HBVdb

Dataset for protein HBe of genotype A

[Download (right click)] [Alignment] [Repertoires]

1086 sequence(s)

>gnl|hbvpro|AB014370_HBe_P-A Product feature CHAIN AB014370_HBe_P-A of FT:mat_peptide AB014370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB064314_HBe_P-A Product feature CHAIN AB064314_HBe_P-A of FT:mat_peptide AB064314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRFPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB076678_HBe_P-A Product feature CHAIN AB076678_HBe_P-A of FT:mat_peptide AB076678_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB076679_HBe_P-A Product feature CHAIN AB076679_HBe_P-A of FT:mat_peptide AB076679_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELTTLATWVGNNLEDHASRDLVVNYVNDNMGLKLRQLLWFHISCLTFGKQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGGSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116076_HBe_P-A Product feature CHAIN AB116076_HBe_P-A of FT:mat_peptide AB116076_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB116077_HBe_P-A Product feature CHAIN AB116077_HBe_P-A of FT:mat_peptide AB116077_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116078_HBe_P-A Product feature CHAIN AB116078_HBe_P-A of FT:mat_peptide AB116078_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116079_HBe_P-A Product feature CHAIN AB116079_HBe_P-A of FT:mat_peptide AB116079_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116080_HBe_P-A Product feature CHAIN AB116080_HBe_P-A of FT:mat_peptide AB116080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116081_HBe_P-A Product feature CHAIN AB116081_HBe_P-A of FT:mat_peptide AB116081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116082_HBe_P-A Product feature CHAIN AB116082_HBe_P-A of FT:mat_peptide AB116082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRCRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116083_HBe_P-A Product feature CHAIN AB116083_HBe_P-A of FT:mat_peptide AB116083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTFQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116084_HBe_P-A Product feature CHAIN AB116084_HBe_P-A of FT:mat_peptide AB116084_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116085_HBe_P-A Product feature CHAIN AB116085_HBe_P-A of FT:mat_peptide AB116085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116086_HBe_P-A Product feature CHAIN AB116086_HBe_P-A of FT:mat_peptide AB116086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATADLLSFLPSDFFPSVQDLLDTASALYREALESPVHCSPH
HTALRQAILCWGELRTLGTWVGNNLDDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116087_HBe_P-A Product feature CHAIN AB116087_HBe_P-A of FT:mat_peptide AB116087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSRH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETAVVRRRVRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116088_HBe_P-A Product feature CHAIN AB116088_HBe_P-A of FT:mat_peptide AB116088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSH
HTALRQAIVCWGELMTLGTWVGNNLEDPESRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB116089_HBe_P-A Product feature CHAIN AB116089_HBe_P-A of FT:mat_peptide AB116089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQASLCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116090_HBe_P-A Product feature CHAIN AB116090_HBe_P-A of FT:mat_peptide AB116090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116091_HBe_P-A Product feature CHAIN AB116091_HBe_P-A of FT:mat_peptide AB116091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116092_HBe_P-A Product feature CHAIN AB116092_HBe_P-A of FT:mat_peptide AB116092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVAALFRDALESPEHCSAH
HTALRQVILCWGELMTLATWVGTNLQDPASRDLVVSYVNDNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116093_HBe_P-A Product feature CHAIN AB116093_HBe_P-A of FT:mat_peptide AB116093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116094_HBe_P-A Product feature CHAIN AB116094_HBe_P-A of FT:mat_peptide AB116094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB126580_HBe_P-A Product feature CHAIN AB126580_HBe_P-A of FT:mat_peptide AB126580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISRTCPTVQASKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB194950_HBe_P-A Product feature CHAIN AB194950_HBe_P-A of FT:mat_peptide AB194950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVTNLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB194951_HBe_P-A Product feature CHAIN AB194951_HBe_P-A of FT:mat_peptide AB194951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVTNLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB194952_HBe_P-A Product feature CHAIN AB194952_HBe_P-A of FT:mat_peptide AB194952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205118_HBe_P-A Product feature CHAIN AB205118_HBe_P-A of FT:mat_peptide AB205118_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222707_HBe_P-A Product feature CHAIN AB222707_HBe_P-A of FT:mat_peptide AB222707_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB241114_HBe_P-A Product feature CHAIN AB241114_HBe_P-A of FT:mat_peptide AB241114_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241115_HBe_P-A Product feature CHAIN AB241115_HBe_P-A of FT:mat_peptide AB241115_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246317_HBe_P-A Product feature CHAIN AB246317_HBe_P-A of FT:mat_peptide AB246317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKVRQLLWFHISCITFGRQTVGEFLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246335_HBe_P-A Product feature CHAIN AB246335_HBe_P-A of FT:mat_peptide AB246335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246336_HBe_P-A Product feature CHAIN AB246336_HBe_P-A of FT:mat_peptide AB246336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246337_HBe_P-A Product feature CHAIN AB246337_HBe_P-A of FT:mat_peptide AB246337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246338_HBe_P-A Product feature CHAIN AB246338_HBe_P-A of FT:mat_peptide AB246338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300366_HBe_P-A Product feature CHAIN AB300366_HBe_P-A of FT:mat_peptide AB300366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300367_HBe_P-A Product feature CHAIN AB300367_HBe_P-A of FT:mat_peptide AB300367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB362931_HBe_P-A Product feature CHAIN AB362931_HBe_P-A of FT:mat_peptide AB362931_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWVELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB453979_HBe_P-A Product feature CHAIN AB453979_HBe_P-A of FT:mat_peptide AB453979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453980_HBe_P-A Product feature CHAIN AB453980_HBe_P-A of FT:mat_peptide AB453980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453981_HBe_P-A Product feature CHAIN AB453981_HBe_P-A of FT:mat_peptide AB453981_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453982_HBe_P-A Product feature CHAIN AB453982_HBe_P-A of FT:mat_peptide AB453982_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSH
HTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB453984_HBe_P-A Product feature CHAIN AB453984_HBe_P-A of FT:mat_peptide AB453984_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453986_HBe_P-A Product feature CHAIN AB453986_HBe_P-A of FT:mat_peptide AB453986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTTLGTWVGNNLQDQTSRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453987_HBe_P-A Product feature CHAIN AB453987_HBe_P-A of FT:mat_peptide AB453987_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453988_HBe_P-A Product feature CHAIN AB453988_HBe_P-A of FT:mat_peptide AB453988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453989_HBe_P-A Product feature CHAIN AB453989_HBe_P-A of FT:mat_peptide AB453989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGREIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRYRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB480036_HBe_P-A Product feature CHAIN AB480036_HBe_P-A of FT:mat_peptide AB480036_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480038_HBe_P-A Product feature CHAIN AB480038_HBe_P-A of FT:mat_peptide AB480038_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480039_HBe_P-A Product feature CHAIN AB480039_HBe_P-A of FT:mat_peptide AB480039_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480040_HBe_P-A Product feature CHAIN AB480040_HBe_P-A of FT:mat_peptide AB480040_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480041_HBe_P-A Product feature CHAIN AB480041_HBe_P-A of FT:mat_peptide AB480041_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB549213_HBe_P-A Product feature CHAIN AB549213_HBe_P-A of FT:mat_peptide AB549213_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697487_HBe_P-A Product feature CHAIN AB697487_HBe_P-A of FT:mat_peptide AB697487_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCXCPTVQASKLCLGWLWGMDIDPYKEFGAXVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMXLATWVGXNLEDPASRXLVVXYVNXNMGLKIRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697488_HBe_P-A Product feature CHAIN AB697488_HBe_P-A of FT:mat_peptide AB697488_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697489_HBe_P-A Product feature CHAIN AB697489_HBe_P-A of FT:mat_peptide AB697489_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697491_HBe_P-A Product feature CHAIN AB697491_HBe_P-A of FT:mat_peptide AB697491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRXTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697492_HBe_P-A Product feature CHAIN AB697492_HBe_P-A of FT:mat_peptide AB697492_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697493_HBe_P-A Product feature CHAIN AB697493_HBe_P-A of FT:mat_peptide AB697493_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697495_HBe_P-A Product feature CHAIN AB697495_HBe_P-A of FT:mat_peptide AB697495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697496_HBe_P-A Product feature CHAIN AB697496_HBe_P-A of FT:mat_peptide AB697496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697497_HBe_P-A Product feature CHAIN AB697497_HBe_P-A of FT:mat_peptide AB697497_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697498_HBe_P-A Product feature CHAIN AB697498_HBe_P-A of FT:mat_peptide AB697498_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCXCPTVQASKLCLGWLWXMDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMXLATWVGXNLEDXASRDLVVXYVNXNMGXKIRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697499_HBe_P-A Product feature CHAIN AB697499_HBe_P-A of FT:mat_peptide AB697499_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697501_HBe_P-A Product feature CHAIN AB697501_HBe_P-A of FT:mat_peptide AB697501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697503_HBe_P-A Product feature CHAIN AB697503_HBe_P-A of FT:mat_peptide AB697503_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697504_HBe_P-A Product feature CHAIN AB697504_HBe_P-A of FT:mat_peptide AB697504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697505_HBe_P-A Product feature CHAIN AB697505_HBe_P-A of FT:mat_peptide AB697505_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697506_HBe_P-A Product feature CHAIN AB697506_HBe_P-A of FT:mat_peptide AB697506_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697507_HBe_P-A Product feature CHAIN AB697507_HBe_P-A of FT:mat_peptide AB697507_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697508_HBe_P-A Product feature CHAIN AB697508_HBe_P-A of FT:mat_peptide AB697508_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697509_HBe_P-A Product feature CHAIN AB697509_HBe_P-A of FT:mat_peptide AB697509_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697511_HBe_P-A Product feature CHAIN AB697511_HBe_P-A of FT:mat_peptide AB697511_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697512_HBe_P-A Product feature CHAIN AB697512_HBe_P-A of FT:mat_peptide AB697512_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775198_HBe_P-A Product feature CHAIN AB775198_HBe_P-A of FT:mat_peptide AB775198_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775199_HBe_P-A Product feature CHAIN AB775199_HBe_P-A of FT:mat_peptide AB775199_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775200_HBe_P-A Product feature CHAIN AB775200_HBe_P-A of FT:mat_peptide AB775200_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775201_HBe_P-A Product feature CHAIN AB775201_HBe_P-A of FT:mat_peptide AB775201_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937791_HBe_P-A Product feature CHAIN AB937791_HBe_P-A of FT:mat_peptide AB937791_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937792_HBe_P-A Product feature CHAIN AB937792_HBe_P-A of FT:mat_peptide AB937792_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937793_HBe_P-A Product feature CHAIN AB937793_HBe_P-A of FT:mat_peptide AB937793_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937794_HBe_P-A Product feature CHAIN AB937794_HBe_P-A of FT:mat_peptide AB937794_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937795_HBe_P-A Product feature CHAIN AB937795_HBe_P-A of FT:mat_peptide AB937795_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|AB937796_HBe_P-A Product feature CHAIN AB937796_HBe_P-A of FT:mat_peptide AB937796_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937797_HBe_P-A Product feature CHAIN AB937797_HBe_P-A of FT:mat_peptide AB937797_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVKDLLDTASALYRDALESPEHCSAH
HTALRQVSLCWVELMTLATWVGNNLQDPASRDQVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVXRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|AB937798_HBe_P-A Product feature CHAIN AB937798_HBe_P-A of FT:mat_peptide AB937798_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF043560_HBe_P-A Product feature CHAIN AF043560_HBe_P-A of FT:mat_peptide AF043560_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF043580_HBe_P-A Product feature CHAIN AF043580_HBe_P-A of FT:mat_peptide AF043580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090839_HBe_P-A Product feature CHAIN AF090839_HBe_P-A of FT:mat_peptide AF090839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090840_HBe_P-A Product feature CHAIN AF090840_HBe_P-A of FT:mat_peptide AF090840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090841_HBe_P-A Product feature CHAIN AF090841_HBe_P-A of FT:mat_peptide AF090841_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090842_HBe_P-A Product feature CHAIN AF090842_HBe_P-A of FT:mat_peptide AF090842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297622_HBe_P-A Product feature CHAIN AF297622_HBe_P-A of FT:mat_peptide AF297622_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297623_HBe_P-A Product feature CHAIN AF297623_HBe_P-A of FT:mat_peptide AF297623_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297624_HBe_P-A Product feature CHAIN AF297624_HBe_P-A of FT:mat_peptide AF297624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297625_HBe_P-A Product feature CHAIN AF297625_HBe_P-A of FT:mat_peptide AF297625_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRETILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350080_HBe_P-A Product feature CHAIN AF350080_HBe_P-A of FT:mat_peptide AF350080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1196). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350081_HBe_P-A Product feature CHAIN AF350081_HBe_P-A of FT:mat_peptide AF350081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1199). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVPDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTLPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350082_HBe_P-A Product feature CHAIN AF350082_HBe_P-A of FT:mat_peptide AF350082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1213). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350083_HBe_P-A Product feature CHAIN AF350083_HBe_P-A of FT:mat_peptide AF350083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1314F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIICWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350084_HBe_P-A Product feature CHAIN AF350084_HBe_P-A of FT:mat_peptide AF350084_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1315F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350085_HBe_P-A Product feature CHAIN AF350085_HBe_P-A of FT:mat_peptide AF350085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1316F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350086_HBe_P-A Product feature CHAIN AF350086_HBe_P-A of FT:mat_peptide AF350086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1330F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350087_HBe_P-A Product feature CHAIN AF350087_HBe_P-A of FT:mat_peptide AF350087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1486F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350088_HBe_P-A Product feature CHAIN AF350088_HBe_P-A of FT:mat_peptide AF350088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1487F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350089_HBe_P-A Product feature CHAIN AF350089_HBe_P-A of FT:mat_peptide AF350089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1606). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350090_HBe_P-A Product feature CHAIN AF350090_HBe_P-A of FT:mat_peptide AF350090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1687). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350091_HBe_P-A Product feature CHAIN AF350091_HBe_P-A of FT:mat_peptide AF350091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1730F202). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350092_HBe_P-A Product feature CHAIN AF350092_HBe_P-A of FT:mat_peptide AF350092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1746). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350093_HBe_P-A Product feature CHAIN AF350093_HBe_P-A of FT:mat_peptide AF350093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1747). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350094_HBe_P-A Product feature CHAIN AF350094_HBe_P-A of FT:mat_peptide AF350094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1800). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350095_HBe_P-A Product feature CHAIN AF350095_HBe_P-A of FT:mat_peptide AF350095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1815F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350096_HBe_P-A Product feature CHAIN AF350096_HBe_P-A of FT:mat_peptide AF350096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1817F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350097_HBe_P-A Product feature CHAIN AF350097_HBe_P-A of FT:mat_peptide AF350097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1835F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350098_HBe_P-A Product feature CHAIN AF350098_HBe_P-A of FT:mat_peptide AF350098_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1841F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419534_HBe_P-A Product feature CHAIN AF419534_HBe_P-A of FT:mat_peptide AF419534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I5-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHSSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419535_HBe_P-A Product feature CHAIN AF419535_HBe_P-A of FT:mat_peptide AF419535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I6-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTXCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419536_HBe_P-A Product feature CHAIN AF419536_HBe_P-A of FT:mat_peptide AF419536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I7-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTVSALYREALESPEHCSPH
HTAIRQAILCWGQLMTLATWVGNNLQDPASRDLVVNYVNDNMGLMIRQLLWFHSSCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRHRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF536524_HBe_P-A Product feature CHAIN AF536524_HBe_P-A of FT:mat_peptide AF536524_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF537371_HBe_P-A Product feature CHAIN AF537371_HBe_P-A of FT:mat_peptide AF537371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|AF537372_HBe_P-A Product feature CHAIN AF537372_HBe_P-A of FT:mat_peptide AF537372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRCRGRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AJ012207_HBe_P-A Product feature CHAIN AJ012207_HBe_P-A of FT:mat_peptide AJ012207_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ309369_HBe_P-A Product feature CHAIN AJ309369_HBe_P-A of FT:mat_peptide AJ309369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCQIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ309370_HBe_P-A Product feature CHAIN AJ309370_HBe_P-A of FT:mat_peptide AJ309370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ309371_HBe_P-A Product feature CHAIN AJ309371_HBe_P-A of FT:mat_peptide AJ309371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRIPPP
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ344115_HBe_P-A Product feature CHAIN AJ344115_HBe_P-A of FT:mat_peptide AJ344115_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKDTVLEYLVSFGVWIRTPPA
YRPPNAPILSSLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AJ627226_HBe_P-A Product feature CHAIN AJ627226_HBe_P-A of FT:mat_peptide AJ627226_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLVISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPPDFFPSARDLLDTASALFRDALESPEHCSAH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHLSCIMFGRDIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627228_HBe_P-A Product feature CHAIN AJ627228_HBe_P-A of FT:mat_peptide AJ627228_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLVISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQCVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPA
YRPPNAPILSILPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AM180624_HBe_P-A Product feature CHAIN AM180624_HBe_P-A of FT:mat_peptide AM180624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSXH
HTAXRQAILCWGXVMTLATWVGXNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|AM184125_HBe_P-A Product feature CHAIN AM184125_HBe_P-A of FT:mat_peptide AM184125_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM184126_HBe_P-A Product feature CHAIN AM184126_HBe_P-A of FT:mat_peptide AM184126_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM282986_HBe_P-A Product feature CHAIN AM282986_HBe_P-A of FT:mat_peptide AM282986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM295795_HBe_P-A Product feature CHAIN AM295795_HBe_P-A of FT:mat_peptide AM295795_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM295796_HBe_P-A Product feature CHAIN AM295796_HBe_P-A of FT:mat_peptide AM295796_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM295797_HBe_P-A Product feature CHAIN AM295797_HBe_P-A of FT:mat_peptide AM295797_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM410963_HBe_P-A Product feature CHAIN AM410963_HBe_P-A of FT:mat_peptide AM410963_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494718_HBe_P-A Product feature CHAIN AM494718_HBe_P-A of FT:mat_peptide AM494718_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY034878_HBe_P-A Product feature CHAIN AY034878_HBe_P-A of FT:mat_peptide AY034878_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLDDPASKDLVVNYVNTKHGLKIRQLLWVHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRTTNAPILSTLPEATVVRQRDRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY128092_HBe_P-A Product feature CHAIN AY128092_HBe_P-A of FT:mat_peptide AY128092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY152726_HBe_P-A Product feature CHAIN AY152726_HBe_P-A of FT:mat_peptide AY152726_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPECTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161138_HBe_P-A Product feature CHAIN AY161138_HBe_P-A of FT:mat_peptide AY161138_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161139_HBe_P-A Product feature CHAIN AY161139_HBe_P-A of FT:mat_peptide AY161139_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161142_HBe_P-A Product feature CHAIN AY161142_HBe_P-A of FT:mat_peptide AY161142_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCCGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPA
YRPPNAPILSALPETTVVRRRDRGRSPRRRLPSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161143_HBe_P-A Product feature CHAIN AY161143_HBe_P-A of FT:mat_peptide AY161143_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCCGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPA
YRPPNAPILSALPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161144_HBe_P-A Product feature CHAIN AY161144_HBe_P-A of FT:mat_peptide AY161144_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCCGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPA
YRPPNAPILSALPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233274_HBe_P-A Product feature CHAIN AY233274_HBe_P-A of FT:mat_peptide AY233274_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233275_HBe_P-A Product feature CHAIN AY233275_HBe_P-A of FT:mat_peptide AY233275_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233276_HBe_P-A Product feature CHAIN AY233276_HBe_P-A of FT:mat_peptide AY233276_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233278_HBe_P-A Product feature CHAIN AY233278_HBe_P-A of FT:mat_peptide AY233278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233279_HBe_P-A Product feature CHAIN AY233279_HBe_P-A of FT:mat_peptide AY233279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTAHRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233280_HBe_P-A Product feature CHAIN AY233280_HBe_P-A of FT:mat_peptide AY233280_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233281_HBe_P-A Product feature CHAIN AY233281_HBe_P-A of FT:mat_peptide AY233281_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AY233282_HBe_P-A Product feature CHAIN AY233282_HBe_P-A of FT:mat_peptide AY233282_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233283_HBe_P-A Product feature CHAIN AY233283_HBe_P-A of FT:mat_peptide AY233283_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233284_HBe_P-A Product feature CHAIN AY233284_HBe_P-A of FT:mat_peptide AY233284_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233285_HBe_P-A Product feature CHAIN AY233285_HBe_P-A of FT:mat_peptide AY233285_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAQYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233286_HBe_P-A Product feature CHAIN AY233286_HBe_P-A of FT:mat_peptide AY233286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233287_HBe_P-A Product feature CHAIN AY233287_HBe_P-A of FT:mat_peptide AY233287_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIITCTCPTLQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMALATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233288_HBe_P-A Product feature CHAIN AY233288_HBe_P-A of FT:mat_peptide AY233288_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233289_HBe_P-A Product feature CHAIN AY233289_HBe_P-A of FT:mat_peptide AY233289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233290_HBe_P-A Product feature CHAIN AY233290_HBe_P-A of FT:mat_peptide AY233290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLASWVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY373428_HBe_P-A Product feature CHAIN AY373428_HBe_P-A of FT:mat_peptide AY373428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY373429_HBe_P-A Product feature CHAIN AY373429_HBe_P-A of FT:mat_peptide AY373429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWSHISCLTFGRETALEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPSRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY373432_HBe_P-A Product feature CHAIN AY373432_HBe_P-A of FT:mat_peptide AY373432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603429_HBe_P-A Product feature CHAIN AY603429_HBe_P-A of FT:mat_peptide AY603429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 15T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603430_HBe_P-A Product feature CHAIN AY603430_HBe_P-A of FT:mat_peptide AY603430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 19T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603431_HBe_P-A Product feature CHAIN AY603431_HBe_P-A of FT:mat_peptide AY603431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSNRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603432_HBe_P-A Product feature CHAIN AY603432_HBe_P-A of FT:mat_peptide AY603432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVLDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603435_HBe_P-A Product feature CHAIN AY603435_HBe_P-A of FT:mat_peptide AY603435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 31T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603436_HBe_P-A Product feature CHAIN AY603436_HBe_P-A of FT:mat_peptide AY603436_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 32T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603438_HBe_P-A Product feature CHAIN AY603438_HBe_P-A of FT:mat_peptide AY603438_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 36T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSNRRRRAQSPRRRRSQSRESQC
>gnl|hbvpro|AY603441_HBe_P-A Product feature CHAIN AY603441_HBe_P-A of FT:mat_peptide AY603441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 59T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603446_HBe_P-A Product feature CHAIN AY603446_HBe_P-A of FT:mat_peptide AY603446_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY707087_HBe_P-A Product feature CHAIN AY707087_HBe_P-A of FT:mat_peptide AY707087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738139_HBe_P-A Product feature CHAIN AY738139_HBe_P-A of FT:mat_peptide AY738139_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=214 residues).
XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738140_HBe_P-A Product feature CHAIN AY738140_HBe_P-A of FT:mat_peptide AY738140_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=214 residues).
XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738141_HBe_P-A Product feature CHAIN AY738141_HBe_P-A of FT:mat_peptide AY738141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=214 residues).
XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738142_HBe_P-A Product feature CHAIN AY738142_HBe_P-A of FT:mat_peptide AY738142_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=214 residues).
XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738143_HBe_P-A Product feature CHAIN AY738143_HBe_P-A of FT:mat_peptide AY738143_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=214 residues).
XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY862867_HBe_P-A Product feature CHAIN AY862867_HBe_P-A of FT:mat_peptide AY862867_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCPGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY862868_HBe_P-A Product feature CHAIN AY862868_HBe_P-A of FT:mat_peptide AY862868_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY902775_HBe_P-A Product feature CHAIN AY902775_HBe_P-A of FT:mat_peptide AY902775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY903452_HBe_P-A Product feature CHAIN AY903452_HBe_P-A of FT:mat_peptide AY903452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY934763_HBe_P-A Product feature CHAIN AY934763_HBe_P-A of FT:mat_peptide AY934763_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934764_HBe_P-A Product feature CHAIN AY934764_HBe_P-A of FT:mat_peptide AY934764_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934765_HBe_P-A Product feature CHAIN AY934765_HBe_P-A of FT:mat_peptide AY934765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934766_HBe_P-A Product feature CHAIN AY934766_HBe_P-A of FT:mat_peptide AY934766_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934767_HBe_P-A Product feature CHAIN AY934767_HBe_P-A of FT:mat_peptide AY934767_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934768_HBe_P-A Product feature CHAIN AY934768_HBe_P-A of FT:mat_peptide AY934768_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934769_HBe_P-A Product feature CHAIN AY934769_HBe_P-A of FT:mat_peptide AY934769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934770_HBe_P-A Product feature CHAIN AY934770_HBe_P-A of FT:mat_peptide AY934770_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934771_HBe_P-A Product feature CHAIN AY934771_HBe_P-A of FT:mat_peptide AY934771_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934772_HBe_P-A Product feature CHAIN AY934772_HBe_P-A of FT:mat_peptide AY934772_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934773_HBe_P-A Product feature CHAIN AY934773_HBe_P-A of FT:mat_peptide AY934773_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934774_HBe_P-A Product feature CHAIN AY934774_HBe_P-A of FT:mat_peptide AY934774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ020002_HBe_P-A Product feature CHAIN DQ020002_HBe_P-A of FT:mat_peptide DQ020002_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ020003_HBe_P-A Product feature CHAIN DQ020003_HBe_P-A of FT:mat_peptide DQ020003_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315784_HBe_P-A Product feature CHAIN DQ315784_HBe_P-A of FT:mat_peptide DQ315784_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315786_HBe_P-A Product feature CHAIN DQ315786_HBe_P-A of FT:mat_peptide DQ315786_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ788725_HBe_P-A Product feature CHAIN DQ788725_HBe_P-A of FT:mat_peptide DQ788725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EF103278_HBe_P-A Product feature CHAIN EF103278_HBe_P-A of FT:mat_peptide EF103278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF208113_HBe_P-A Product feature CHAIN EF208113_HBe_P-A of FT:mat_peptide EF208113_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU054331_HBe_C-A Product feature CHAIN EU054331_HBe_C-A of FT:mat_peptide EU054331_HBe_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU086721_HBe_P-A Product feature CHAIN EU086721_HBe_P-A of FT:mat_peptide EU086721_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185746_HBe_P-A Product feature CHAIN EU185746_HBe_P-A of FT:mat_peptide EU185746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YXPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185750_HBe_P-A Product feature CHAIN EU185750_HBe_P-A of FT:mat_peptide EU185750_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|EU185765_HBe_P-A Product feature CHAIN EU185765_HBe_P-A of FT:mat_peptide EU185765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSMLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|EU185774_HBe_P-A Product feature CHAIN EU185774_HBe_P-A of FT:mat_peptide EU185774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISRACPTVZASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLBTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185775_HBe_P-A Product feature CHAIN EU185775_HBe_P-A of FT:mat_peptide EU185775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLXLIISCTCPTVGASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|EU185776_HBe_P-A Product feature CHAIN EU185776_HBe_P-A of FT:mat_peptide EU185776_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLXTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPPSRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YKPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185777_HBe_P-A Product feature CHAIN EU185777_HBe_P-A of FT:mat_peptide EU185777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIIXCTCPTVQASKLCXGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLXTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPPSRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YKPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSHSPRRRRSQSRESQC
>gnl|hbvpro|EU185786_HBe_P-A Product feature CHAIN EU185786_HBe_P-A of FT:mat_peptide EU185786_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU11). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185787_HBe_P-A Product feature CHAIN EU185787_HBe_P-A of FT:mat_peptide EU185787_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185789_HBe_P-A Product feature CHAIN EU185789_HBe_P-A of FT:mat_peptide EU185789_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU304331_HBe_P-A Product feature CHAIN EU304331_HBe_P-A of FT:mat_peptide EU304331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA84). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
IQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSSH
HTALRQAILCWGELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDXVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRQRHRGRSPRGRTPSPRRXRSKSPRRRRSQSRESQC
>gnl|hbvpro|EU366129_HBe_P-A Product feature CHAIN EU366129_HBe_P-A of FT:mat_peptide EU366129_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSPH
HTAIRQAILCWGELMTLATWVGNNLXDPASRDLVVNYVNTHMGLKIRQLLWFHXSCICFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRCRVRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU410082_HBe_P-A Product feature CHAIN EU410082_HBe_P-A of FT:mat_peptide EU410082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414048_HBe_P-A Product feature CHAIN EU414048_HBe_P-A of FT:mat_peptide EU414048_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
LQLFHLCLITSCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414049_HBe_P-A Product feature CHAIN EU414049_HBe_P-A of FT:mat_peptide EU414049_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MXLFHLCLIISCTCPTVQASXLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWXXXXTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETTVXRRRDRGRSPRRRTPSPRRRRSQSPRRRRXQSRESQC
>gnl|hbvpro|EU414050_HBe_P-A Product feature CHAIN EU414050_HBe_P-A of FT:mat_peptide EU414050_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGDVTNLATWVGTNLNDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414052_HBe_P-A Product feature CHAIN EU414052_HBe_P-A of FT:mat_peptide EU414052_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPH
HTALRQAILCWADVTNLATWVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414133_HBe_P-A Product feature CHAIN EU414133_HBe_P-A of FT:mat_peptide EU414133_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPH
HTALRQAILCWADVTNLATWVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594383_HBe_P-A Product feature CHAIN EU594383_HBe_P-A of FT:mat_peptide EU594383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594384_HBe_P-A Product feature CHAIN EU594384_HBe_P-A of FT:mat_peptide EU594384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594385_HBe_P-A Product feature CHAIN EU594385_HBe_P-A of FT:mat_peptide EU594385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594386_HBe_P-A Product feature CHAIN EU594386_HBe_P-A of FT:mat_peptide EU594386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594387_HBe_P-A Product feature CHAIN EU594387_HBe_P-A of FT:mat_peptide EU594387_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594388_HBe_P-A Product feature CHAIN EU594388_HBe_P-A of FT:mat_peptide EU594388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594389_HBe_P-A Product feature CHAIN EU594389_HBe_P-A of FT:mat_peptide EU594389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594390_HBe_P-A Product feature CHAIN EU594390_HBe_P-A of FT:mat_peptide EU594390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594391_HBe_P-A Product feature CHAIN EU594391_HBe_P-A of FT:mat_peptide EU594391_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594392_HBe_P-A Product feature CHAIN EU594392_HBe_P-A of FT:mat_peptide EU594392_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594393_HBe_P-A Product feature CHAIN EU594393_HBe_P-A of FT:mat_peptide EU594393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594394_HBe_P-A Product feature CHAIN EU594394_HBe_P-A of FT:mat_peptide EU594394_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594395_HBe_P-A Product feature CHAIN EU594395_HBe_P-A of FT:mat_peptide EU594395_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859898_HBe_P-A Product feature CHAIN EU859898_HBe_P-A of FT:mat_peptide EU859898_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859899_HBe_P-A Product feature CHAIN EU859899_HBe_P-A of FT:mat_peptide EU859899_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859900_HBe_P-A Product feature CHAIN EU859900_HBe_P-A of FT:mat_peptide EU859900_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859901_HBe_P-A Product feature CHAIN EU859901_HBe_P-A of FT:mat_peptide EU859901_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859902_HBe_P-A Product feature CHAIN EU859902_HBe_P-A of FT:mat_peptide EU859902_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859903_HBe_P-A Product feature CHAIN EU859903_HBe_P-A of FT:mat_peptide EU859903_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859904_HBe_P-A Product feature CHAIN EU859904_HBe_P-A of FT:mat_peptide EU859904_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859905_HBe_P-A Product feature CHAIN EU859905_HBe_P-A of FT:mat_peptide EU859905_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859906_HBe_P-A Product feature CHAIN EU859906_HBe_P-A of FT:mat_peptide EU859906_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859907_HBe_P-A Product feature CHAIN EU859907_HBe_P-A of FT:mat_peptide EU859907_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859908_HBe_P-A Product feature CHAIN EU859908_HBe_P-A of FT:mat_peptide EU859908_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859909_HBe_P-A Product feature CHAIN EU859909_HBe_P-A of FT:mat_peptide EU859909_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859910_HBe_P-A Product feature CHAIN EU859910_HBe_P-A of FT:mat_peptide EU859910_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859911_HBe_P-A Product feature CHAIN EU859911_HBe_P-A of FT:mat_peptide EU859911_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859912_HBe_P-A Product feature CHAIN EU859912_HBe_P-A of FT:mat_peptide EU859912_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVGRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859913_HBe_P-A Product feature CHAIN EU859913_HBe_P-A of FT:mat_peptide EU859913_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859914_HBe_P-A Product feature CHAIN EU859914_HBe_P-A of FT:mat_peptide EU859914_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859915_HBe_P-A Product feature CHAIN EU859915_HBe_P-A of FT:mat_peptide EU859915_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859916_HBe_P-A Product feature CHAIN EU859916_HBe_P-A of FT:mat_peptide EU859916_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859917_HBe_P-A Product feature CHAIN EU859917_HBe_P-A of FT:mat_peptide EU859917_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859918_HBe_P-A Product feature CHAIN EU859918_HBe_P-A of FT:mat_peptide EU859918_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859919_HBe_P-A Product feature CHAIN EU859919_HBe_P-A of FT:mat_peptide EU859919_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859920_HBe_P-A Product feature CHAIN EU859920_HBe_P-A of FT:mat_peptide EU859920_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859921_HBe_P-A Product feature CHAIN EU859921_HBe_P-A of FT:mat_peptide EU859921_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859922_HBe_P-A Product feature CHAIN EU859922_HBe_P-A of FT:mat_peptide EU859922_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859923_HBe_P-A Product feature CHAIN EU859923_HBe_P-A of FT:mat_peptide EU859923_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859924_HBe_P-A Product feature CHAIN EU859924_HBe_P-A of FT:mat_peptide EU859924_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859925_HBe_P-A Product feature CHAIN EU859925_HBe_P-A of FT:mat_peptide EU859925_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859926_HBe_P-A Product feature CHAIN EU859926_HBe_P-A of FT:mat_peptide EU859926_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859927_HBe_P-A Product feature CHAIN EU859927_HBe_P-A of FT:mat_peptide EU859927_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859928_HBe_P-A Product feature CHAIN EU859928_HBe_P-A of FT:mat_peptide EU859928_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859929_HBe_P-A Product feature CHAIN EU859929_HBe_P-A of FT:mat_peptide EU859929_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859930_HBe_P-A Product feature CHAIN EU859930_HBe_P-A of FT:mat_peptide EU859930_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859931_HBe_P-A Product feature CHAIN EU859931_HBe_P-A of FT:mat_peptide EU859931_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859932_HBe_P-A Product feature CHAIN EU859932_HBe_P-A of FT:mat_peptide EU859932_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859933_HBe_P-A Product feature CHAIN EU859933_HBe_P-A of FT:mat_peptide EU859933_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859934_HBe_P-A Product feature CHAIN EU859934_HBe_P-A of FT:mat_peptide EU859934_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859935_HBe_P-A Product feature CHAIN EU859935_HBe_P-A of FT:mat_peptide EU859935_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859936_HBe_P-A Product feature CHAIN EU859936_HBe_P-A of FT:mat_peptide EU859936_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859937_HBe_P-A Product feature CHAIN EU859937_HBe_P-A of FT:mat_peptide EU859937_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859939_HBe_P-A Product feature CHAIN EU859939_HBe_P-A of FT:mat_peptide EU859939_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859940_HBe_P-A Product feature CHAIN EU859940_HBe_P-A of FT:mat_peptide EU859940_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859941_HBe_P-A Product feature CHAIN EU859941_HBe_P-A of FT:mat_peptide EU859941_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859942_HBe_P-A Product feature CHAIN EU859942_HBe_P-A of FT:mat_peptide EU859942_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859943_HBe_P-A Product feature CHAIN EU859943_HBe_P-A of FT:mat_peptide EU859943_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859944_HBe_P-A Product feature CHAIN EU859944_HBe_P-A of FT:mat_peptide EU859944_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859945_HBe_P-A Product feature CHAIN EU859945_HBe_P-A of FT:mat_peptide EU859945_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859946_HBe_P-A Product feature CHAIN EU859946_HBe_P-A of FT:mat_peptide EU859946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859947_HBe_P-A Product feature CHAIN EU859947_HBe_P-A of FT:mat_peptide EU859947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859948_HBe_P-A Product feature CHAIN EU859948_HBe_P-A of FT:mat_peptide EU859948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859949_HBe_P-A Product feature CHAIN EU859949_HBe_P-A of FT:mat_peptide EU859949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859950_HBe_P-A Product feature CHAIN EU859950_HBe_P-A of FT:mat_peptide EU859950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859951_HBe_P-A Product feature CHAIN EU859951_HBe_P-A of FT:mat_peptide EU859951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859952_HBe_P-A Product feature CHAIN EU859952_HBe_P-A of FT:mat_peptide EU859952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|EU859953_HBe_P-A Product feature CHAIN EU859953_HBe_P-A of FT:mat_peptide EU859953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859954_HBe_P-A Product feature CHAIN EU859954_HBe_P-A of FT:mat_peptide EU859954_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859955_HBe_P-A Product feature CHAIN EU859955_HBe_P-A of FT:mat_peptide EU859955_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859956_HBe_P-A Product feature CHAIN EU859956_HBe_P-A of FT:mat_peptide EU859956_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349222_HBe_P-A Product feature CHAIN FJ349222_HBe_P-A of FT:mat_peptide FJ349222_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPV
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349224_HBe_P-A Product feature CHAIN FJ349224_HBe_P-A of FT:mat_peptide FJ349224_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349296_HBe_P-A Product feature CHAIN FJ349296_HBe_P-A of FT:mat_peptide FJ349296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLNTASALYREALKSPGHCSPH
HTALRQAILCWGELMTLATWVGNNLENPASRDLVVNYVNTNMGLKIRQLWGFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692554_HBe_P-A Product feature CHAIN FJ692554_HBe_P-A of FT:mat_peptide FJ692554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPV
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692555_HBe_P-A Product feature CHAIN FJ692555_HBe_P-A of FT:mat_peptide FJ692555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24074). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWDMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASXLYREALESPEHCSPX
HTAIRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETXVVRCRDRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692557_HBe_P-A Product feature CHAIN FJ692557_HBe_P-A of FT:mat_peptide FJ692557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692558_HBe_P-A Product feature CHAIN FJ692558_HBe_P-A of FT:mat_peptide FJ692558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDAASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692559_HBe_P-A Product feature CHAIN FJ692559_HBe_P-A of FT:mat_peptide FJ692559_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|FJ692561_HBe_P-A Product feature CHAIN FJ692561_HBe_P-A of FT:mat_peptide FJ692561_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMTLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETAVVRCRARGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692562_HBe_P-A Product feature CHAIN FJ692562_HBe_P-A of FT:mat_peptide FJ692562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692563_HBe_P-A Product feature CHAIN FJ692563_HBe_P-A of FT:mat_peptide FJ692563_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692564_HBe_P-A Product feature CHAIN FJ692564_HBe_P-A of FT:mat_peptide FJ692564_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVTTLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCXTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692565_HBe_P-A Product feature CHAIN FJ692565_HBe_P-A of FT:mat_peptide FJ692565_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVTTLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETTVVRRRXRGRSPRRRTPSPRRRRSQSPRRRRSQSRZSQC
>gnl|hbvpro|FJ692566_HBe_P-A Product feature CHAIN FJ692566_HBe_P-A of FT:mat_peptide FJ692566_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRESLESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692567_HBe_P-A Product feature CHAIN FJ692567_HBe_P-A of FT:mat_peptide FJ692567_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDGLESPEHCXPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRCRNRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|FJ692570_HBe_P-A Product feature CHAIN FJ692570_HBe_P-A of FT:mat_peptide FJ692570_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVTNLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692571_HBe_P-A Product feature CHAIN FJ692571_HBe_P-A of FT:mat_peptide FJ692571_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692573_HBe_P-A Product feature CHAIN FJ692573_HBe_P-A of FT:mat_peptide FJ692573_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50014). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMTLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPP
YRPPNAPILSSLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692574_HBe_P-A Product feature CHAIN FJ692574_HBe_P-A of FT:mat_peptide FJ692574_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692575_HBe_P-A Product feature CHAIN FJ692575_HBe_P-A of FT:mat_peptide FJ692575_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692576_HBe_P-A Product feature CHAIN FJ692576_HBe_P-A of FT:mat_peptide FJ692576_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRGRPRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692577_HBe_P-A Product feature CHAIN FJ692577_HBe_P-A of FT:mat_peptide FJ692577_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAXLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGXXTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692578_HBe_P-A Product feature CHAIN FJ692578_HBe_P-A of FT:mat_peptide FJ692578_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692579_HBe_P-A Product feature CHAIN FJ692579_HBe_P-A of FT:mat_peptide FJ692579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692580_HBe_P-A Product feature CHAIN FJ692580_HBe_P-A of FT:mat_peptide FJ692580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692581_HBe_P-A Product feature CHAIN FJ692581_HBe_P-A of FT:mat_peptide FJ692581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692582_HBe_P-A Product feature CHAIN FJ692582_HBe_P-A of FT:mat_peptide FJ692582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692583_HBe_P-A Product feature CHAIN FJ692583_HBe_P-A of FT:mat_peptide FJ692583_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692584_HBe_P-A Product feature CHAIN FJ692584_HBe_P-A of FT:mat_peptide FJ692584_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692585_HBe_P-A Product feature CHAIN FJ692585_HBe_P-A of FT:mat_peptide FJ692585_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692586_HBe_P-A Product feature CHAIN FJ692586_HBe_P-A of FT:mat_peptide FJ692586_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSARDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDLTTLGSWVGNNLEDQASRALVVNYVDTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692587_HBe_P-A Product feature CHAIN FJ692587_HBe_P-A of FT:mat_peptide FJ692587_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGDVMTLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692588_HBe_P-A Product feature CHAIN FJ692588_HBe_P-A of FT:mat_peptide FJ692588_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=215 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRQGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692590_HBe_P-A Product feature CHAIN FJ692590_HBe_P-A of FT:mat_peptide FJ692590_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692591_HBe_P-A Product feature CHAIN FJ692591_HBe_P-A of FT:mat_peptide FJ692591_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692592_HBe_P-A Product feature CHAIN FJ692592_HBe_P-A of FT:mat_peptide FJ692592_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREGLESPEHCSPH
HTALRQAILXWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|FJ692593_HBe_P-A Product feature CHAIN FJ692593_HBe_P-A of FT:mat_peptide FJ692593_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPVSRDLVVNYVNTNMGLRIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YXPQNAPILSTLPETXVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692595_HBe_P-A Product feature CHAIN FJ692595_HBe_P-A of FT:mat_peptide FJ692595_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNDNMGIKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPP
YRPLNAPILSTLPETTVVRQRYRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692596_HBe_P-A Product feature CHAIN FJ692596_HBe_P-A of FT:mat_peptide FJ692596_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHTSSITFGREXVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692597_HBe_P-A Product feature CHAIN FJ692597_HBe_P-A of FT:mat_peptide FJ692597_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIIXCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFXEALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDQVVNYVNXNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETAVVRXRXRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692598_HBe_P-A Product feature CHAIN FJ692598_HBe_P-A of FT:mat_peptide FJ692598_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGEVMBLGNWVGNNLEDXASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPP
YRPXNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692599_HBe_P-A Product feature CHAIN FJ692599_HBe_P-A of FT:mat_peptide FJ692599_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTAIRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPVNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692600_HBe_P-A Product feature CHAIN FJ692600_HBe_P-A of FT:mat_peptide FJ692600_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYRXALESPEHCSPH
HTALRQAXLCWGELMTLATWVGNNLEDPASRDXVVNYVNXNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRXRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692601_HBe_P-A Product feature CHAIN FJ692601_HBe_P-A of FT:mat_peptide FJ692601_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692602_HBe_P-A Product feature CHAIN FJ692602_HBe_P-A of FT:mat_peptide FJ692602_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=214 residues).
TQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALHREALESPEHCSPH
HTALRQAILCWGDLSTLATWVGNNLADPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692603_HBe_P-A Product feature CHAIN FJ692603_HBe_P-A of FT:mat_peptide FJ692603_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDHYKEFGAXVELLSFLPSDFYPSVRDLLDTATALYRXXLESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692604_HBe_P-A Product feature CHAIN FJ692604_HBe_P-A of FT:mat_peptide FJ692604_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDLMTLATWVGNNLEDPASRDLVVNYVNTTTGLRIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692605_HBe_P-A Product feature CHAIN FJ692605_HBe_P-A of FT:mat_peptide FJ692605_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLXDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|FJ692606_HBe_P-A Product feature CHAIN FJ692606_HBe_P-A of FT:mat_peptide FJ692606_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692607_HBe_P-A Product feature CHAIN FJ692607_HBe_P-A of FT:mat_peptide FJ692607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPP
YRPQNAPILSTLPETTVVRRGDRGRSLRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692608_HBe_P-A Product feature CHAIN FJ692608_HBe_P-A of FT:mat_peptide FJ692608_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692611_HBe_P-A Product feature CHAIN FJ692611_HBe_P-A of FT:mat_peptide FJ692611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTFQASKLCLGWLWGMDIDTYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLASWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692612_HBe_P-A Product feature CHAIN FJ692612_HBe_P-A of FT:mat_peptide FJ692612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPX
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|FJ692613_HBe_P-A Product feature CHAIN FJ692613_HBe_P-A of FT:mat_peptide FJ692613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|FJ867946_HBe_P-A Product feature CHAIN FJ867946_HBe_P-A of FT:mat_peptide FJ867946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867947_HBe_P-A Product feature CHAIN FJ867947_HBe_P-A of FT:mat_peptide FJ867947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867948_HBe_P-A Product feature CHAIN FJ867948_HBe_P-A of FT:mat_peptide FJ867948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867949_HBe_P-A Product feature CHAIN FJ867949_HBe_P-A of FT:mat_peptide FJ867949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867958_HBe_P-A Product feature CHAIN FJ867958_HBe_P-A of FT:mat_peptide FJ867958_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867960_HBe_P-A Product feature CHAIN FJ867960_HBe_P-A of FT:mat_peptide FJ867960_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867961_HBe_P-A Product feature CHAIN FJ867961_HBe_P-A of FT:mat_peptide FJ867961_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867985_HBe_P-A Product feature CHAIN FJ867985_HBe_P-A of FT:mat_peptide FJ867985_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETSVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867986_HBe_P-A Product feature CHAIN FJ867986_HBe_P-A of FT:mat_peptide FJ867986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWDMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETSVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867994_HBe_P-A Product feature CHAIN FJ867994_HBe_P-A of FT:mat_peptide FJ867994_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867995_HBe_P-A Product feature CHAIN FJ867995_HBe_P-A of FT:mat_peptide FJ867995_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868002_HBe_P-A Product feature CHAIN FJ868002_HBe_P-A of FT:mat_peptide FJ868002_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHMPC58). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHGSPH
HTALRQAILCWGELMTLATWVGINLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREAVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868008_HBe_P-A Product feature CHAIN FJ868008_HBe_P-A of FT:mat_peptide FJ868008_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHNPC87). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ904434_HBe_P-A Product feature CHAIN FJ904434_HBe_P-A of FT:mat_peptide FJ904434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPRDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQIILCWGDVMTLATWVGTNLZDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199974_HBe_P-A Product feature CHAIN FM199974_HBe_P-A of FT:mat_peptide FM199974_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMALASWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FM199975_HBe_P-A Product feature CHAIN FM199975_HBe_P-A of FT:mat_peptide FM199975_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCXPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|FM199976_HBe_P-A Product feature CHAIN FM199976_HBe_P-A of FT:mat_peptide FM199976_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCXTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAXLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199977_HBe_P-A Product feature CHAIN FM199977_HBe_P-A of FT:mat_peptide FM199977_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALQREALESHEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199978_HBe_P-A Product feature CHAIN FM199978_HBe_P-A of FT:mat_peptide FM199978_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199979_HBe_P-A Product feature CHAIN FM199979_HBe_P-A of FT:mat_peptide FM199979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199980_HBe_P-A Product feature CHAIN FM199980_HBe_P-A of FT:mat_peptide FM199980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545825_HBe_P-A Product feature CHAIN FN545825_HBe_P-A of FT:mat_peptide FN545825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRXQSRESQC
>gnl|hbvpro|FN545826_HBe_P-A Product feature CHAIN FN545826_HBe_P-A of FT:mat_peptide FN545826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDLMTLATWVGNNLEDPASRDLVVNYVNNTTGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FN545828_HBe_P-A Product feature CHAIN FN545828_HBe_P-A of FT:mat_peptide FN545828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTLQASKLCLGXLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPH
HTALRQAILCWGELMTLASWVGNNLQDPASRDQVVDYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPP
YRPLNAPILSTLPETTVVRRRDPGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545829_HBe_P-A Product feature CHAIN FN545829_HBe_P-A of FT:mat_peptide FN545829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREGLESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRARSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545830_HBe_P-A Product feature CHAIN FN545830_HBe_P-A of FT:mat_peptide FN545830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPLNAPILSTLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FN545831_HBe_P-A Product feature CHAIN FN545831_HBe_P-A of FT:mat_peptide FN545831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545832_HBe_P-A Product feature CHAIN FN545832_HBe_P-A of FT:mat_peptide FN545832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRXALESPEHCTPH
HTALRQAILCWGEXMTLATWVGNNLDDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLZYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRXRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|FN545833_HBe_P-A Product feature CHAIN FN545833_HBe_P-A of FT:mat_peptide FN545833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545834_HBe_P-A Product feature CHAIN FN545834_HBe_P-A of FT:mat_peptide FN545834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545835_HBe_P-A Product feature CHAIN FN545835_HBe_P-A of FT:mat_peptide FN545835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545836_HBe_P-A Product feature CHAIN FN545836_HBe_P-A of FT:mat_peptide FN545836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545838_HBe_P-A Product feature CHAIN FN545838_HBe_P-A of FT:mat_peptide FN545838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGDVMSLATWVGTNLEDPASREQVVSYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRLRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545839_HBe_P-A Product feature CHAIN FN545839_HBe_P-A of FT:mat_peptide FN545839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLQYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRXRDRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FN545840_HBe_P-A Product feature CHAIN FN545840_HBe_P-A of FT:mat_peptide FN545840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ161813_HBe_P-A Product feature CHAIN GQ161813_HBe_P-A of FT:mat_peptide GQ161813_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ184323_HBe_P-A Product feature CHAIN GQ184323_HBe_P-A of FT:mat_peptide GQ184323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ184324_HBe_P-A Product feature CHAIN GQ184324_HBe_P-A of FT:mat_peptide GQ184324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATLELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ222208_HBe_P-A Product feature CHAIN GQ222208_HBe_P-A of FT:mat_peptide GQ222208_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1123). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWRELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|GQ331046_HBe_P-A Product feature CHAIN GQ331046_HBe_P-A of FT:mat_peptide GQ331046_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ331047_HBe_P-A Product feature CHAIN GQ331047_HBe_P-A of FT:mat_peptide GQ331047_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|GQ414522_HBe_P-A Product feature CHAIN GQ414522_HBe_P-A of FT:mat_peptide GQ414522_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477461_HBe_P-A Product feature CHAIN GQ477461_HBe_P-A of FT:mat_peptide GQ477461_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477462_HBe_P-A Product feature CHAIN GQ477462_HBe_P-A of FT:mat_peptide GQ477462_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTSLGTWVGNNLDDQASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|GQ477463_HBe_P-A Product feature CHAIN GQ477463_HBe_P-A of FT:mat_peptide GQ477463_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPH
HTALRQAILCWVELMTLASWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477464_HBe_P-A Product feature CHAIN GQ477464_HBe_P-A of FT:mat_peptide GQ477464_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477465_HBe_P-A Product feature CHAIN GQ477465_HBe_P-A of FT:mat_peptide GQ477465_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLASWVGNNLQDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVCRRRVRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477466_HBe_P-A Product feature CHAIN GQ477466_HBe_P-A of FT:mat_peptide GQ477466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GQ477467_HBe_P-A Product feature CHAIN GQ477467_HBe_P-A of FT:mat_peptide GQ477467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477468_HBe_P-A Product feature CHAIN GQ477468_HBe_P-A of FT:mat_peptide GQ477468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMTLATWVGNNLEDLASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477469_HBe_P-A Product feature CHAIN GQ477469_HBe_P-A of FT:mat_peptide GQ477469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSAH
HTALRQAVLCWGELMTLATWVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSILPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477472_HBe_P-A Product feature CHAIN GQ477472_HBe_P-A of FT:mat_peptide GQ477472_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPGVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSILPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477473_HBe_P-A Product feature CHAIN GQ477473_HBe_P-A of FT:mat_peptide GQ477473_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPLDFFPSARDLLDTASALYREGLESPEHCSPH
HTALRQAILCWGELTALATWVGGNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|GQ477474_HBe_P-A Product feature CHAIN GQ477474_HBe_P-A of FT:mat_peptide GQ477474_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELISFLPSDFFPSVRDLLDTASALYREALESSEHCSPH
HTAIRHVLLCWVELMTLANWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRDRVRSPRRRTPSPRRRRSQSPRRRRSPSREPQC
>gnl|hbvpro|GQ477475_HBe_P-A Product feature CHAIN GQ477475_HBe_P-A of FT:mat_peptide GQ477475_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLRWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTAIRQVVLCWGELMTLATWVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPLNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477476_HBe_P-A Product feature CHAIN GQ477476_HBe_P-A of FT:mat_peptide GQ477476_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPTDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELSTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHVSCIIFGREIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477478_HBe_P-A Product feature CHAIN GQ477478_HBe_P-A of FT:mat_peptide GQ477478_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPENTVVRPRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477479_HBe_P-A Product feature CHAIN GQ477479_HBe_P-A of FT:mat_peptide GQ477479_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADYYPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477480_HBe_P-A Product feature CHAIN GQ477480_HBe_P-A of FT:mat_peptide GQ477480_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPNVRDLLDTASALYREALESPEHCTPH
HTALRQAVLCWGELMNLATWVGSNLQDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477482_HBe_P-A Product feature CHAIN GQ477482_HBe_P-A of FT:mat_peptide GQ477482_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIICWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477484_HBe_P-A Product feature CHAIN GQ477484_HBe_P-A of FT:mat_peptide GQ477484_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGDVMSLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRQHRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477486_HBe_P-A Product feature CHAIN GQ477486_HBe_P-A of FT:mat_peptide GQ477486_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTAAALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477487_HBe_P-A Product feature CHAIN GQ477487_HBe_P-A of FT:mat_peptide GQ477487_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELSTLATWVGNNLQDSASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRGRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|GQ477488_HBe_P-A Product feature CHAIN GQ477488_HBe_P-A of FT:mat_peptide GQ477488_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=214 residues).
TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSHH
HTAIRQAILCWGELMTLASWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477490_HBe_P-A Product feature CHAIN GQ477490_HBe_P-A of FT:mat_peptide GQ477490_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMTLATWVGSNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477491_HBe_P-A Product feature CHAIN GQ477491_HBe_P-A of FT:mat_peptide GQ477491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=214 residues).
TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHSSCITFGRDTVLEYLVSFGVWIRTPPA
YRPLNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477493_HBe_P-A Product feature CHAIN GQ477493_HBe_P-A of FT:mat_peptide GQ477493_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSARDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPA
YRPLNAPILSTLPETTVVRCRDRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477495_HBe_P-A Product feature CHAIN GQ477495_HBe_P-A of FT:mat_peptide GQ477495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPTNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477496_HBe_P-A Product feature CHAIN GQ477496_HBe_P-A of FT:mat_peptide GQ477496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRVRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477497_HBe_P-A Product feature CHAIN GQ477497_HBe_P-A of FT:mat_peptide GQ477497_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLRWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPECTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPHC
>gnl|hbvpro|GQ477498_HBe_P-A Product feature CHAIN GQ477498_HBe_P-A of FT:mat_peptide GQ477498_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477500_HBe_P-A Product feature CHAIN GQ477500_HBe_P-A of FT:mat_peptide GQ477500_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=214 residues).
IQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVKDLLDTASALYREALESSEHCSPH
HTAIRQVILCWGDVMTLGTWVGNNLEDPASKDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477501_HBe_P-A Product feature CHAIN GQ477501_HBe_P-A of FT:mat_peptide GQ477501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCSPH
HTALRQAILCWGELTTLGTWVGNNLNDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSMLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477502_HBe_P-A Product feature CHAIN GQ477502_HBe_P-A of FT:mat_peptide GQ477502_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPNVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDLMNLATWVGGNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRPRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|GQ477503_HBe_P-A Product feature CHAIN GQ477503_HBe_P-A of FT:mat_peptide GQ477503_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477504_HBe_P-A Product feature CHAIN GQ477504_HBe_P-A of FT:mat_peptide GQ477504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELSTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGREVVHEYLVSFGVWIRTPPA
YRPINAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563545_HBe_P-A Product feature CHAIN GU563545_HBe_P-A of FT:mat_peptide GU563545_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLCDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563546_HBe_P-A Product feature CHAIN GU563546_HBe_P-A of FT:mat_peptide GU563546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563547_HBe_P-A Product feature CHAIN GU563547_HBe_P-A of FT:mat_peptide GU563547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATTDLLSFLPSDFFPSVRDLRDTTSALYREALESPEHCSSH
HTAIRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHLSCITFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU563548_HBe_P-A Product feature CHAIN GU563548_HBe_P-A of FT:mat_peptide GU563548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563550_HBe_P-A Product feature CHAIN GU563550_HBe_P-A of FT:mat_peptide GU563550_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWVWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563553_HBe_P-A Product feature CHAIN GU563553_HBe_P-A of FT:mat_peptide GU563553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563554_HBe_P-A Product feature CHAIN GU563554_HBe_P-A of FT:mat_peptide GU563554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563555_HBe_P-A Product feature CHAIN GU563555_HBe_P-A of FT:mat_peptide GU563555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563557_HBe_P-A Product feature CHAIN GU563557_HBe_P-A of FT:mat_peptide GU563557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563558_HBe_P-A Product feature CHAIN GU563558_HBe_P-A of FT:mat_peptide GU563558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563562_HBe_P-A Product feature CHAIN GU563562_HBe_P-A of FT:mat_peptide GU563562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU827640_HBe_P-A Product feature CHAIN GU827640_HBe_P-A of FT:mat_peptide GU827640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMC25B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTSLGTWVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|HE576988_HBe_P-A Product feature CHAIN HE576988_HBe_P-A of FT:mat_peptide HE576988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HE576989_HBe_P-A Product feature CHAIN HE576989_HBe_P-A of FT:mat_peptide HE576989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM535200_HBe_P-A Product feature CHAIN HM535200_HBe_P-A of FT:mat_peptide HM535200_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM535205_HBe_P-A Product feature CHAIN HM535205_HBe_P-A of FT:mat_peptide HM535205_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRGRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF440016_HBe_P-A Product feature CHAIN JF440016_HBe_P-A of FT:mat_peptide JF440016_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B11). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHT
ALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182318_HBe_P-A Product feature CHAIN JN182318_HBe_P-A of FT:mat_peptide JN182318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
XXLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182319_HBe_P-A Product feature CHAIN JN182319_HBe_P-A of FT:mat_peptide JN182319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFXXXXXXXXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182321_HBe_P-A Product feature CHAIN JN182321_HBe_P-A of FT:mat_peptide JN182321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182322_HBe_P-A Product feature CHAIN JN182322_HBe_P-A of FT:mat_peptide JN182322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHT
ALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182323_HBe_P-A Product feature CHAIN JN182323_HBe_P-A of FT:mat_peptide JN182323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=212 residues).
LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHT
ALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSYGVWIRTPPAYR
PPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182324_HBe_P-A Product feature CHAIN JN182324_HBe_P-A of FT:mat_peptide JN182324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182325_HBe_P-A Product feature CHAIN JN182325_HBe_P-A of FT:mat_peptide JN182325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILRWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182327_HBe_P-A Product feature CHAIN JN182327_HBe_P-A of FT:mat_peptide JN182327_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLXXXXXXXXXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182328_HBe_P-A Product feature CHAIN JN182328_HBe_P-A of FT:mat_peptide JN182328_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCPGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182329_HBe_P-A Product feature CHAIN JN182329_HBe_P-A of FT:mat_peptide JN182329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHT
ALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182330_HBe_P-A Product feature CHAIN JN182330_HBe_P-A of FT:mat_peptide JN182330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182331_HBe_P-A Product feature CHAIN JN182331_HBe_P-A of FT:mat_peptide JN182331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182332_HBe_P-A Product feature CHAIN JN182332_HBe_P-A of FT:mat_peptide JN182332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQRLWFHISCLTFGRETALEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182333_HBe_P-A Product feature CHAIN JN182333_HBe_P-A of FT:mat_peptide JN182333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182334_HBe_P-A Product feature CHAIN JN182334_HBe_P-A of FT:mat_peptide JN182334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLXXXXXXXXCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGEPMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRSRSQSRESQC
>gnl|hbvpro|JQ023660_HBe_P-A Product feature CHAIN JQ023660_HBe_P-A of FT:mat_peptide JQ023660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPKAPILSTLPETTVVRRRDRGKSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ023661_HBe_P-A Product feature CHAIN JQ023661_HBe_P-A of FT:mat_peptide JQ023661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPKAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|JQ687529_HBe_P-A Product feature CHAIN JQ687529_HBe_P-A of FT:mat_peptide JQ687529_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ687533_HBe_P-A Product feature CHAIN JQ687533_HBe_P-A of FT:mat_peptide JQ687533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRKRRSQSPRRKRSQSRESQC
>gnl|hbvpro|JQ707299_HBe_P-A Product feature CHAIN JQ707299_HBe_P-A of FT:mat_peptide JQ707299_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|JQ707300_HBe_P-A Product feature CHAIN JQ707300_HBe_P-A of FT:mat_peptide JQ707300_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPHRRRSQSRESQC
>gnl|hbvpro|JQ707301_HBe_P-A Product feature CHAIN JQ707301_HBe_P-A of FT:mat_peptide JQ707301_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707302_HBe_P-A Product feature CHAIN JQ707302_HBe_P-A of FT:mat_peptide JQ707302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707303_HBe_P-A Product feature CHAIN JQ707303_HBe_P-A of FT:mat_peptide JQ707303_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707304_HBe_P-A Product feature CHAIN JQ707304_HBe_P-A of FT:mat_peptide JQ707304_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707305_HBe_P-A Product feature CHAIN JQ707305_HBe_P-A of FT:mat_peptide JQ707305_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707306_HBe_P-A Product feature CHAIN JQ707306_HBe_P-A of FT:mat_peptide JQ707306_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707307_HBe_P-A Product feature CHAIN JQ707307_HBe_P-A of FT:mat_peptide JQ707307_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707308_HBe_P-A Product feature CHAIN JQ707308_HBe_P-A of FT:mat_peptide JQ707308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707309_HBe_P-A Product feature CHAIN JQ707309_HBe_P-A of FT:mat_peptide JQ707309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707310_HBe_P-A Product feature CHAIN JQ707310_HBe_P-A of FT:mat_peptide JQ707310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707311_HBe_P-A Product feature CHAIN JQ707311_HBe_P-A of FT:mat_peptide JQ707311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707312_HBe_P-A Product feature CHAIN JQ707312_HBe_P-A of FT:mat_peptide JQ707312_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFNISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707313_HBe_P-A Product feature CHAIN JQ707313_HBe_P-A of FT:mat_peptide JQ707313_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707314_HBe_P-A Product feature CHAIN JQ707314_HBe_P-A of FT:mat_peptide JQ707314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707315_HBe_P-A Product feature CHAIN JQ707315_HBe_P-A of FT:mat_peptide JQ707315_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707316_HBe_P-A Product feature CHAIN JQ707316_HBe_P-A of FT:mat_peptide JQ707316_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707317_HBe_P-A Product feature CHAIN JQ707317_HBe_P-A of FT:mat_peptide JQ707317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707318_HBe_P-A Product feature CHAIN JQ707318_HBe_P-A of FT:mat_peptide JQ707318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707319_HBe_P-A Product feature CHAIN JQ707319_HBe_P-A of FT:mat_peptide JQ707319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707320_HBe_P-A Product feature CHAIN JQ707320_HBe_P-A of FT:mat_peptide JQ707320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707321_HBe_P-A Product feature CHAIN JQ707321_HBe_P-A of FT:mat_peptide JQ707321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707322_HBe_P-A Product feature CHAIN JQ707322_HBe_P-A of FT:mat_peptide JQ707322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707323_HBe_P-A Product feature CHAIN JQ707323_HBe_P-A of FT:mat_peptide JQ707323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707324_HBe_P-A Product feature CHAIN JQ707324_HBe_P-A of FT:mat_peptide JQ707324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707325_HBe_P-A Product feature CHAIN JQ707325_HBe_P-A of FT:mat_peptide JQ707325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707326_HBe_P-A Product feature CHAIN JQ707326_HBe_P-A of FT:mat_peptide JQ707326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707327_HBe_P-A Product feature CHAIN JQ707327_HBe_P-A of FT:mat_peptide JQ707327_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707329_HBe_P-A Product feature CHAIN JQ707329_HBe_P-A of FT:mat_peptide JQ707329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSKLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707330_HBe_P-A Product feature CHAIN JQ707330_HBe_P-A of FT:mat_peptide JQ707330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707331_HBe_P-A Product feature CHAIN JQ707331_HBe_P-A of FT:mat_peptide JQ707331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707332_HBe_P-A Product feature CHAIN JQ707332_HBe_P-A of FT:mat_peptide JQ707332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707333_HBe_P-A Product feature CHAIN JQ707333_HBe_P-A of FT:mat_peptide JQ707333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707334_HBe_P-A Product feature CHAIN JQ707334_HBe_P-A of FT:mat_peptide JQ707334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQR
>gnl|hbvpro|JQ707335_HBe_P-A Product feature CHAIN JQ707335_HBe_P-A of FT:mat_peptide JQ707335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C44). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|JQ707336_HBe_P-A Product feature CHAIN JQ707336_HBe_P-A of FT:mat_peptide JQ707336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707337_HBe_P-A Product feature CHAIN JQ707337_HBe_P-A of FT:mat_peptide JQ707337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707338_HBe_P-A Product feature CHAIN JQ707338_HBe_P-A of FT:mat_peptide JQ707338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSFPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707339_HBe_P-A Product feature CHAIN JQ707339_HBe_P-A of FT:mat_peptide JQ707339_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707340_HBe_P-A Product feature CHAIN JQ707340_HBe_P-A of FT:mat_peptide JQ707340_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C5). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707341_HBe_P-A Product feature CHAIN JQ707341_HBe_P-A of FT:mat_peptide JQ707341_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707342_HBe_P-A Product feature CHAIN JQ707342_HBe_P-A of FT:mat_peptide JQ707342_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707343_HBe_P-A Product feature CHAIN JQ707343_HBe_P-A of FT:mat_peptide JQ707343_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707344_HBe_P-A Product feature CHAIN JQ707344_HBe_P-A of FT:mat_peptide JQ707344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707345_HBe_P-A Product feature CHAIN JQ707345_HBe_P-A of FT:mat_peptide JQ707345_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELVSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707346_HBe_P-A Product feature CHAIN JQ707346_HBe_P-A of FT:mat_peptide JQ707346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQEPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPD
YRSPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707347_HBe_P-A Product feature CHAIN JQ707347_HBe_P-A of FT:mat_peptide JQ707347_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707348_HBe_P-A Product feature CHAIN JQ707348_HBe_P-A of FT:mat_peptide JQ707348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707349_HBe_P-A Product feature CHAIN JQ707349_HBe_P-A of FT:mat_peptide JQ707349_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707350_HBe_P-A Product feature CHAIN JQ707350_HBe_P-A of FT:mat_peptide JQ707350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707351_HBe_P-A Product feature CHAIN JQ707351_HBe_P-A of FT:mat_peptide JQ707351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707352_HBe_P-A Product feature CHAIN JQ707352_HBe_P-A of FT:mat_peptide JQ707352_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707353_HBe_P-A Product feature CHAIN JQ707353_HBe_P-A of FT:mat_peptide JQ707353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707354_HBe_P-A Product feature CHAIN JQ707354_HBe_P-A of FT:mat_peptide JQ707354_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707355_HBe_P-A Product feature CHAIN JQ707355_HBe_P-A of FT:mat_peptide JQ707355_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707356_HBe_P-A Product feature CHAIN JQ707356_HBe_P-A of FT:mat_peptide JQ707356_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPSRRRSQSRESQC
>gnl|hbvpro|JQ707357_HBe_P-A Product feature CHAIN JQ707357_HBe_P-A of FT:mat_peptide JQ707357_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707358_HBe_P-A Product feature CHAIN JQ707358_HBe_P-A of FT:mat_peptide JQ707358_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707359_HBe_P-A Product feature CHAIN JQ707359_HBe_P-A of FT:mat_peptide JQ707359_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707360_HBe_P-A Product feature CHAIN JQ707360_HBe_P-A of FT:mat_peptide JQ707360_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707361_HBe_P-A Product feature CHAIN JQ707361_HBe_P-A of FT:mat_peptide JQ707361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707362_HBe_P-A Product feature CHAIN JQ707362_HBe_P-A of FT:mat_peptide JQ707362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707363_HBe_P-A Product feature CHAIN JQ707363_HBe_P-A of FT:mat_peptide JQ707363_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVPASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707364_HBe_P-A Product feature CHAIN JQ707364_HBe_P-A of FT:mat_peptide JQ707364_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707365_HBe_P-A Product feature CHAIN JQ707365_HBe_P-A of FT:mat_peptide JQ707365_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSSPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707366_HBe_P-A Product feature CHAIN JQ707366_HBe_P-A of FT:mat_peptide JQ707366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707367_HBe_P-A Product feature CHAIN JQ707367_HBe_P-A of FT:mat_peptide JQ707367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707368_HBe_P-A Product feature CHAIN JQ707368_HBe_P-A of FT:mat_peptide JQ707368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPSKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPIVSTLPETTVVRRRDRGRFPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707369_HBe_P-A Product feature CHAIN JQ707369_HBe_P-A of FT:mat_peptide JQ707369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707370_HBe_P-A Product feature CHAIN JQ707370_HBe_P-A of FT:mat_peptide JQ707370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707371_HBe_P-A Product feature CHAIN JQ707371_HBe_P-A of FT:mat_peptide JQ707371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707372_HBe_P-A Product feature CHAIN JQ707372_HBe_P-A of FT:mat_peptide JQ707372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707373_HBe_P-A Product feature CHAIN JQ707373_HBe_P-A of FT:mat_peptide JQ707373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707374_HBe_P-A Product feature CHAIN JQ707374_HBe_P-A of FT:mat_peptide JQ707374_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707375_HBe_P-A Product feature CHAIN JQ707375_HBe_P-A of FT:mat_peptide JQ707375_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707376_HBe_P-A Product feature CHAIN JQ707376_HBe_P-A of FT:mat_peptide JQ707376_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707377_HBe_P-A Product feature CHAIN JQ707377_HBe_P-A of FT:mat_peptide JQ707377_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707378_HBe_P-A Product feature CHAIN JQ707378_HBe_P-A of FT:mat_peptide JQ707378_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707379_HBe_P-A Product feature CHAIN JQ707379_HBe_P-A of FT:mat_peptide JQ707379_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707380_HBe_P-A Product feature CHAIN JQ707380_HBe_P-A of FT:mat_peptide JQ707380_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707381_HBe_P-A Product feature CHAIN JQ707381_HBe_P-A of FT:mat_peptide JQ707381_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707382_HBe_P-A Product feature CHAIN JQ707382_HBe_P-A of FT:mat_peptide JQ707382_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVDNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707383_HBe_P-A Product feature CHAIN JQ707383_HBe_P-A of FT:mat_peptide JQ707383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707384_HBe_P-A Product feature CHAIN JQ707384_HBe_P-A of FT:mat_peptide JQ707384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707385_HBe_P-A Product feature CHAIN JQ707385_HBe_P-A of FT:mat_peptide JQ707385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707386_HBe_P-A Product feature CHAIN JQ707386_HBe_P-A of FT:mat_peptide JQ707386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707387_HBe_P-A Product feature CHAIN JQ707387_HBe_P-A of FT:mat_peptide JQ707387_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPAPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707388_HBe_P-A Product feature CHAIN JQ707388_HBe_P-A of FT:mat_peptide JQ707388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLLVNYVNGDMGLKIRQLGRFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707389_HBe_P-A Product feature CHAIN JQ707389_HBe_P-A of FT:mat_peptide JQ707389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707390_HBe_P-A Product feature CHAIN JQ707390_HBe_P-A of FT:mat_peptide JQ707390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707391_HBe_P-A Product feature CHAIN JQ707391_HBe_P-A of FT:mat_peptide JQ707391_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707392_HBe_P-A Product feature CHAIN JQ707392_HBe_P-A of FT:mat_peptide JQ707392_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707393_HBe_P-A Product feature CHAIN JQ707393_HBe_P-A of FT:mat_peptide JQ707393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707394_HBe_P-A Product feature CHAIN JQ707394_HBe_P-A of FT:mat_peptide JQ707394_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707395_HBe_P-A Product feature CHAIN JQ707395_HBe_P-A of FT:mat_peptide JQ707395_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707396_HBe_P-A Product feature CHAIN JQ707396_HBe_P-A of FT:mat_peptide JQ707396_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYINTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707397_HBe_P-A Product feature CHAIN JQ707397_HBe_P-A of FT:mat_peptide JQ707397_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707398_HBe_P-A Product feature CHAIN JQ707398_HBe_P-A of FT:mat_peptide JQ707398_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707399_HBe_P-A Product feature CHAIN JQ707399_HBe_P-A of FT:mat_peptide JQ707399_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707400_HBe_P-A Product feature CHAIN JQ707400_HBe_P-A of FT:mat_peptide JQ707400_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707401_HBe_P-A Product feature CHAIN JQ707401_HBe_P-A of FT:mat_peptide JQ707401_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707402_HBe_P-A Product feature CHAIN JQ707402_HBe_P-A of FT:mat_peptide JQ707402_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707403_HBe_P-A Product feature CHAIN JQ707403_HBe_P-A of FT:mat_peptide JQ707403_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707404_HBe_P-A Product feature CHAIN JQ707404_HBe_P-A of FT:mat_peptide JQ707404_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707405_HBe_P-A Product feature CHAIN JQ707405_HBe_P-A of FT:mat_peptide JQ707405_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707406_HBe_P-A Product feature CHAIN JQ707406_HBe_P-A of FT:mat_peptide JQ707406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707407_HBe_P-A Product feature CHAIN JQ707407_HBe_P-A of FT:mat_peptide JQ707407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707408_HBe_P-A Product feature CHAIN JQ707408_HBe_P-A of FT:mat_peptide JQ707408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707409_HBe_P-A Product feature CHAIN JQ707409_HBe_P-A of FT:mat_peptide JQ707409_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707410_HBe_P-A Product feature CHAIN JQ707410_HBe_P-A of FT:mat_peptide JQ707410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707411_HBe_P-A Product feature CHAIN JQ707411_HBe_P-A of FT:mat_peptide JQ707411_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707412_HBe_P-A Product feature CHAIN JQ707412_HBe_P-A of FT:mat_peptide JQ707412_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707413_HBe_P-A Product feature CHAIN JQ707413_HBe_P-A of FT:mat_peptide JQ707413_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707414_HBe_P-A Product feature CHAIN JQ707414_HBe_P-A of FT:mat_peptide JQ707414_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707415_HBe_P-A Product feature CHAIN JQ707415_HBe_P-A of FT:mat_peptide JQ707415_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707416_HBe_P-A Product feature CHAIN JQ707416_HBe_P-A of FT:mat_peptide JQ707416_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707417_HBe_P-A Product feature CHAIN JQ707417_HBe_P-A of FT:mat_peptide JQ707417_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707418_HBe_P-A Product feature CHAIN JQ707418_HBe_P-A of FT:mat_peptide JQ707418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707419_HBe_P-A Product feature CHAIN JQ707419_HBe_P-A of FT:mat_peptide JQ707419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707420_HBe_P-A Product feature CHAIN JQ707420_HBe_P-A of FT:mat_peptide JQ707420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707531_HBe_P-A Product feature CHAIN JQ707531_HBe_P-A of FT:mat_peptide JQ707531_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707532_HBe_P-A Product feature CHAIN JQ707532_HBe_P-A of FT:mat_peptide JQ707532_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707533_HBe_P-A Product feature CHAIN JQ707533_HBe_P-A of FT:mat_peptide JQ707533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707534_HBe_P-A Product feature CHAIN JQ707534_HBe_P-A of FT:mat_peptide JQ707534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPV
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707535_HBe_P-A Product feature CHAIN JQ707535_HBe_P-A of FT:mat_peptide JQ707535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707536_HBe_P-A Product feature CHAIN JQ707536_HBe_P-A of FT:mat_peptide JQ707536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707537_HBe_P-A Product feature CHAIN JQ707537_HBe_P-A of FT:mat_peptide JQ707537_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707538_HBe_P-A Product feature CHAIN JQ707538_HBe_P-A of FT:mat_peptide JQ707538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707539_HBe_P-A Product feature CHAIN JQ707539_HBe_P-A of FT:mat_peptide JQ707539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707540_HBe_P-A Product feature CHAIN JQ707540_HBe_P-A of FT:mat_peptide JQ707540_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707541_HBe_P-A Product feature CHAIN JQ707541_HBe_P-A of FT:mat_peptide JQ707541_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707542_HBe_P-A Product feature CHAIN JQ707542_HBe_P-A of FT:mat_peptide JQ707542_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707543_HBe_P-A Product feature CHAIN JQ707543_HBe_P-A of FT:mat_peptide JQ707543_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707544_HBe_P-A Product feature CHAIN JQ707544_HBe_P-A of FT:mat_peptide JQ707544_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707545_HBe_P-A Product feature CHAIN JQ707545_HBe_P-A of FT:mat_peptide JQ707545_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707546_HBe_P-A Product feature CHAIN JQ707546_HBe_P-A of FT:mat_peptide JQ707546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707547_HBe_P-A Product feature CHAIN JQ707547_HBe_P-A of FT:mat_peptide JQ707547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707548_HBe_P-A Product feature CHAIN JQ707548_HBe_P-A of FT:mat_peptide JQ707548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707549_HBe_P-A Product feature CHAIN JQ707549_HBe_P-A of FT:mat_peptide JQ707549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707550_HBe_P-A Product feature CHAIN JQ707550_HBe_P-A of FT:mat_peptide JQ707550_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707551_HBe_P-A Product feature CHAIN JQ707551_HBe_P-A of FT:mat_peptide JQ707551_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707552_HBe_P-A Product feature CHAIN JQ707552_HBe_P-A of FT:mat_peptide JQ707552_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707553_HBe_P-A Product feature CHAIN JQ707553_HBe_P-A of FT:mat_peptide JQ707553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707554_HBe_P-A Product feature CHAIN JQ707554_HBe_P-A of FT:mat_peptide JQ707554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707555_HBe_P-A Product feature CHAIN JQ707555_HBe_P-A of FT:mat_peptide JQ707555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGKLMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707556_HBe_P-A Product feature CHAIN JQ707556_HBe_P-A of FT:mat_peptide JQ707556_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707557_HBe_P-A Product feature CHAIN JQ707557_HBe_P-A of FT:mat_peptide JQ707557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707558_HBe_P-A Product feature CHAIN JQ707558_HBe_P-A of FT:mat_peptide JQ707558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707559_HBe_P-A Product feature CHAIN JQ707559_HBe_P-A of FT:mat_peptide JQ707559_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707560_HBe_P-A Product feature CHAIN JQ707560_HBe_P-A of FT:mat_peptide JQ707560_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707561_HBe_P-A Product feature CHAIN JQ707561_HBe_P-A of FT:mat_peptide JQ707561_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707562_HBe_P-A Product feature CHAIN JQ707562_HBe_P-A of FT:mat_peptide JQ707562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707563_HBe_P-A Product feature CHAIN JQ707563_HBe_P-A of FT:mat_peptide JQ707563_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707564_HBe_P-A Product feature CHAIN JQ707564_HBe_P-A of FT:mat_peptide JQ707564_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707565_HBe_P-A Product feature CHAIN JQ707565_HBe_P-A of FT:mat_peptide JQ707565_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHSSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707566_HBe_P-A Product feature CHAIN JQ707566_HBe_P-A of FT:mat_peptide JQ707566_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707567_HBe_P-A Product feature CHAIN JQ707567_HBe_P-A of FT:mat_peptide JQ707567_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707568_HBe_P-A Product feature CHAIN JQ707568_HBe_P-A of FT:mat_peptide JQ707568_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707569_HBe_P-A Product feature CHAIN JQ707569_HBe_P-A of FT:mat_peptide JQ707569_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707570_HBe_P-A Product feature CHAIN JQ707570_HBe_P-A of FT:mat_peptide JQ707570_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707571_HBe_P-A Product feature CHAIN JQ707571_HBe_P-A of FT:mat_peptide JQ707571_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707572_HBe_P-A Product feature CHAIN JQ707572_HBe_P-A of FT:mat_peptide JQ707572_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707573_HBe_P-A Product feature CHAIN JQ707573_HBe_P-A of FT:mat_peptide JQ707573_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707574_HBe_P-A Product feature CHAIN JQ707574_HBe_P-A of FT:mat_peptide JQ707574_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707575_HBe_P-A Product feature CHAIN JQ707575_HBe_P-A of FT:mat_peptide JQ707575_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707576_HBe_P-A Product feature CHAIN JQ707576_HBe_P-A of FT:mat_peptide JQ707576_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMNIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707577_HBe_P-A Product feature CHAIN JQ707577_HBe_P-A of FT:mat_peptide JQ707577_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707578_HBe_P-A Product feature CHAIN JQ707578_HBe_P-A of FT:mat_peptide JQ707578_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLLFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707579_HBe_P-A Product feature CHAIN JQ707579_HBe_P-A of FT:mat_peptide JQ707579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707580_HBe_P-A Product feature CHAIN JQ707580_HBe_P-A of FT:mat_peptide JQ707580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707581_HBe_P-A Product feature CHAIN JQ707581_HBe_P-A of FT:mat_peptide JQ707581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707582_HBe_P-A Product feature CHAIN JQ707582_HBe_P-A of FT:mat_peptide JQ707582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707583_HBe_P-A Product feature CHAIN JQ707583_HBe_P-A of FT:mat_peptide JQ707583_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707584_HBe_P-A Product feature CHAIN JQ707584_HBe_P-A of FT:mat_peptide JQ707584_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707585_HBe_P-A Product feature CHAIN JQ707585_HBe_P-A of FT:mat_peptide JQ707585_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707586_HBe_P-A Product feature CHAIN JQ707586_HBe_P-A of FT:mat_peptide JQ707586_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707587_HBe_P-A Product feature CHAIN JQ707587_HBe_P-A of FT:mat_peptide JQ707587_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707588_HBe_P-A Product feature CHAIN JQ707588_HBe_P-A of FT:mat_peptide JQ707588_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707589_HBe_P-A Product feature CHAIN JQ707589_HBe_P-A of FT:mat_peptide JQ707589_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707590_HBe_P-A Product feature CHAIN JQ707590_HBe_P-A of FT:mat_peptide JQ707590_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707591_HBe_P-A Product feature CHAIN JQ707591_HBe_P-A of FT:mat_peptide JQ707591_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707592_HBe_P-A Product feature CHAIN JQ707592_HBe_P-A of FT:mat_peptide JQ707592_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707593_HBe_P-A Product feature CHAIN JQ707593_HBe_P-A of FT:mat_peptide JQ707593_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLAFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707594_HBe_P-A Product feature CHAIN JQ707594_HBe_P-A of FT:mat_peptide JQ707594_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707595_HBe_P-A Product feature CHAIN JQ707595_HBe_P-A of FT:mat_peptide JQ707595_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707596_HBe_P-A Product feature CHAIN JQ707596_HBe_P-A of FT:mat_peptide JQ707596_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707597_HBe_P-A Product feature CHAIN JQ707597_HBe_P-A of FT:mat_peptide JQ707597_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707598_HBe_P-A Product feature CHAIN JQ707598_HBe_P-A of FT:mat_peptide JQ707598_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707599_HBe_P-A Product feature CHAIN JQ707599_HBe_P-A of FT:mat_peptide JQ707599_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707600_HBe_P-A Product feature CHAIN JQ707600_HBe_P-A of FT:mat_peptide JQ707600_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ707601_HBe_P-A Product feature CHAIN JQ707601_HBe_P-A of FT:mat_peptide JQ707601_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707602_HBe_P-A Product feature CHAIN JQ707602_HBe_P-A of FT:mat_peptide JQ707602_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGKLMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707603_HBe_P-A Product feature CHAIN JQ707603_HBe_P-A of FT:mat_peptide JQ707603_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707604_HBe_P-A Product feature CHAIN JQ707604_HBe_P-A of FT:mat_peptide JQ707604_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707605_HBe_P-A Product feature CHAIN JQ707605_HBe_P-A of FT:mat_peptide JQ707605_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707606_HBe_P-A Product feature CHAIN JQ707606_HBe_P-A of FT:mat_peptide JQ707606_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707607_HBe_P-A Product feature CHAIN JQ707607_HBe_P-A of FT:mat_peptide JQ707607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707608_HBe_P-A Product feature CHAIN JQ707608_HBe_P-A of FT:mat_peptide JQ707608_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707609_HBe_P-A Product feature CHAIN JQ707609_HBe_P-A of FT:mat_peptide JQ707609_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707610_HBe_P-A Product feature CHAIN JQ707610_HBe_P-A of FT:mat_peptide JQ707610_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707611_HBe_P-A Product feature CHAIN JQ707611_HBe_P-A of FT:mat_peptide JQ707611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707612_HBe_P-A Product feature CHAIN JQ707612_HBe_P-A of FT:mat_peptide JQ707612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707613_HBe_P-A Product feature CHAIN JQ707613_HBe_P-A of FT:mat_peptide JQ707613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707614_HBe_P-A Product feature CHAIN JQ707614_HBe_P-A of FT:mat_peptide JQ707614_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707615_HBe_P-A Product feature CHAIN JQ707615_HBe_P-A of FT:mat_peptide JQ707615_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707616_HBe_P-A Product feature CHAIN JQ707616_HBe_P-A of FT:mat_peptide JQ707616_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707617_HBe_P-A Product feature CHAIN JQ707617_HBe_P-A of FT:mat_peptide JQ707617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707618_HBe_P-A Product feature CHAIN JQ707618_HBe_P-A of FT:mat_peptide JQ707618_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707619_HBe_P-A Product feature CHAIN JQ707619_HBe_P-A of FT:mat_peptide JQ707619_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707620_HBe_P-A Product feature CHAIN JQ707620_HBe_P-A of FT:mat_peptide JQ707620_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707621_HBe_P-A Product feature CHAIN JQ707621_HBe_P-A of FT:mat_peptide JQ707621_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707622_HBe_P-A Product feature CHAIN JQ707622_HBe_P-A of FT:mat_peptide JQ707622_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707623_HBe_P-A Product feature CHAIN JQ707623_HBe_P-A of FT:mat_peptide JQ707623_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEFPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707624_HBe_P-A Product feature CHAIN JQ707624_HBe_P-A of FT:mat_peptide JQ707624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707625_HBe_P-A Product feature CHAIN JQ707625_HBe_P-A of FT:mat_peptide JQ707625_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707626_HBe_P-A Product feature CHAIN JQ707626_HBe_P-A of FT:mat_peptide JQ707626_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707627_HBe_P-A Product feature CHAIN JQ707627_HBe_P-A of FT:mat_peptide JQ707627_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707628_HBe_P-A Product feature CHAIN JQ707628_HBe_P-A of FT:mat_peptide JQ707628_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707629_HBe_P-A Product feature CHAIN JQ707629_HBe_P-A of FT:mat_peptide JQ707629_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707630_HBe_P-A Product feature CHAIN JQ707630_HBe_P-A of FT:mat_peptide JQ707630_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707631_HBe_P-A Product feature CHAIN JQ707631_HBe_P-A of FT:mat_peptide JQ707631_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707632_HBe_P-A Product feature CHAIN JQ707632_HBe_P-A of FT:mat_peptide JQ707632_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707633_HBe_P-A Product feature CHAIN JQ707633_HBe_P-A of FT:mat_peptide JQ707633_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707634_HBe_P-A Product feature CHAIN JQ707634_HBe_P-A of FT:mat_peptide JQ707634_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707635_HBe_P-A Product feature CHAIN JQ707635_HBe_P-A of FT:mat_peptide JQ707635_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707636_HBe_P-A Product feature CHAIN JQ707636_HBe_P-A of FT:mat_peptide JQ707636_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707637_HBe_P-A Product feature CHAIN JQ707637_HBe_P-A of FT:mat_peptide JQ707637_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707638_HBe_P-A Product feature CHAIN JQ707638_HBe_P-A of FT:mat_peptide JQ707638_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707639_HBe_P-A Product feature CHAIN JQ707639_HBe_P-A of FT:mat_peptide JQ707639_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707640_HBe_P-A Product feature CHAIN JQ707640_HBe_P-A of FT:mat_peptide JQ707640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707641_HBe_P-A Product feature CHAIN JQ707641_HBe_P-A of FT:mat_peptide JQ707641_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707642_HBe_P-A Product feature CHAIN JQ707642_HBe_P-A of FT:mat_peptide JQ707642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707643_HBe_P-A Product feature CHAIN JQ707643_HBe_P-A of FT:mat_peptide JQ707643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707644_HBe_P-A Product feature CHAIN JQ707644_HBe_P-A of FT:mat_peptide JQ707644_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707645_HBe_P-A Product feature CHAIN JQ707645_HBe_P-A of FT:mat_peptide JQ707645_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707646_HBe_P-A Product feature CHAIN JQ707646_HBe_P-A of FT:mat_peptide JQ707646_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707647_HBe_P-A Product feature CHAIN JQ707647_HBe_P-A of FT:mat_peptide JQ707647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707648_HBe_P-A Product feature CHAIN JQ707648_HBe_P-A of FT:mat_peptide JQ707648_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707649_HBe_P-A Product feature CHAIN JQ707649_HBe_P-A of FT:mat_peptide JQ707649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707650_HBe_P-A Product feature CHAIN JQ707650_HBe_P-A of FT:mat_peptide JQ707650_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707651_HBe_P-A Product feature CHAIN JQ707651_HBe_P-A of FT:mat_peptide JQ707651_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707652_HBe_P-A Product feature CHAIN JQ707652_HBe_P-A of FT:mat_peptide JQ707652_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707653_HBe_P-A Product feature CHAIN JQ707653_HBe_P-A of FT:mat_peptide JQ707653_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707654_HBe_P-A Product feature CHAIN JQ707654_HBe_P-A of FT:mat_peptide JQ707654_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707655_HBe_P-A Product feature CHAIN JQ707655_HBe_P-A of FT:mat_peptide JQ707655_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707656_HBe_P-A Product feature CHAIN JQ707656_HBe_P-A of FT:mat_peptide JQ707656_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707658_HBe_P-A Product feature CHAIN JQ707658_HBe_P-A of FT:mat_peptide JQ707658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707659_HBe_P-A Product feature CHAIN JQ707659_HBe_P-A of FT:mat_peptide JQ707659_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707661_HBe_P-A Product feature CHAIN JQ707661_HBe_P-A of FT:mat_peptide JQ707661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707662_HBe_P-A Product feature CHAIN JQ707662_HBe_P-A of FT:mat_peptide JQ707662_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707663_HBe_P-A Product feature CHAIN JQ707663_HBe_P-A of FT:mat_peptide JQ707663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707664_HBe_P-A Product feature CHAIN JQ707664_HBe_P-A of FT:mat_peptide JQ707664_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707665_HBe_P-A Product feature CHAIN JQ707665_HBe_P-A of FT:mat_peptide JQ707665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707667_HBe_P-A Product feature CHAIN JQ707667_HBe_P-A of FT:mat_peptide JQ707667_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707669_HBe_P-A Product feature CHAIN JQ707669_HBe_P-A of FT:mat_peptide JQ707669_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707670_HBe_P-A Product feature CHAIN JQ707670_HBe_P-A of FT:mat_peptide JQ707670_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707672_HBe_P-A Product feature CHAIN JQ707672_HBe_P-A of FT:mat_peptide JQ707672_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707674_HBe_P-A Product feature CHAIN JQ707674_HBe_P-A of FT:mat_peptide JQ707674_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707675_HBe_P-A Product feature CHAIN JQ707675_HBe_P-A of FT:mat_peptide JQ707675_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707676_HBe_P-A Product feature CHAIN JQ707676_HBe_P-A of FT:mat_peptide JQ707676_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707681_HBe_P-A Product feature CHAIN JQ707681_HBe_P-A of FT:mat_peptide JQ707681_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096952_HBe_P-A Product feature CHAIN JX096952_HBe_P-A of FT:mat_peptide JX096952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096953_HBe_P-A Product feature CHAIN JX096953_HBe_P-A of FT:mat_peptide JX096953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX154579_HBe_P-A Product feature CHAIN JX154579_HBe_P-A of FT:mat_peptide JX154579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMTLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX154580_HBe_P-A Product feature CHAIN JX154580_HBe_P-A of FT:mat_peptide JX154580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMTLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX154581_HBe_P-A Product feature CHAIN JX154581_HBe_P-A of FT:mat_peptide JX154581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMTLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX154582_HBe_P-A Product feature CHAIN JX154582_HBe_P-A of FT:mat_peptide JX154582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMTLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836831_HBe_P-A Product feature CHAIN KC836831_HBe_P-A of FT:mat_peptide KC836831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836832_HBe_P-A Product feature CHAIN KC836832_HBe_P-A of FT:mat_peptide KC836832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836834_HBe_P-A Product feature CHAIN KC836834_HBe_P-A of FT:mat_peptide KC836834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836846_HBe_P-A Product feature CHAIN KC836846_HBe_P-A of FT:mat_peptide KC836846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836849_HBe_P-A Product feature CHAIN KC836849_HBe_P-A of FT:mat_peptide KC836849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836854_HBe_P-A Product feature CHAIN KC836854_HBe_P-A of FT:mat_peptide KC836854_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836858_HBe_P-A Product feature CHAIN KC836858_HBe_P-A of FT:mat_peptide KC836858_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875251_HBe_P-A Product feature CHAIN KC875251_HBe_P-A of FT:mat_peptide KC875251_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPH
HPALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875252_HBe_P-A Product feature CHAIN KC875252_HBe_P-A of FT:mat_peptide KC875252_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIHCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875253_HBe_P-A Product feature CHAIN KC875253_HBe_P-A of FT:mat_peptide KC875253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875255_HBe_P-A Product feature CHAIN KC875255_HBe_P-A of FT:mat_peptide KC875255_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVPFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875256_HBe_P-A Product feature CHAIN KC875256_HBe_P-A of FT:mat_peptide KC875256_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCAPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875257_HBe_P-A Product feature CHAIN KC875257_HBe_P-A of FT:mat_peptide KC875257_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV14). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWAGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875258_HBe_P-A Product feature CHAIN KC875258_HBe_P-A of FT:mat_peptide KC875258_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV66). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875259_HBe_P-A Product feature CHAIN KC875259_HBe_P-A of FT:mat_peptide KC875259_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYQEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875260_HBe_P-A Product feature CHAIN KC875260_HBe_P-A of FT:mat_peptide KC875260_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214657_HBe_P-A Product feature CHAIN KF214657_HBe_P-A of FT:mat_peptide KF214657_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214658_HBe_P-A Product feature CHAIN KF214658_HBe_P-A of FT:mat_peptide KF214658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASQLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGKLMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214659_HBe_P-A Product feature CHAIN KF214659_HBe_P-A of FT:mat_peptide KF214659_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214660_HBe_P-A Product feature CHAIN KF214660_HBe_P-A of FT:mat_peptide KF214660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLISSCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLQDTASALYREALESPEHCSHH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214661_HBe_P-A Product feature CHAIN KF214661_HBe_P-A of FT:mat_peptide KF214661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRRAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214662_HBe_P-A Product feature CHAIN KF214662_HBe_P-A of FT:mat_peptide KF214662_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214663_HBe_P-A Product feature CHAIN KF214663_HBe_P-A of FT:mat_peptide KF214663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214665_HBe_P-A Product feature CHAIN KF214665_HBe_P-A of FT:mat_peptide KF214665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214666_HBe_P-A Product feature CHAIN KF214666_HBe_P-A of FT:mat_peptide KF214666_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELTTLAGWVGHNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF798265_HBe_P-A Product feature CHAIN KF798265_HBe_P-A of FT:mat_peptide KF798265_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPEIAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798266_HBe_P-A Product feature CHAIN KF798266_HBe_P-A of FT:mat_peptide KF798266_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF798267_HBe_P-A Product feature CHAIN KF798267_HBe_P-A of FT:mat_peptide KF798267_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798271_HBe_P-A Product feature CHAIN KF798271_HBe_P-A of FT:mat_peptide KF798271_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798278_HBe_P-A Product feature CHAIN KF798278_HBe_P-A of FT:mat_peptide KF798278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798279_HBe_P-A Product feature CHAIN KF798279_HBe_P-A of FT:mat_peptide KF798279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798285_HBe_P-A Product feature CHAIN KF798285_HBe_P-A of FT:mat_peptide KF798285_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798286_HBe_P-A Product feature CHAIN KF798286_HBe_P-A of FT:mat_peptide KF798286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798289_HBe_P-A Product feature CHAIN KF798289_HBe_P-A of FT:mat_peptide KF798289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798290_HBe_P-A Product feature CHAIN KF798290_HBe_P-A of FT:mat_peptide KF798290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798291_HBe_P-A Product feature CHAIN KF798291_HBe_P-A of FT:mat_peptide KF798291_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798292_HBe_P-A Product feature CHAIN KF798292_HBe_P-A of FT:mat_peptide KF798292_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798302_HBe_P-A Product feature CHAIN KF798302_HBe_P-A of FT:mat_peptide KF798302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798308_HBe_P-A Product feature CHAIN KF798308_HBe_P-A of FT:mat_peptide KF798308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798309_HBe_P-A Product feature CHAIN KF798309_HBe_P-A of FT:mat_peptide KF798309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-51). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798310_HBe_P-A Product feature CHAIN KF798310_HBe_P-A of FT:mat_peptide KF798310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798311_HBe_P-A Product feature CHAIN KF798311_HBe_P-A of FT:mat_peptide KF798311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798314_HBe_P-A Product feature CHAIN KF798314_HBe_P-A of FT:mat_peptide KF798314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922406_HBe_P-A Product feature CHAIN KF922406_HBe_P-A of FT:mat_peptide KF922406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922407_HBe_P-A Product feature CHAIN KF922407_HBe_P-A of FT:mat_peptide KF922407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922408_HBe_P-A Product feature CHAIN KF922408_HBe_P-A of FT:mat_peptide KF922408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCPTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922409_HBe_P-A Product feature CHAIN KF922409_HBe_P-A of FT:mat_peptide KF922409_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|KF922414_HBe_P-A Product feature CHAIN KF922414_HBe_P-A of FT:mat_peptide KF922414_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSSLPETTVVRRRGRDRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922415_HBe_P-A Product feature CHAIN KF922415_HBe_P-A of FT:mat_peptide KF922415_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSSLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922416_HBe_P-A Product feature CHAIN KF922416_HBe_P-A of FT:mat_peptide KF922416_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSSLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922418_HBe_P-A Product feature CHAIN KF922418_HBe_P-A of FT:mat_peptide KF922418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSSLPETTVVRRRGRGRSPGRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922419_HBe_P-A Product feature CHAIN KF922419_HBe_P-A of FT:mat_peptide KF922419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSSLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922420_HBe_P-A Product feature CHAIN KF922420_HBe_P-A of FT:mat_peptide KF922420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSSLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922421_HBe_P-A Product feature CHAIN KF922421_HBe_P-A of FT:mat_peptide KF922421_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPA
YGPPNAPILSSLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922424_HBe_P-A Product feature CHAIN KF922424_HBe_P-A of FT:mat_peptide KF922424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922425_HBe_P-A Product feature CHAIN KF922425_HBe_P-A of FT:mat_peptide KF922425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922426_HBe_P-A Product feature CHAIN KF922426_HBe_P-A of FT:mat_peptide KF922426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922427_HBe_P-A Product feature CHAIN KF922427_HBe_P-A of FT:mat_peptide KF922427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922428_HBe_P-A Product feature CHAIN KF922428_HBe_P-A of FT:mat_peptide KF922428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922429_HBe_P-A Product feature CHAIN KF922429_HBe_P-A of FT:mat_peptide KF922429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPH
HTAIRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922430_HBe_P-A Product feature CHAIN KF922430_HBe_P-A of FT:mat_peptide KF922430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPH
HTAIRQAILCWGELMIFATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922431_HBe_P-A Product feature CHAIN KF922431_HBe_P-A of FT:mat_peptide KF922431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPH
HTAIRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ010776_HBe_P-A Product feature CHAIN KJ010776_HBe_P-A of FT:mat_peptide KJ010776_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ010777_HBe_P-A Product feature CHAIN KJ010777_HBe_P-A of FT:mat_peptide KJ010777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ010778_HBe_P-A Product feature CHAIN KJ010778_HBe_P-A of FT:mat_peptide KJ010778_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ586809_HBe_P-A Product feature CHAIN KJ586809_HBe_P-A of FT:mat_peptide KJ586809_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLNTASALYREALESPEHCSPH
HTALRQAILCWGELMTLSTWVGNNLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843166_HBe_P-A Product feature CHAIN KJ843166_HBe_P-A of FT:mat_peptide KJ843166_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843172_HBe_P-A Product feature CHAIN KJ843172_HBe_P-A of FT:mat_peptide KJ843172_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPEITVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843173_HBe_P-A Product feature CHAIN KJ843173_HBe_P-A of FT:mat_peptide KJ843173_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843182_HBe_P-A Product feature CHAIN KJ843182_HBe_P-A of FT:mat_peptide KJ843182_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843183_HBe_P-A Product feature CHAIN KJ843183_HBe_P-A of FT:mat_peptide KJ843183_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843184_HBe_P-A Product feature CHAIN KJ843184_HBe_P-A of FT:mat_peptide KJ843184_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIXTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843186_HBe_P-A Product feature CHAIN KJ843186_HBe_P-A of FT:mat_peptide KJ843186_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843188_HBe_P-A Product feature CHAIN KJ843188_HBe_P-A of FT:mat_peptide KJ843188_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843192_HBe_P-A Product feature CHAIN KJ843192_HBe_P-A of FT:mat_peptide KJ843192_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843214_HBe_P-A Product feature CHAIN KJ843214_HBe_P-A of FT:mat_peptide KJ843214_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843215_HBe_P-A Product feature CHAIN KJ843215_HBe_P-A of FT:mat_peptide KJ843215_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843216_HBe_P-A Product feature CHAIN KJ843216_HBe_P-A of FT:mat_peptide KJ843216_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843217_HBe_P-A Product feature CHAIN KJ843217_HBe_P-A of FT:mat_peptide KJ843217_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843218_HBe_P-A Product feature CHAIN KJ843218_HBe_P-A of FT:mat_peptide KJ843218_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854685_HBe_P-A Product feature CHAIN KJ854685_HBe_P-A of FT:mat_peptide KJ854685_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMAIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELSTLGTWVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854686_HBe_P-A Product feature CHAIN KJ854686_HBe_P-A of FT:mat_peptide KJ854686_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|KJ854687_HBe_P-A Product feature CHAIN KJ854687_HBe_P-A of FT:mat_peptide KJ854687_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854688_HBe_P-A Product feature CHAIN KJ854688_HBe_P-A of FT:mat_peptide KJ854688_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854689_HBe_P-A Product feature CHAIN KJ854689_HBe_P-A of FT:mat_peptide KJ854689_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854690_HBe_P-A Product feature CHAIN KJ854690_HBe_P-A of FT:mat_peptide KJ854690_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTSSALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854691_HBe_P-A Product feature CHAIN KJ854691_HBe_P-A of FT:mat_peptide KJ854691_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIXSCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854692_HBe_P-A Product feature CHAIN KJ854692_HBe_P-A of FT:mat_peptide KJ854692_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854693_HBe_P-A Product feature CHAIN KJ854693_HBe_P-A of FT:mat_peptide KJ854693_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17545-NE-BRA). Complete genome. [Hepadnaviridae] (length=212 residues).
LFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHT
ALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854694_HBe_P-A Product feature CHAIN KJ854694_HBe_P-A of FT:mat_peptide KJ854694_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854696_HBe_P-A Product feature CHAIN KJ854696_HBe_P-A of FT:mat_peptide KJ854696_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854697_HBe_P-A Product feature CHAIN KJ854697_HBe_P-A of FT:mat_peptide KJ854697_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854698_HBe_P-A Product feature CHAIN KJ854698_HBe_P-A of FT:mat_peptide KJ854698_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1993-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
LFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHT
ALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854699_HBe_P-A Product feature CHAIN KJ854699_HBe_P-A of FT:mat_peptide KJ854699_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854700_HBe_P-A Product feature CHAIN KJ854700_HBe_P-A of FT:mat_peptide KJ854700_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854701_HBe_P-A Product feature CHAIN KJ854701_HBe_P-A of FT:mat_peptide KJ854701_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPTARDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDILTLGTWVGNNLEDQTSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ854702_HBe_P-A Product feature CHAIN KJ854702_HBe_P-A of FT:mat_peptide KJ854702_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854703_HBe_P-A Product feature CHAIN KJ854703_HBe_P-A of FT:mat_peptide KJ854703_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDFDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLXXNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854704_HBe_P-A Product feature CHAIN KJ854704_HBe_P-A of FT:mat_peptide KJ854704_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854705_HBe_P-A Product feature CHAIN KJ854705_HBe_P-A of FT:mat_peptide KJ854705_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854706_HBe_P-A Product feature CHAIN KJ854706_HBe_P-A of FT:mat_peptide KJ854706_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854707_HBe_P-A Product feature CHAIN KJ854707_HBe_P-A of FT:mat_peptide KJ854707_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854708_HBe_P-A Product feature CHAIN KJ854708_HBe_P-A of FT:mat_peptide KJ854708_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIXSCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854709_HBe_P-A Product feature CHAIN KJ854709_HBe_P-A of FT:mat_peptide KJ854709_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=212 residues).
LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHT
ALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854710_HBe_P-A Product feature CHAIN KJ854710_HBe_P-A of FT:mat_peptide KJ854710_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM243029_HBe_P-A Product feature CHAIN KM243029_HBe_P-A of FT:mat_peptide KM243029_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM519452_HBe_P-A Product feature CHAIN KM519452_HBe_P-A of FT:mat_peptide KM519452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM519453_HBe_P-A Product feature CHAIN KM519453_HBe_P-A of FT:mat_peptide KM519453_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM519454_HBe_P-A Product feature CHAIN KM519454_HBe_P-A of FT:mat_peptide KM519454_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606647_HBe_P-A Product feature CHAIN KM606647_HBe_P-A of FT:mat_peptide KM606647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba10a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDHYKEFGATVELLSFLPLDFFPSARDLLETASALYRESLESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRDTVLQYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606648_HBe_P-A Product feature CHAIN KM606648_HBe_P-A of FT:mat_peptide KM606648_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606649_HBe_P-A Product feature CHAIN KM606649_HBe_P-A of FT:mat_peptide KM606649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba15a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPTRRTPSPRTRISQSPRRKRSQSRQSQC
>gnl|hbvpro|KM606650_HBe_P-A Product feature CHAIN KM606650_HBe_P-A of FT:mat_peptide KM606650_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba16a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMTLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606652_HBe_P-A Product feature CHAIN KM606652_HBe_P-A of FT:mat_peptide KM606652_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba20a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606653_HBe_P-A Product feature CHAIN KM606653_HBe_P-A of FT:mat_peptide KM606653_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba21a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPH
HTALRQEILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606656_HBe_P-A Product feature CHAIN KM606656_HBe_P-A of FT:mat_peptide KM606656_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba26a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606658_HBe_P-A Product feature CHAIN KM606658_HBe_P-A of FT:mat_peptide KM606658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba31a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606660_HBe_P-A Product feature CHAIN KM606660_HBe_P-A of FT:mat_peptide KM606660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba34a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606661_HBe_P-A Product feature CHAIN KM606661_HBe_P-A of FT:mat_peptide KM606661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba35a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606663_HBe_P-A Product feature CHAIN KM606663_HBe_P-A of FT:mat_peptide KM606663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba38a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606665_HBe_P-A Product feature CHAIN KM606665_HBe_P-A of FT:mat_peptide KM606665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba40a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606666_HBe_P-A Product feature CHAIN KM606666_HBe_P-A of FT:mat_peptide KM606666_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba41a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606669_HBe_P-A Product feature CHAIN KM606669_HBe_P-A of FT:mat_peptide KM606669_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba45a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606672_HBe_P-A Product feature CHAIN KM606672_HBe_P-A of FT:mat_peptide KM606672_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba54a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTPPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606673_HBe_P-A Product feature CHAIN KM606673_HBe_P-A of FT:mat_peptide KM606673_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba55a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606674_HBe_P-A Product feature CHAIN KM606674_HBe_P-A of FT:mat_peptide KM606674_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606676_HBe_P-A Product feature CHAIN KM606676_HBe_P-A of FT:mat_peptide KM606676_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba59a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606677_HBe_P-A Product feature CHAIN KM606677_HBe_P-A of FT:mat_peptide KM606677_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba60a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606678_HBe_P-A Product feature CHAIN KM606678_HBe_P-A of FT:mat_peptide KM606678_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba61a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606680_HBe_P-A Product feature CHAIN KM606680_HBe_P-A of FT:mat_peptide KM606680_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba66a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606683_HBe_P-A Product feature CHAIN KM606683_HBe_P-A of FT:mat_peptide KM606683_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba69a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606684_HBe_P-A Product feature CHAIN KM606684_HBe_P-A of FT:mat_peptide KM606684_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba71a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606685_HBe_P-A Product feature CHAIN KM606685_HBe_P-A of FT:mat_peptide KM606685_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba72a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606687_HBe_P-A Product feature CHAIN KM606687_HBe_P-A of FT:mat_peptide KM606687_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba75a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606688_HBe_P-A Product feature CHAIN KM606688_HBe_P-A of FT:mat_peptide KM606688_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba78a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606691_HBe_P-A Product feature CHAIN KM606691_HBe_P-A of FT:mat_peptide KM606691_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba82a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606694_HBe_P-A Product feature CHAIN KM606694_HBe_P-A of FT:mat_peptide KM606694_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba85a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606695_HBe_P-A Product feature CHAIN KM606695_HBe_P-A of FT:mat_peptide KM606695_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba86a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQAYKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPH
HTALRQAILCWGELMTLATWAGNNLEDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRTRSQSRESQC
>gnl|hbvpro|KM606696_HBe_P-A Product feature CHAIN KM606696_HBe_P-A of FT:mat_peptide KM606696_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba89a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATTELVSFLPSDFFPNTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRE
>gnl|hbvpro|KM606700_HBe_P-A Product feature CHAIN KM606700_HBe_P-A of FT:mat_peptide KM606700_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba100a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606737_HBe_P-A Product feature CHAIN KM606737_HBe_P-A of FT:mat_peptide KM606737_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606742_HBe_P-A Product feature CHAIN KM606742_HBe_P-A of FT:mat_peptide KM606742_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDFLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606746_HBe_P-A Product feature CHAIN KM606746_HBe_P-A of FT:mat_peptide KM606746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606749_HBe_P-A Product feature CHAIN KM606749_HBe_P-A of FT:mat_peptide KM606749_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168423_HBe_P-A Product feature CHAIN KP168423_HBe_P-A of FT:mat_peptide KP168423_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168424_HBe_P-A Product feature CHAIN KP168424_HBe_P-A of FT:mat_peptide KP168424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168425_HBe_P-A Product feature CHAIN KP168425_HBe_P-A of FT:mat_peptide KP168425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIFWWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168426_HBe_P-A Product feature CHAIN KP168426_HBe_P-A of FT:mat_peptide KP168426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRXPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168427_HBe_P-A Product feature CHAIN KP168427_HBe_P-A of FT:mat_peptide KP168427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168428_HBe_P-A Product feature CHAIN KP168428_HBe_P-A of FT:mat_peptide KP168428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAVLCWGELMTLATWVGNNLDDXASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP168429_HBe_P-A Product feature CHAIN KP168429_HBe_P-A of FT:mat_peptide KP168429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLXSDFFPSVRDLLDTXSALYREALESPEHCSPH
HTALRQAILWWXELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168430_HBe_P-A Product feature CHAIN KP168430_HBe_P-A of FT:mat_peptide KP168430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168432_HBe_P-A Product feature CHAIN KP168432_HBe_P-A of FT:mat_peptide KP168432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168433_HBe_P-A Product feature CHAIN KP168433_HBe_P-A of FT:mat_peptide KP168433_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168434_HBe_P-A Product feature CHAIN KP168434_HBe_P-A of FT:mat_peptide KP168434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168435_HBe_P-A Product feature CHAIN KP168435_HBe_P-A of FT:mat_peptide KP168435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP274925_HBe_P-A Product feature CHAIN KP274925_HBe_P-A of FT:mat_peptide KP274925_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP274927_HBe_P-A Product feature CHAIN KP274927_HBe_P-A of FT:mat_peptide KP274927_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP274928_HBe_P-A Product feature CHAIN KP274928_HBe_P-A of FT:mat_peptide KP274928_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLMMSCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718085_HBe_P-A Product feature CHAIN KP718085_HBe_P-A of FT:mat_peptide KP718085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718086_HBe_P-A Product feature CHAIN KP718086_HBe_P-A of FT:mat_peptide KP718086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718087_HBe_P-A Product feature CHAIN KP718087_HBe_P-A of FT:mat_peptide KP718087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718088_HBe_P-A Product feature CHAIN KP718088_HBe_P-A of FT:mat_peptide KP718088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718089_HBe_P-A Product feature CHAIN KP718089_HBe_P-A of FT:mat_peptide KP718089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEXPEHCSPH
HTALRQAIXCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718090_HBe_P-A Product feature CHAIN KP718090_HBe_P-A of FT:mat_peptide KP718090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIIXCTCPXVXAXKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718091_HBe_P-A Product feature CHAIN KP718091_HBe_P-A of FT:mat_peptide KP718091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718092_HBe_P-A Product feature CHAIN KP718092_HBe_P-A of FT:mat_peptide KP718092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIIXCTCPTVQAXKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718093_HBe_P-A Product feature CHAIN KP718093_HBe_P-A of FT:mat_peptide KP718093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLLHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718094_HBe_P-A Product feature CHAIN KP718094_HBe_P-A of FT:mat_peptide KP718094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGVKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718095_HBe_P-A Product feature CHAIN KP718095_HBe_P-A of FT:mat_peptide KP718095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718096_HBe_P-A Product feature CHAIN KP718096_HBe_P-A of FT:mat_peptide KP718096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCIIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718097_HBe_P-A Product feature CHAIN KP718097_HBe_P-A of FT:mat_peptide KP718097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718098_HBe_P-A Product feature CHAIN KP718098_HBe_P-A of FT:mat_peptide KP718098_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718099_HBe_P-A Product feature CHAIN KP718099_HBe_P-A of FT:mat_peptide KP718099_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718100_HBe_P-A Product feature CHAIN KP718100_HBe_P-A of FT:mat_peptide KP718100_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718101_HBe_P-A Product feature CHAIN KP718101_HBe_P-A of FT:mat_peptide KP718101_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPHPRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857058_HBe_P-A Product feature CHAIN KP857058_HBe_P-A of FT:mat_peptide KP857058_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857059_HBe_P-A Product feature CHAIN KP857059_HBe_P-A of FT:mat_peptide KP857059_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPP
YRPQNAPILSTLPETAVVRGSNRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KP857060_HBe_P-A Product feature CHAIN KP857060_HBe_P-A of FT:mat_peptide KP857060_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSARDLLDTAAALFREALESPEHCSPH
HTALRQASLCWVELMTLATWVGNNLQDTASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSMLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|KP857061_HBe_P-A Product feature CHAIN KP857061_HBe_P-A of FT:mat_peptide KP857061_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRQRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857062_HBe_P-A Product feature CHAIN KP857062_HBe_P-A of FT:mat_peptide KP857062_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857063_HBe_P-A Product feature CHAIN KP857063_HBe_P-A of FT:mat_peptide KP857063_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857064_HBe_P-A Product feature CHAIN KP857064_HBe_P-A of FT:mat_peptide KP857064_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALEAPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVLRRRDRGRSPRGRTPSPRRRRSKSPRRRRSQSREPQC
>gnl|hbvpro|KP857065_HBe_P-A Product feature CHAIN KP857065_HBe_P-A of FT:mat_peptide KP857065_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSAH
HTAIRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRGRARGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KP857066_HBe_P-A Product feature CHAIN KP857066_HBe_P-A of FT:mat_peptide KP857066_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLVISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVKDLYDTALALHREALESPEHCTHH
HTALRQAILCWGDLMNLANWVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPLNAPILSTLPECTVVRQRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857067_HBe_P-A Product feature CHAIN KP857067_HBe_P-A of FT:mat_peptide KP857067_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESAEHCSPH
HTALRQAILCWGDVMTLGTWVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVWIRTPPA
YRPPNAPILSTLPETTVXRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857068_HBe_P-A Product feature CHAIN KP857068_HBe_P-A of FT:mat_peptide KP857068_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLFISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTAIRQIVLCWGDVMNLATWVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVVEYLVSFGVWIRTPPA
YRPLNAPILSTLPETTVVRCRDRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857069_HBe_P-A Product feature CHAIN KP857069_HBe_P-A of FT:mat_peptide KP857069_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSSH
HTALRQAILCWGELTTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857070_HBe_P-A Product feature CHAIN KP857070_HBe_P-A of FT:mat_peptide KP857070_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPH
HTALRQAILCWGDLTTLGSWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPVNAPILSTLPETTVVRSRNRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857071_HBe_P-A Product feature CHAIN KP857071_HBe_P-A of FT:mat_peptide KP857071_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSPH
HTALRQAILCWGDLTTLGSWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPVNAPILSTLPETTVVRSRNRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857072_HBe_P-A Product feature CHAIN KP857072_HBe_P-A of FT:mat_peptide KP857072_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLFTSCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALFREALESPEHGSSH
HTALRQAILCWQEVTTLASWVGTNLDDPSSRDQVVHYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857073_HBe_P-A Product feature CHAIN KP857073_HBe_P-A of FT:mat_peptide KP857073_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFYPSVRDLLDTATALYREALESPEHCSAH
HTAIRQAILCWGELMTLASWVGANLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRHTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGGSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857074_HBe_P-A Product feature CHAIN KP857074_HBe_P-A of FT:mat_peptide KP857074_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPNDFYPSVKDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMTLATWVGNNLEDQASRNLVVDYVNNNVGLRLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857075_HBe_P-A Product feature CHAIN KP857075_HBe_P-A of FT:mat_peptide KP857075_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSPH
HTALRQAALCWWELTTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSRC
>gnl|hbvpro|KP857076_HBe_P-A Product feature CHAIN KP857076_HBe_P-A of FT:mat_peptide KP857076_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPH
HTALRQAILCWGEVTXLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPT
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP857077_HBe_P-A Product feature CHAIN KP857077_HBe_P-A of FT:mat_peptide KP857077_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPIDFYPSVRDLIETASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPA
YRPTNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857078_HBe_P-A Product feature CHAIN KP857078_HBe_P-A of FT:mat_peptide KP857078_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSTKDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMTLGTWVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRPRHRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|KP857079_HBe_P-A Product feature CHAIN KP857079_HBe_P-A of FT:mat_peptide KP857079_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MPLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHXSPH
HTALRQAILCWGXVMTLGTWVGBNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857080_HBe_P-A Product feature CHAIN KP857080_HBe_P-A of FT:mat_peptide KP857080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRXRDRGRAPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857091_HBe_P-A Product feature CHAIN KP857091_HBe_P-A of FT:mat_peptide KP857091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSHH
HTAIRQAILCWGELTTLATWVGTNLDDPGSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857092_HBe_P-A Product feature CHAIN KP857092_HBe_P-A of FT:mat_peptide KP857092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWVELXTLATWVGNNLEDPASRDQVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP995108_HBe_P-A Product feature CHAIN KP995108_HBe_P-A of FT:mat_peptide KP995108_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGATVELLSFLPSDFYPSVRDLVDTASALYREALESPEHGSPH
HTALRQAIVCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR905425_HBe_P-A Product feature CHAIN KR905425_HBe_P-A of FT:mat_peptide KR905425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPEIAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905426_HBe_P-A Product feature CHAIN KR905426_HBe_P-A of FT:mat_peptide KR905426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905427_HBe_P-A Product feature CHAIN KR905427_HBe_P-A of FT:mat_peptide KR905427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEAPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPV
YRPPNAPILSTLPETTVIRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KR905429_HBe_P-A Product feature CHAIN KR905429_HBe_P-A of FT:mat_peptide KR905429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905430_HBe_P-A Product feature CHAIN KR905430_HBe_P-A of FT:mat_peptide KR905430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905431_HBe_P-A Product feature CHAIN KR905431_HBe_P-A of FT:mat_peptide KR905431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151611_HBe_P-A Product feature CHAIN KT151611_HBe_P-A of FT:mat_peptide KT151611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151612_HBe_P-A Product feature CHAIN KT151612_HBe_P-A of FT:mat_peptide KT151612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPANAPILSTLPETTVIRGRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151613_HBe_P-A Product feature CHAIN KT151613_HBe_P-A of FT:mat_peptide KT151613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151614_HBe_P-A Product feature CHAIN KT151614_HBe_P-A of FT:mat_peptide KT151614_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151615_HBe_P-A Product feature CHAIN KT151615_HBe_P-A of FT:mat_peptide KT151615_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDHYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151616_HBe_P-A Product feature CHAIN KT151616_HBe_P-A of FT:mat_peptide KT151616_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151617_HBe_P-A Product feature CHAIN KT151617_HBe_P-A of FT:mat_peptide KT151617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPXNAPILSTLPETTVIRGRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151618_HBe_P-A Product feature CHAIN KT151618_HBe_P-A of FT:mat_peptide KT151618_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT347087_HBe_P-A Product feature CHAIN KT347087_HBe_P-A of FT:mat_peptide KT347087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT347088_HBe_P-A Product feature CHAIN KT347088_HBe_P-A of FT:mat_peptide KT347088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366466_HBe_P-A Product feature CHAIN KT366466_HBe_P-A of FT:mat_peptide KT366466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPEIAVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366467_HBe_P-A Product feature CHAIN KT366467_HBe_P-A of FT:mat_peptide KT366467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366468_HBe_P-A Product feature CHAIN KT366468_HBe_P-A of FT:mat_peptide KT366468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366469_HBe_P-A Product feature CHAIN KT366469_HBe_P-A of FT:mat_peptide KT366469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366470_HBe_P-A Product feature CHAIN KT366470_HBe_P-A of FT:mat_peptide KT366470_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366471_HBe_P-A Product feature CHAIN KT366471_HBe_P-A of FT:mat_peptide KT366471_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749824_HBe_P-A Product feature CHAIN KT749824_HBe_P-A of FT:mat_peptide KT749824_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749825_HBe_P-A Product feature CHAIN KT749825_HBe_P-A of FT:mat_peptide KT749825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749826_HBe_P-A Product feature CHAIN KT749826_HBe_P-A of FT:mat_peptide KT749826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749829_HBe_P-A Product feature CHAIN KT749829_HBe_P-A of FT:mat_peptide KT749829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749830_HBe_P-A Product feature CHAIN KT749830_HBe_P-A of FT:mat_peptide KT749830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749831_HBe_P-A Product feature CHAIN KT749831_HBe_P-A of FT:mat_peptide KT749831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749832_HBe_P-A Product feature CHAIN KT749832_HBe_P-A of FT:mat_peptide KT749832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELISFLPADFFPSVRDLLDTASALFREALESPEHCSAH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749833_HBe_P-A Product feature CHAIN KT749833_HBe_P-A of FT:mat_peptide KT749833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSPH
HTALRQAIVCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749834_HBe_P-A Product feature CHAIN KT749834_HBe_P-A of FT:mat_peptide KT749834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRIRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749835_HBe_P-A Product feature CHAIN KT749835_HBe_P-A of FT:mat_peptide KT749835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749836_HBe_P-A Product feature CHAIN KT749836_HBe_P-A of FT:mat_peptide KT749836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749837_HBe_P-A Product feature CHAIN KT749837_HBe_P-A of FT:mat_peptide KT749837_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749838_HBe_P-A Product feature CHAIN KT749838_HBe_P-A of FT:mat_peptide KT749838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749839_HBe_P-A Product feature CHAIN KT749839_HBe_P-A of FT:mat_peptide KT749839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRTRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749840_HBe_P-A Product feature CHAIN KT749840_HBe_P-A of FT:mat_peptide KT749840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749842_HBe_P-A Product feature CHAIN KT749842_HBe_P-A of FT:mat_peptide KT749842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749843_HBe_P-A Product feature CHAIN KT749843_HBe_P-A of FT:mat_peptide KT749843_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAMYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749844_HBe_P-A Product feature CHAIN KT749844_HBe_P-A of FT:mat_peptide KT749844_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749846_HBe_P-A Product feature CHAIN KT749846_HBe_P-A of FT:mat_peptide KT749846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749847_HBe_P-A Product feature CHAIN KT749847_HBe_P-A of FT:mat_peptide KT749847_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749849_HBe_P-A Product feature CHAIN KT749849_HBe_P-A of FT:mat_peptide KT749849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749850_HBe_P-A Product feature CHAIN KT749850_HBe_P-A of FT:mat_peptide KT749850_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605516_HBe_P-A Product feature CHAIN KU605516_HBe_P-A of FT:mat_peptide KU605516_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605517_HBe_P-A Product feature CHAIN KU605517_HBe_P-A of FT:mat_peptide KU605517_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605518_HBe_P-A Product feature CHAIN KU605518_HBe_P-A of FT:mat_peptide KU605518_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605519_HBe_P-A Product feature CHAIN KU605519_HBe_P-A of FT:mat_peptide KU605519_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605520_HBe_P-A Product feature CHAIN KU605520_HBe_P-A of FT:mat_peptide KU605520_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605521_HBe_P-A Product feature CHAIN KU605521_HBe_P-A of FT:mat_peptide KU605521_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605522_HBe_P-A Product feature CHAIN KU605522_HBe_P-A of FT:mat_peptide KU605522_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605532_HBe_P-A Product feature CHAIN KU605532_HBe_P-A of FT:mat_peptide KU605532_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605533_HBe_P-A Product feature CHAIN KU605533_HBe_P-A of FT:mat_peptide KU605533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=214 residues).
MQIFHLCIIISYSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605534_HBe_P-A Product feature CHAIN KU605534_HBe_P-A of FT:mat_peptide KU605534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605535_HBe_P-A Product feature CHAIN KU605535_HBe_P-A of FT:mat_peptide KU605535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=213 residues).
QLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHH
TALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAY
RPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605536_HBe_P-A Product feature CHAIN KU605536_HBe_P-A of FT:mat_peptide KU605536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=213 residues).
QIFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHH
TALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAY
RPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605537_HBe_P-A Product feature CHAIN KU605537_HBe_P-A of FT:mat_peptide KU605537_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605538_HBe_P-A Product feature CHAIN KU605538_HBe_P-A of FT:mat_peptide KU605538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605539_HBe_P-A Product feature CHAIN KU605539_HBe_P-A of FT:mat_peptide KU605539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736918_HBe_P-A Product feature CHAIN KU736918_HBe_P-A of FT:mat_peptide KU736918_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736919_HBe_P-A Product feature CHAIN KU736919_HBe_P-A of FT:mat_peptide KU736919_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736920_HBe_P-A Product feature CHAIN KU736920_HBe_P-A of FT:mat_peptide KU736920_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKXFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276769_HBe_P-A Product feature CHAIN KX276769_HBe_P-A of FT:mat_peptide KX276769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIXSCTCPTFQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSH
HTALRQAILCWGELMTLASWVGNNLQDPASRDQVVSYVNTNMGLKIRQLLWFHISCLTFGRDAVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KX357640_HBe_P-A Product feature CHAIN KX357640_HBe_P-A of FT:mat_peptide KX357640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA11ETH). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVTNLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX357642_HBe_P-A Product feature CHAIN KX357642_HBe_P-A of FT:mat_peptide KX357642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357643_HBe_P-A Product feature CHAIN KX357643_HBe_P-A of FT:mat_peptide KX357643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357644_HBe_P-A Product feature CHAIN KX357644_HBe_P-A of FT:mat_peptide KX357644_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357645_HBe_P-A Product feature CHAIN KX357645_HBe_P-A of FT:mat_peptide KX357645_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357646_HBe_P-A Product feature CHAIN KX357646_HBe_P-A of FT:mat_peptide KX357646_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357647_HBe_P-A Product feature CHAIN KX357647_HBe_P-A of FT:mat_peptide KX357647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357649_HBe_P-A Product feature CHAIN KX357649_HBe_P-A of FT:mat_peptide KX357649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPRDFYPSVRDLIDTASALFREALESPEHCSPH
HTALRQAVLCWGELMTLAXWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX648547_HBe_P-A Product feature CHAIN KX648547_HBe_P-A of FT:mat_peptide KX648547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATXELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGXGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX648548_HBe_P-A Product feature CHAIN KX648548_HBe_P-A of FT:mat_peptide KX648548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX648549_HBe_P-A Product feature CHAIN KX648549_HBe_P-A of FT:mat_peptide KX648549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRXPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX686607_HBe_P-A Product feature CHAIN KX686607_HBe_P-A of FT:mat_peptide KX686607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1522). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827293_HBe_P-A Product feature CHAIN KX827293_HBe_P-A of FT:mat_peptide KX827293_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827294_HBe_P-A Product feature CHAIN KX827294_HBe_P-A of FT:mat_peptide KX827294_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGKLMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827295_HBe_P-A Product feature CHAIN KX827295_HBe_P-A of FT:mat_peptide KX827295_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIPCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827296_HBe_P-A Product feature CHAIN KX827296_HBe_P-A of FT:mat_peptide KX827296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827298_HBe_P-A Product feature CHAIN KX827298_HBe_P-A of FT:mat_peptide KX827298_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY003230_HBe_P-A Product feature CHAIN KY003230_HBe_P-A of FT:mat_peptide KY003230_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY382410_HBe_P-A Product feature CHAIN KY382410_HBe_P-A of FT:mat_peptide KY382410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY886219_HBe_P-A Product feature CHAIN KY886219_HBe_P-A of FT:mat_peptide KY886219_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|L13994_HBe_P-A Product feature CHAIN L13994_HBe_P-A of FT:mat_peptide L13994_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC051141_HBe_P-A Product feature CHAIN LC051141_HBe_P-A of FT:mat_peptide LC051141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC074724_HBe_P-A Product feature CHAIN LC074724_HBe_P-A of FT:mat_peptide LC074724_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC311241_HBe_P-A Product feature CHAIN LC311241_HBe_P-A of FT:mat_peptide LC311241_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC311242_HBe_P-A Product feature CHAIN LC311242_HBe_P-A of FT:mat_peptide LC311242_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPN
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC311243_HBe_P-A Product feature CHAIN LC311243_HBe_P-A of FT:mat_peptide LC311243_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC458430_HBe_P-A Product feature CHAIN LC458430_HBe_P-A of FT:mat_peptide LC458430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC458431_HBe_P-A Product feature CHAIN LC458431_HBe_P-A of FT:mat_peptide LC458431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LK995385_HBe_P-A Product feature CHAIN LK995385_HBe_P-A of FT:mat_peptide LK995385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NAT2037658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992440_HBe_P-A Product feature CHAIN LT992440_HBe_P-A of FT:mat_peptide LT992440_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA119). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992441_HBe_P-A Product feature CHAIN LT992441_HBe_P-A of FT:mat_peptide LT992441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992448_HBe_P-A Product feature CHAIN LT992448_HBe_P-A of FT:mat_peptide LT992448_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RISE386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|M57663_HBe_P-A Product feature CHAIN M57663_HBe_P-A of FT:mat_peptide M57663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGKLMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|M74501_HBe_P-A Product feature CHAIN M74501_HBe_P-A of FT:mat_peptide M74501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF536836_HBe_P-A Product feature CHAIN MF536836_HBe_P-A of FT:mat_peptide MF536836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate T2029C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=215 residues).
MQLFHLCLFISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLHTASALYREALESPEHCSSH
HTALRQAILCWGELLYSLPTWVGNNLQDPASRDLHVNYVNTNMGLKIRQLLWFHISCLTFGRLVVLEYLVSFGVWIRTPP
PYRPPNAPILSTLPETTVVRCRDRVRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772344_HBe_P-A Product feature CHAIN MF772344_HBe_P-A of FT:mat_peptide MF772344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772346_HBe_P-A Product feature CHAIN MF772346_HBe_P-A of FT:mat_peptide MF772346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772348_HBe_P-A Product feature CHAIN MF772348_HBe_P-A of FT:mat_peptide MF772348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPA
YRPLNAPILSTLPETTVVRRRDRVRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772350_HBe_P-A Product feature CHAIN MF772350_HBe_P-A of FT:mat_peptide MF772350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772351_HBe_P-A Product feature CHAIN MF772351_HBe_P-A of FT:mat_peptide MF772351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772353_HBe_P-A Product feature CHAIN MF772353_HBe_P-A of FT:mat_peptide MF772353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIIFCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWXGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925361_HBe_P-A Product feature CHAIN MF925361_HBe_P-A of FT:mat_peptide MF925361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925362_HBe_P-A Product feature CHAIN MF925362_HBe_P-A of FT:mat_peptide MF925362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV05). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPNVRDLLDTASALFREALESPEHCSPH
HTALRQAILCWGDVMNLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGQGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925368_HBe_P-A Product feature CHAIN MF925368_HBe_P-A of FT:mat_peptide MF925368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925372_HBe_P-A Product feature CHAIN MF925372_HBe_P-A of FT:mat_peptide MF925372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWLRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MF925373_HBe_P-A Product feature CHAIN MF925373_HBe_P-A of FT:mat_peptide MF925373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRAPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925385_HBe_P-A Product feature CHAIN MF925385_HBe_P-A of FT:mat_peptide MF925385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MF925400_HBe_P-A Product feature CHAIN MF925400_HBe_P-A of FT:mat_peptide MF925400_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRNRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|MF925407_HBe_P-A Product feature CHAIN MF925407_HBe_P-A of FT:mat_peptide MF925407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464808_HBe_P-A Product feature CHAIN MH464808_HBe_P-A of FT:mat_peptide MH464808_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKKFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTAXRQAILCWGEXMXLAXWVGNNLZDPXSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|MH464810_HBe_P-A Product feature CHAIN MH464810_HBe_P-A of FT:mat_peptide MH464810_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=214 residues).
XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464813_HBe_P-A Product feature CHAIN MH464813_HBe_P-A of FT:mat_peptide MH464813_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464814_HBe_P-A Product feature CHAIN MH464814_HBe_P-A of FT:mat_peptide MH464814_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464815_HBe_P-A Product feature CHAIN MH464815_HBe_P-A of FT:mat_peptide MH464815_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464817_HBe_P-A Product feature CHAIN MH464817_HBe_P-A of FT:mat_peptide MH464817_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA95). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATXELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDLMTLATWVGNNLDDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|MH464818_HBe_P-A Product feature CHAIN MH464818_HBe_P-A of FT:mat_peptide MH464818_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464825_HBe_P-A Product feature CHAIN MH464825_HBe_P-A of FT:mat_peptide MH464825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPPVRDLLGTAAALYREALESSDHCSPH
HTALRQALLCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH464828_HBe_P-A Product feature CHAIN MH464828_HBe_P-A of FT:mat_peptide MH464828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464830_HBe_P-A Product feature CHAIN MH464830_HBe_P-A of FT:mat_peptide MH464830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580627_HBe_P-A Product feature CHAIN MH580627_HBe_P-A of FT:mat_peptide MH580627_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580639_HBe_P-A Product feature CHAIN MH580639_HBe_P-A of FT:mat_peptide MH580639_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580642_HBe_P-A Product feature CHAIN MH580642_HBe_P-A of FT:mat_peptide MH580642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580643_HBe_P-A Product feature CHAIN MH580643_HBe_P-A of FT:mat_peptide MH580643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH932713_HBe_P-A Product feature CHAIN MH932713_HBe_P-A of FT:mat_peptide MH932713_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512455_HBe_P-A Product feature CHAIN MK512455_HBe_P-A of FT:mat_peptide MK512455_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2079). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRELLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRDRGRSPRRRTPSPRRRRSQSPRRKRSQSRESKC
>gnl|hbvpro|MK512456_HBe_P-A Product feature CHAIN MK512456_HBe_P-A of FT:mat_peptide MK512456_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALFREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512457_HBe_P-A Product feature CHAIN MK512457_HBe_P-A of FT:mat_peptide MK512457_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGDVMTLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512458_HBe_P-A Product feature CHAIN MK512458_HBe_P-A of FT:mat_peptide MK512458_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2244). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSSPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDDCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWILTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512459_HBe_P-A Product feature CHAIN MK512459_HBe_P-A of FT:mat_peptide MK512459_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2226). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512460_HBe_P-A Product feature CHAIN MK512460_HBe_P-A of FT:mat_peptide MK512460_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2199). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRKQKSQSPRRKRSQSRESQC
>gnl|hbvpro|MK512461_HBe_P-A Product feature CHAIN MK512461_HBe_P-A of FT:mat_peptide MK512461_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2157). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHH
HTAIRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPANAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512462_HBe_P-A Product feature CHAIN MK512462_HBe_P-A of FT:mat_peptide MK512462_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=214 residues).
KQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512463_HBe_P-A Product feature CHAIN MK512463_HBe_P-A of FT:mat_peptide MK512463_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2086). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRQRSQSPRRRKSQSRESQC
>gnl|hbvpro|MK512464_HBe_P-A Product feature CHAIN MK512464_HBe_P-A of FT:mat_peptide MK512464_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVLRRRDRGRSPRRRTPSPRRRRFQSPRRRRSQSRESQC
>gnl|hbvpro|MK512465_HBe_P-A Product feature CHAIN MK512465_HBe_P-A of FT:mat_peptide MK512465_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREGLESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512466_HBe_P-A Product feature CHAIN MK512466_HBe_P-A of FT:mat_peptide MK512466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKISQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512467_HBe_P-A Product feature CHAIN MK512467_HBe_P-A of FT:mat_peptide MK512467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-220). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELRTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGEWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512468_HBe_P-A Product feature CHAIN MK512468_HBe_P-A of FT:mat_peptide MK512468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-203). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512469_HBe_P-A Product feature CHAIN MK512469_HBe_P-A of FT:mat_peptide MK512469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-136). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512470_HBe_P-A Product feature CHAIN MK512470_HBe_P-A of FT:mat_peptide MK512470_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512471_HBe_P-A Product feature CHAIN MK512471_HBe_P-A of FT:mat_peptide MK512471_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=214 residues).
LQLFHLCLIISCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAGALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512472_HBe_P-A Product feature CHAIN MK512472_HBe_P-A of FT:mat_peptide MK512472_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELTTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512473_HBe_P-A Product feature CHAIN MK512473_HBe_P-A of FT:mat_peptide MK512473_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512474_HBe_P-A Product feature CHAIN MK512474_HBe_P-A of FT:mat_peptide MK512474_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-37). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512475_HBe_P-A Product feature CHAIN MK512475_HBe_P-A of FT:mat_peptide MK512475_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512476_HBe_P-A Product feature CHAIN MK512476_HBe_P-A of FT:mat_peptide MK512476_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|V00866_HBe_P-A Product feature CHAIN V00866_HBe_P-A of FT:mat_peptide V00866_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X02763_HBe_C-A Product feature CHAIN X02763_HBe_C-A of FT:mat_peptide X02763_HBe_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSPSPRRRRSQSRESQC
>gnl|hbvpro|X07911_HBe_P-A Product feature CHAIN X07911_HBe_P-A of FT:mat_peptide X07911_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X51970_HBe_P-A Product feature CHAIN X51970_HBe_P-A of FT:mat_peptide X51970_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X70185_HBe_P-A Product feature CHAIN X70185_HBe_P-A of FT:mat_peptide X70185_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|Z35717_HBe_P-A Product feature CHAIN Z35717_HBe_P-A of FT:mat_peptide Z35717_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|Z72478_HBe_P-A Product feature CHAIN Z72478_HBe_P-A of FT:mat_peptide Z72478_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
© 1998-2019