HBVdb

Dataset for protein HBx of genotype A

[Download (right click)] [Alignment] [Repertoires]

974 sequence(s)

>gnl|hbvpro|AB014370_HBx_P-A Product feature CHAIN AB014370_HBx_P-A of FT:mat_peptide AB014370_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB064314_HBx_P-A Product feature CHAIN AB064314_HBx_P-A of FT:mat_peptide AB064314_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSLCNFFTSA
>gnl|hbvpro|AB076678_HBx_P-A Product feature CHAIN AB076678_HBx_P-A of FT:mat_peptide AB076678_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB076679_HBx_P-A Product feature CHAIN AB076679_HBx_P-A of FT:mat_peptide AB076679_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116076_HBx_P-A Product feature CHAIN AB116076_HBx_P-A of FT:mat_peptide AB116076_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116077_HBx_P-A Product feature CHAIN AB116077_HBx_P-A of FT:mat_peptide AB116077_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116078_HBx_P-A Product feature CHAIN AB116078_HBx_P-A of FT:mat_peptide AB116078_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116079_HBx_P-A Product feature CHAIN AB116079_HBx_P-A of FT:mat_peptide AB116079_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116080_HBx_P-A Product feature CHAIN AB116080_HBx_P-A of FT:mat_peptide AB116080_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116081_HBx_P-A Product feature CHAIN AB116081_HBx_P-A of FT:mat_peptide AB116081_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|AB116082_HBx_P-A Product feature CHAIN AB116082_HBx_P-A of FT:mat_peptide AB116082_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116083_HBx_P-A Product feature CHAIN AB116083_HBx_P-A of FT:mat_peptide AB116083_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDRVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116084_HBx_P-A Product feature CHAIN AB116084_HBx_P-A of FT:mat_peptide AB116084_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNTHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116085_HBx_P-A Product feature CHAIN AB116085_HBx_P-A of FT:mat_peptide AB116085_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116086_HBx_P-A Product feature CHAIN AB116086_HBx_P-A of FT:mat_peptide AB116086_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGSLGTLSSPAPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPYSCNFFTSA
>gnl|hbvpro|AB116087_HBx_P-A Product feature CHAIN AB116087_HBx_P-A of FT:mat_peptide AB116087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116088_HBx_P-A Product feature CHAIN AB116088_HBx_P-A of FT:mat_peptide AB116088_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAPQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AB116089_HBx_P-A Product feature CHAIN AB116089_HBx_P-A of FT:mat_peptide AB116089_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGANLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AB116090_HBx_P-A Product feature CHAIN AB116090_HBx_P-A of FT:mat_peptide AB116090_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116091_HBx_P-A Product feature CHAIN AB116091_HBx_P-A of FT:mat_peptide AB116091_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116092_HBx_P-A Product feature CHAIN AB116092_HBx_P-A of FT:mat_peptide AB116092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116093_HBx_P-A Product feature CHAIN AB116093_HBx_P-A of FT:mat_peptide AB116093_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116094_HBx_P-A Product feature CHAIN AB116094_HBx_P-A of FT:mat_peptide AB116094_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB126580_HBx_P-A Product feature CHAIN AB126580_HBx_P-A of FT:mat_peptide AB126580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB194950_HBx_P-A Product feature CHAIN AB194950_HBx_P-A of FT:mat_peptide AB194950_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB194951_HBx_P-A Product feature CHAIN AB194951_HBx_P-A of FT:mat_peptide AB194951_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB194952_HBx_P-A Product feature CHAIN AB194952_HBx_P-A of FT:mat_peptide AB194952_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|AB205118_HBx_P-A Product feature CHAIN AB205118_HBx_P-A of FT:mat_peptide AB205118_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB222707_HBx_P-A Product feature CHAIN AB222707_HBx_P-A of FT:mat_peptide AB222707_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB241114_HBx_P-A Product feature CHAIN AB241114_HBx_P-A of FT:mat_peptide AB241114_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB241115_HBx_P-A Product feature CHAIN AB241115_HBx_P-A of FT:mat_peptide AB241115_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDTSRDVLCLRPISAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB246317_HBx_P-A Product feature CHAIN AB246317_HBx_P-A of FT:mat_peptide AB246317_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGANLSLRGLPVCAFSSAGPCALRFTSARCVE
TTMNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|AB246335_HBx_P-A Product feature CHAIN AB246335_HBx_P-A of FT:mat_peptide AB246335_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB246336_HBx_P-A Product feature CHAIN AB246336_HBx_P-A of FT:mat_peptide AB246336_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB246337_HBx_P-A Product feature CHAIN AB246337_HBx_P-A of FT:mat_peptide AB246337_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB246338_HBx_P-A Product feature CHAIN AB246338_HBx_P-A of FT:mat_peptide AB246338_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB300366_HBx_P-A Product feature CHAIN AB300366_HBx_P-A of FT:mat_peptide AB300366_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB300367_HBx_P-A Product feature CHAIN AB300367_HBx_P-A of FT:mat_peptide AB300367_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB362931_HBx_P-A Product feature CHAIN AB362931_HBx_P-A of FT:mat_peptide AB362931_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453979_HBx_P-A Product feature CHAIN AB453979_HBx_P-A of FT:mat_peptide AB453979_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453980_HBx_P-A Product feature CHAIN AB453980_HBx_P-A of FT:mat_peptide AB453980_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453981_HBx_P-A Product feature CHAIN AB453981_HBx_P-A of FT:mat_peptide AB453981_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453982_HBx_P-A Product feature CHAIN AB453982_HBx_P-A of FT:mat_peptide AB453982_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453983_HBx_P-A Product feature CHAIN AB453983_HBx_P-A of FT:mat_peptide AB453983_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453984_HBx_P-A Product feature CHAIN AB453984_HBx_P-A of FT:mat_peptide AB453984_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453986_HBx_P-A Product feature CHAIN AB453986_HBx_P-A of FT:mat_peptide AB453986_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB453987_HBx_P-A Product feature CHAIN AB453987_HBx_P-A of FT:mat_peptide AB453987_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|AB453988_HBx_P-A Product feature CHAIN AB453988_HBx_P-A of FT:mat_peptide AB453988_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB453989_HBx_P-A Product feature CHAIN AB453989_HBx_P-A of FT:mat_peptide AB453989_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB480036_HBx_P-A Product feature CHAIN AB480036_HBx_P-A of FT:mat_peptide AB480036_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480038_HBx_P-A Product feature CHAIN AB480038_HBx_P-A of FT:mat_peptide AB480038_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480039_HBx_P-A Product feature CHAIN AB480039_HBx_P-A of FT:mat_peptide AB480039_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480040_HBx_P-A Product feature CHAIN AB480040_HBx_P-A of FT:mat_peptide AB480040_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARXMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480041_HBx_P-A Product feature CHAIN AB480041_HBx_P-A of FT:mat_peptide AB480041_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB549213_HBx_P-A Product feature CHAIN AB549213_HBx_P-A of FT:mat_peptide AB549213_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697487_HBx_P-A Product feature CHAIN AB697487_HBx_P-A of FT:mat_peptide AB697487_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCXFKDWEELGEEIRLKVFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|AB697488_HBx_P-A Product feature CHAIN AB697488_HBx_P-A of FT:mat_peptide AB697488_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697489_HBx_P-A Product feature CHAIN AB697489_HBx_P-A of FT:mat_peptide AB697489_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697491_HBx_P-A Product feature CHAIN AB697491_HBx_P-A of FT:mat_peptide AB697491_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697492_HBx_P-A Product feature CHAIN AB697492_HBx_P-A of FT:mat_peptide AB697492_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697493_HBx_P-A Product feature CHAIN AB697493_HBx_P-A of FT:mat_peptide AB697493_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697495_HBx_P-A Product feature CHAIN AB697495_HBx_P-A of FT:mat_peptide AB697495_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697496_HBx_P-A Product feature CHAIN AB697496_HBx_P-A of FT:mat_peptide AB697496_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697497_HBx_P-A Product feature CHAIN AB697497_HBx_P-A of FT:mat_peptide AB697497_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697498_HBx_P-A Product feature CHAIN AB697498_HBx_P-A of FT:mat_peptide AB697498_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|AB697499_HBx_P-A Product feature CHAIN AB697499_HBx_P-A of FT:mat_peptide AB697499_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697501_HBx_P-A Product feature CHAIN AB697501_HBx_P-A of FT:mat_peptide AB697501_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697503_HBx_P-A Product feature CHAIN AB697503_HBx_P-A of FT:mat_peptide AB697503_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697504_HBx_P-A Product feature CHAIN AB697504_HBx_P-A of FT:mat_peptide AB697504_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697505_HBx_P-A Product feature CHAIN AB697505_HBx_P-A of FT:mat_peptide AB697505_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697506_HBx_P-A Product feature CHAIN AB697506_HBx_P-A of FT:mat_peptide AB697506_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697507_HBx_P-A Product feature CHAIN AB697507_HBx_P-A of FT:mat_peptide AB697507_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697508_HBx_P-A Product feature CHAIN AB697508_HBx_P-A of FT:mat_peptide AB697508_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697509_HBx_P-A Product feature CHAIN AB697509_HBx_P-A of FT:mat_peptide AB697509_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697511_HBx_P-A Product feature CHAIN AB697511_HBx_P-A of FT:mat_peptide AB697511_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697512_HBx_P-A Product feature CHAIN AB697512_HBx_P-A of FT:mat_peptide AB697512_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775198_HBx_P-A Product feature CHAIN AB775198_HBx_P-A of FT:mat_peptide AB775198_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775199_HBx_P-A Product feature CHAIN AB775199_HBx_P-A of FT:mat_peptide AB775199_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775200_HBx_P-A Product feature CHAIN AB775200_HBx_P-A of FT:mat_peptide AB775200_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775201_HBx_P-A Product feature CHAIN AB775201_HBx_P-A of FT:mat_peptide AB775201_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937791_HBx_P-A Product feature CHAIN AB937791_HBx_P-A of FT:mat_peptide AB937791_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB937792_HBx_P-A Product feature CHAIN AB937792_HBx_P-A of FT:mat_peptide AB937792_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937793_HBx_P-A Product feature CHAIN AB937793_HBx_P-A of FT:mat_peptide AB937793_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937794_HBx_P-A Product feature CHAIN AB937794_HBx_P-A of FT:mat_peptide AB937794_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937795_HBx_P-A Product feature CHAIN AB937795_HBx_P-A of FT:mat_peptide AB937795_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKWTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB937796_HBx_P-A Product feature CHAIN AB937796_HBx_P-A of FT:mat_peptide AB937796_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB937797_HBx_P-A Product feature CHAIN AB937797_HBx_P-A of FT:mat_peptide AB937797_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQTLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937798_HBx_P-A Product feature CHAIN AB937798_HBx_P-A of FT:mat_peptide AB937798_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF043560_HBx_P-A Product feature CHAIN AF043560_HBx_P-A of FT:mat_peptide AF043560_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AF043580_HBx_P-A Product feature CHAIN AF043580_HBx_P-A of FT:mat_peptide AF043580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLXGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090838_HBx_P-A Product feature CHAIN AF090838_HBx_P-A of FT:mat_peptide AF090838_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF090839_HBx_P-A Product feature CHAIN AF090839_HBx_P-A of FT:mat_peptide AF090839_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090840_HBx_P-A Product feature CHAIN AF090840_HBx_P-A of FT:mat_peptide AF090840_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090841_HBx_P-A Product feature CHAIN AF090841_HBx_P-A of FT:mat_peptide AF090841_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090842_HBx_P-A Product feature CHAIN AF090842_HBx_P-A of FT:mat_peptide AF090842_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AF143298_HBx_P-A Product feature CHAIN AF143298_HBx_P-A of FT:mat_peptide AF143298_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF143302_HBx_P-A Product feature CHAIN AF143302_HBx_P-A of FT:mat_peptide AF143302_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297621_HBx_P-A Product feature CHAIN AF297621_HBx_P-A of FT:mat_peptide AF297621_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297622_HBx_P-A Product feature CHAIN AF297622_HBx_P-A of FT:mat_peptide AF297622_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297623_HBx_P-A Product feature CHAIN AF297623_HBx_P-A of FT:mat_peptide AF297623_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297624_HBx_P-A Product feature CHAIN AF297624_HBx_P-A of FT:mat_peptide AF297624_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297625_HBx_P-A Product feature CHAIN AF297625_HBx_P-A of FT:mat_peptide AF297625_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVFAPSSCNFFTSA
>gnl|hbvpro|AF536524_HBx_P-A Product feature CHAIN AF536524_HBx_P-A of FT:mat_peptide AF536524_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF537371_HBx_P-A Product feature CHAIN AF537371_HBx_P-A of FT:mat_peptide AF537371_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF537372_HBx_P-A Product feature CHAIN AF537372_HBx_P-A of FT:mat_peptide AF537372_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ012207_HBx_P-A Product feature CHAIN AJ012207_HBx_P-A of FT:mat_peptide AJ012207_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ309369_HBx_P-A Product feature CHAIN AJ309369_HBx_P-A of FT:mat_peptide AJ309369_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSAK
>gnl|hbvpro|AJ309370_HBx_P-A Product feature CHAIN AJ309370_HBx_P-A of FT:mat_peptide AJ309370_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ309371_HBx_P-A Product feature CHAIN AJ309371_HBx_P-A of FT:mat_peptide AJ309371_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MTARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ344115_HBx_P-A Product feature CHAIN AJ344115_HBx_P-A of FT:mat_peptide AJ344115_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLFCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627226_HBx_P-A Product feature CHAIN AJ627226_HBx_P-A of FT:mat_peptide AJ627226_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTIGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627227_HBx_P-A Product feature CHAIN AJ627227_HBx_P-A of FT:mat_peptide AJ627227_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVXAESRGRPLSGPLGALSSPSPSAVPAVHGANLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627228_HBx_P-A Product feature CHAIN AJ627228_HBx_P-A of FT:mat_peptide AJ627228_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM180624_HBx_P-A Product feature CHAIN AM180624_HBx_P-A of FT:mat_peptide AM180624_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGXLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AM184125_HBx_P-A Product feature CHAIN AM184125_HBx_P-A of FT:mat_peptide AM184125_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AM184126_HBx_P-A Product feature CHAIN AM184126_HBx_P-A of FT:mat_peptide AM184126_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AM282986_HBx_P-A Product feature CHAIN AM282986_HBx_P-A of FT:mat_peptide AM282986_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295795_HBx_P-A Product feature CHAIN AM295795_HBx_P-A of FT:mat_peptide AM295795_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295796_HBx_P-A Product feature CHAIN AM295796_HBx_P-A of FT:mat_peptide AM295796_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295797_HBx_P-A Product feature CHAIN AM295797_HBx_P-A of FT:mat_peptide AM295797_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295798_HBx_P-A Product feature CHAIN AM295798_HBx_P-A of FT:mat_peptide AM295798_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295799_HBx_P-A Product feature CHAIN AM295799_HBx_P-A of FT:mat_peptide AM295799_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM410963_HBx_P-A Product feature CHAIN AM410963_HBx_P-A of FT:mat_peptide AM410963_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM494718_HBx_P-A Product feature CHAIN AM494718_HBx_P-A of FT:mat_peptide AM494718_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY034878_HBx_P-A Product feature CHAIN AY034878_HBx_P-A of FT:mat_peptide AY034878_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTFARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY128092_HBx_P-A Product feature CHAIN AY128092_HBx_P-A of FT:mat_peptide AY128092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY152726_HBx_P-A Product feature CHAIN AY152726_HBx_P-A of FT:mat_peptide AY152726_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPVMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161138_HBx_P-A Product feature CHAIN AY161138_HBx_P-A of FT:mat_peptide AY161138_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161139_HBx_P-A Product feature CHAIN AY161139_HBx_P-A of FT:mat_peptide AY161139_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161142_HBx_P-A Product feature CHAIN AY161142_HBx_P-A of FT:mat_peptide AY161142_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSARCME
TTVNSHQVLPKVLYKWTLGLSAMSTTDLKAYLKDCVFKDREELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY161143_HBx_P-A Product feature CHAIN AY161143_HBx_P-A of FT:mat_peptide AY161143_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSARCME
TTVNSHQVLPKVLYKWTLGLSAMSTTDLKAYLKDCVFKDREELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY161144_HBx_P-A Product feature CHAIN AY161144_HBx_P-A of FT:mat_peptide AY161144_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSARCME
TTVNSHQVLPKVLYKWTLGLSAMSTTDLKAYLKDCVFKDREELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233274_HBx_P-A Product feature CHAIN AY233274_HBx_P-A of FT:mat_peptide AY233274_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233275_HBx_P-A Product feature CHAIN AY233275_HBx_P-A of FT:mat_peptide AY233275_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AY233276_HBx_P-A Product feature CHAIN AY233276_HBx_P-A of FT:mat_peptide AY233276_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAQQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233278_HBx_P-A Product feature CHAIN AY233278_HBx_P-A of FT:mat_peptide AY233278_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLRLRPVGAESRGRPLARSLGTLSSPTPSAVPSDHGAHLSLRGLPVCAFTSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233279_HBx_P-A Product feature CHAIN AY233279_HBx_P-A of FT:mat_peptide AY233279_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRPKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233280_HBx_P-A Product feature CHAIN AY233280_HBx_P-A of FT:mat_peptide AY233280_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKAFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233281_HBx_P-A Product feature CHAIN AY233281_HBx_P-A of FT:mat_peptide AY233281_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQIPPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLRIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AY233282_HBx_P-A Product feature CHAIN AY233282_HBx_P-A of FT:mat_peptide AY233282_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTADLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233283_HBx_P-A Product feature CHAIN AY233283_HBx_P-A of FT:mat_peptide AY233283_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233284_HBx_P-A Product feature CHAIN AY233284_HBx_P-A of FT:mat_peptide AY233284_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233285_HBx_P-A Product feature CHAIN AY233285_HBx_P-A of FT:mat_peptide AY233285_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233286_HBx_P-A Product feature CHAIN AY233286_HBx_P-A of FT:mat_peptide AY233286_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVSAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233287_HBx_P-A Product feature CHAIN AY233287_HBx_P-A of FT:mat_peptide AY233287_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233288_HBx_P-A Product feature CHAIN AY233288_HBx_P-A of FT:mat_peptide AY233288_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TIVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233289_HBx_P-A Product feature CHAIN AY233289_HBx_P-A of FT:mat_peptide AY233289_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233290_HBx_P-A Product feature CHAIN AY233290_HBx_P-A of FT:mat_peptide AY233290_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGDLSSPSPSAVPSDHGANLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTFGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|AY373428_HBx_P-A Product feature CHAIN AY373428_HBx_P-A of FT:mat_peptide AY373428_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY373429_HBx_P-A Product feature CHAIN AY373429_HBx_P-A of FT:mat_peptide AY373429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY373432_HBx_P-A Product feature CHAIN AY373432_HBx_P-A of FT:mat_peptide AY373432_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY707087_HBx_P-A Product feature CHAIN AY707087_HBx_P-A of FT:mat_peptide AY707087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY738139_HBx_P-A Product feature CHAIN AY738139_HBx_P-A of FT:mat_peptide AY738139_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738140_HBx_P-A Product feature CHAIN AY738140_HBx_P-A of FT:mat_peptide AY738140_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738141_HBx_P-A Product feature CHAIN AY738141_HBx_P-A of FT:mat_peptide AY738141_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738142_HBx_P-A Product feature CHAIN AY738142_HBx_P-A of FT:mat_peptide AY738142_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTPGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738143_HBx_P-A Product feature CHAIN AY738143_HBx_P-A of FT:mat_peptide AY738143_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY862867_HBx_P-A Product feature CHAIN AY862867_HBx_P-A of FT:mat_peptide AY862867_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY862868_HBx_P-A Product feature CHAIN AY862868_HBx_P-A of FT:mat_peptide AY862868_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGVESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY902775_HBx_P-A Product feature CHAIN AY902775_HBx_P-A of FT:mat_peptide AY902775_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY903452_HBx_P-A Product feature CHAIN AY903452_HBx_P-A of FT:mat_peptide AY903452_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|AY934763_HBx_P-A Product feature CHAIN AY934763_HBx_P-A of FT:mat_peptide AY934763_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDDGANLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934764_HBx_P-A Product feature CHAIN AY934764_HBx_P-A of FT:mat_peptide AY934764_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934765_HBx_P-A Product feature CHAIN AY934765_HBx_P-A of FT:mat_peptide AY934765_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVCVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934766_HBx_P-A Product feature CHAIN AY934766_HBx_P-A of FT:mat_peptide AY934766_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934767_HBx_P-A Product feature CHAIN AY934767_HBx_P-A of FT:mat_peptide AY934767_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934768_HBx_P-A Product feature CHAIN AY934768_HBx_P-A of FT:mat_peptide AY934768_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934769_HBx_P-A Product feature CHAIN AY934769_HBx_P-A of FT:mat_peptide AY934769_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRRRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY934770_HBx_P-A Product feature CHAIN AY934770_HBx_P-A of FT:mat_peptide AY934770_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVCVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934771_HBx_P-A Product feature CHAIN AY934771_HBx_P-A of FT:mat_peptide AY934771_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934772_HBx_P-A Product feature CHAIN AY934772_HBx_P-A of FT:mat_peptide AY934772_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGSLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVYKDWEVLGEEIRLMICVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY934773_HBx_P-A Product feature CHAIN AY934773_HBx_P-A of FT:mat_peptide AY934773_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934774_HBx_P-A Product feature CHAIN AY934774_HBx_P-A of FT:mat_peptide AY934774_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ020002_HBx_P-A Product feature CHAIN DQ020002_HBx_P-A of FT:mat_peptide DQ020002_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
ATVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMICVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ020003_HBx_P-A Product feature CHAIN DQ020003_HBx_P-A of FT:mat_peptide DQ020003_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ298161_HBx_P-A Product feature CHAIN DQ298161_HBx_P-A of FT:mat_peptide DQ298161_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADRGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298162_HBx_P-A Product feature CHAIN DQ298162_HBx_P-A of FT:mat_peptide DQ298162_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCARRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLRGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298163_HBx_P-A Product feature CHAIN DQ298163_HBx_P-A of FT:mat_peptide DQ298163_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298164_HBx_P-A Product feature CHAIN DQ298164_HBx_P-A of FT:mat_peptide DQ298164_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298165_HBx_P-A Product feature CHAIN DQ298165_HBx_P-A of FT:mat_peptide DQ298165_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ315784_HBx_P-A Product feature CHAIN DQ315784_HBx_P-A of FT:mat_peptide DQ315784_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ315785_HBx_P-A Product feature CHAIN DQ315785_HBx_P-A of FT:mat_peptide DQ315785_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI0386). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ315786_HBx_P-A Product feature CHAIN DQ315786_HBx_P-A of FT:mat_peptide DQ315786_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTTRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ788725_HBx_P-A Product feature CHAIN DQ788725_HBx_P-A of FT:mat_peptide DQ788725_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ788728_HBx_P-A Product feature CHAIN DQ788728_HBx_P-A of FT:mat_peptide DQ788728_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 05/96). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMILVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103278_HBx_P-A Product feature CHAIN EF103278_HBx_P-A of FT:mat_peptide EF103278_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLSLRPVGAESRGRPLARPLGAVSSPSPSAVPSDLGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF208113_HBx_P-A Product feature CHAIN EF208113_HBx_P-A of FT:mat_peptide EF208113_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQIPPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU054331_HBx_C-A Product feature CHAIN EU054331_HBx_C-A of FT:mat_peptide EU054331_HBx_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPFGHFSSPSLSNIPNDHGAHLSFHCLPVCAFSSDGPCALRFTSARCMA
TTVNDHQMLRKLLHKRAVGLPAISTADLEAYFKDCVFKDWEELGEEIRLKVFVLRGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EU086721_HBx_P-A Product feature CHAIN EU086721_HBx_P-A of FT:mat_peptide EU086721_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185786_HBx_P-A Product feature CHAIN EU185786_HBx_P-A of FT:mat_peptide EU185786_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185787_HBx_P-A Product feature CHAIN EU185787_HBx_P-A of FT:mat_peptide EU185787_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185788_HBx_P-A Product feature CHAIN EU185788_HBx_P-A of FT:mat_peptide EU185788_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU19). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185789_HBx_P-A Product feature CHAIN EU185789_HBx_P-A of FT:mat_peptide EU185789_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU366129_HBx_P-A Product feature CHAIN EU366129_HBx_P-A of FT:mat_peptide EU366129_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EU414133_HBx_P-A Product feature CHAIN EU414133_HBx_P-A of FT:mat_peptide EU414133_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLQKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594383_HBx_P-A Product feature CHAIN EU594383_HBx_P-A of FT:mat_peptide EU594383_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594384_HBx_P-A Product feature CHAIN EU594384_HBx_P-A of FT:mat_peptide EU594384_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594385_HBx_P-A Product feature CHAIN EU594385_HBx_P-A of FT:mat_peptide EU594385_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594386_HBx_P-A Product feature CHAIN EU594386_HBx_P-A of FT:mat_peptide EU594386_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594387_HBx_P-A Product feature CHAIN EU594387_HBx_P-A of FT:mat_peptide EU594387_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594388_HBx_P-A Product feature CHAIN EU594388_HBx_P-A of FT:mat_peptide EU594388_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594389_HBx_P-A Product feature CHAIN EU594389_HBx_P-A of FT:mat_peptide EU594389_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594390_HBx_P-A Product feature CHAIN EU594390_HBx_P-A of FT:mat_peptide EU594390_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594391_HBx_P-A Product feature CHAIN EU594391_HBx_P-A of FT:mat_peptide EU594391_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594392_HBx_P-A Product feature CHAIN EU594392_HBx_P-A of FT:mat_peptide EU594392_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594393_HBx_P-A Product feature CHAIN EU594393_HBx_P-A of FT:mat_peptide EU594393_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594394_HBx_P-A Product feature CHAIN EU594394_HBx_P-A of FT:mat_peptide EU594394_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594395_HBx_P-A Product feature CHAIN EU594395_HBx_P-A of FT:mat_peptide EU594395_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU747320_HBx_P-A Product feature CHAIN EU747320_HBx_P-A of FT:mat_peptide EU747320_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V51). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
NTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859898_HBx_P-A Product feature CHAIN EU859898_HBx_P-A of FT:mat_peptide EU859898_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859899_HBx_P-A Product feature CHAIN EU859899_HBx_P-A of FT:mat_peptide EU859899_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859900_HBx_P-A Product feature CHAIN EU859900_HBx_P-A of FT:mat_peptide EU859900_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKKTLGLPAMSTTDLEAYFKDCVFKHWEELGEENRLKVFVLGGCKHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859901_HBx_P-A Product feature CHAIN EU859901_HBx_P-A of FT:mat_peptide EU859901_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVWPPAPCNFFTSA
>gnl|hbvpro|EU859902_HBx_P-A Product feature CHAIN EU859902_HBx_P-A of FT:mat_peptide EU859902_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859903_HBx_P-A Product feature CHAIN EU859903_HBx_P-A of FT:mat_peptide EU859903_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|EU859904_HBx_P-A Product feature CHAIN EU859904_HBx_P-A of FT:mat_peptide EU859904_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859905_HBx_P-A Product feature CHAIN EU859905_HBx_P-A of FT:mat_peptide EU859905_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859906_HBx_P-A Product feature CHAIN EU859906_HBx_P-A of FT:mat_peptide EU859906_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCSHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859907_HBx_P-A Product feature CHAIN EU859907_HBx_P-A of FT:mat_peptide EU859907_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859908_HBx_P-A Product feature CHAIN EU859908_HBx_P-A of FT:mat_peptide EU859908_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859909_HBx_P-A Product feature CHAIN EU859909_HBx_P-A of FT:mat_peptide EU859909_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859910_HBx_P-A Product feature CHAIN EU859910_HBx_P-A of FT:mat_peptide EU859910_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859911_HBx_P-A Product feature CHAIN EU859911_HBx_P-A of FT:mat_peptide EU859911_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859912_HBx_P-A Product feature CHAIN EU859912_HBx_P-A of FT:mat_peptide EU859912_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859913_HBx_P-A Product feature CHAIN EU859913_HBx_P-A of FT:mat_peptide EU859913_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859914_HBx_P-A Product feature CHAIN EU859914_HBx_P-A of FT:mat_peptide EU859914_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859915_HBx_P-A Product feature CHAIN EU859915_HBx_P-A of FT:mat_peptide EU859915_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859916_HBx_P-A Product feature CHAIN EU859916_HBx_P-A of FT:mat_peptide EU859916_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859917_HBx_P-A Product feature CHAIN EU859917_HBx_P-A of FT:mat_peptide EU859917_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAKSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859918_HBx_P-A Product feature CHAIN EU859918_HBx_P-A of FT:mat_peptide EU859918_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859919_HBx_P-A Product feature CHAIN EU859919_HBx_P-A of FT:mat_peptide EU859919_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859920_HBx_P-A Product feature CHAIN EU859920_HBx_P-A of FT:mat_peptide EU859920_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859921_HBx_P-A Product feature CHAIN EU859921_HBx_P-A of FT:mat_peptide EU859921_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859922_HBx_P-A Product feature CHAIN EU859922_HBx_P-A of FT:mat_peptide EU859922_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859923_HBx_P-A Product feature CHAIN EU859923_HBx_P-A of FT:mat_peptide EU859923_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859924_HBx_P-A Product feature CHAIN EU859924_HBx_P-A of FT:mat_peptide EU859924_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859925_HBx_P-A Product feature CHAIN EU859925_HBx_P-A of FT:mat_peptide EU859925_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859926_HBx_P-A Product feature CHAIN EU859926_HBx_P-A of FT:mat_peptide EU859926_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859927_HBx_P-A Product feature CHAIN EU859927_HBx_P-A of FT:mat_peptide EU859927_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGFPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859928_HBx_P-A Product feature CHAIN EU859928_HBx_P-A of FT:mat_peptide EU859928_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859929_HBx_P-A Product feature CHAIN EU859929_HBx_P-A of FT:mat_peptide EU859929_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859930_HBx_P-A Product feature CHAIN EU859930_HBx_P-A of FT:mat_peptide EU859930_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=156 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859931_HBx_P-A Product feature CHAIN EU859931_HBx_P-A of FT:mat_peptide EU859931_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859932_HBx_P-A Product feature CHAIN EU859932_HBx_P-A of FT:mat_peptide EU859932_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859933_HBx_P-A Product feature CHAIN EU859933_HBx_P-A of FT:mat_peptide EU859933_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859934_HBx_P-A Product feature CHAIN EU859934_HBx_P-A of FT:mat_peptide EU859934_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859935_HBx_P-A Product feature CHAIN EU859935_HBx_P-A of FT:mat_peptide EU859935_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859936_HBx_P-A Product feature CHAIN EU859936_HBx_P-A of FT:mat_peptide EU859936_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859937_HBx_P-A Product feature CHAIN EU859937_HBx_P-A of FT:mat_peptide EU859937_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859938_HBx_P-A Product feature CHAIN EU859938_HBx_P-A of FT:mat_peptide EU859938_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859939_HBx_P-A Product feature CHAIN EU859939_HBx_P-A of FT:mat_peptide EU859939_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859940_HBx_P-A Product feature CHAIN EU859940_HBx_P-A of FT:mat_peptide EU859940_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859941_HBx_P-A Product feature CHAIN EU859941_HBx_P-A of FT:mat_peptide EU859941_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEKIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859942_HBx_P-A Product feature CHAIN EU859942_HBx_P-A of FT:mat_peptide EU859942_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859943_HBx_P-A Product feature CHAIN EU859943_HBx_P-A of FT:mat_peptide EU859943_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859944_HBx_P-A Product feature CHAIN EU859944_HBx_P-A of FT:mat_peptide EU859944_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859945_HBx_P-A Product feature CHAIN EU859945_HBx_P-A of FT:mat_peptide EU859945_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859946_HBx_P-A Product feature CHAIN EU859946_HBx_P-A of FT:mat_peptide EU859946_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859947_HBx_P-A Product feature CHAIN EU859947_HBx_P-A of FT:mat_peptide EU859947_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859948_HBx_P-A Product feature CHAIN EU859948_HBx_P-A of FT:mat_peptide EU859948_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859949_HBx_P-A Product feature CHAIN EU859949_HBx_P-A of FT:mat_peptide EU859949_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLRGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859950_HBx_P-A Product feature CHAIN EU859950_HBx_P-A of FT:mat_peptide EU859950_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859951_HBx_P-A Product feature CHAIN EU859951_HBx_P-A of FT:mat_peptide EU859951_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859952_HBx_P-A Product feature CHAIN EU859952_HBx_P-A of FT:mat_peptide EU859952_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859953_HBx_P-A Product feature CHAIN EU859953_HBx_P-A of FT:mat_peptide EU859953_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859954_HBx_P-A Product feature CHAIN EU859954_HBx_P-A of FT:mat_peptide EU859954_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859955_HBx_P-A Product feature CHAIN EU859955_HBx_P-A of FT:mat_peptide EU859955_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859956_HBx_P-A Product feature CHAIN EU859956_HBx_P-A of FT:mat_peptide EU859956_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349222_HBx_P-A Product feature CHAIN FJ349222_HBx_P-A of FT:mat_peptide FJ349222_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349224_HBx_P-A Product feature CHAIN FJ349224_HBx_P-A of FT:mat_peptide FJ349224_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ692554_HBx_P-A Product feature CHAIN FJ692554_HBx_P-A of FT:mat_peptide FJ692554_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAYQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692555_HBx_P-A Product feature CHAIN FJ692555_HBx_P-A of FT:mat_peptide FJ692555_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24074). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|FJ692557_HBx_P-A Product feature CHAIN FJ692557_HBx_P-A of FT:mat_peptide FJ692557_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692558_HBx_P-A Product feature CHAIN FJ692558_HBx_P-A of FT:mat_peptide FJ692558_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPTSCNFFTSA
>gnl|hbvpro|FJ692559_HBx_P-A Product feature CHAIN FJ692559_HBx_P-A of FT:mat_peptide FJ692559_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692561_HBx_P-A Product feature CHAIN FJ692561_HBx_P-A of FT:mat_peptide FJ692561_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692562_HBx_P-A Product feature CHAIN FJ692562_HBx_P-A of FT:mat_peptide FJ692562_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDNGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692563_HBx_P-A Product feature CHAIN FJ692563_HBx_P-A of FT:mat_peptide FJ692563_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLRLPAMSTTDLEAYFKDCVFKDWEELGKEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692564_HBx_P-A Product feature CHAIN FJ692564_HBx_P-A of FT:mat_peptide FJ692564_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692565_HBx_P-A Product feature CHAIN FJ692565_HBx_P-A of FT:mat_peptide FJ692565_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692566_HBx_P-A Product feature CHAIN FJ692566_HBx_P-A of FT:mat_peptide FJ692566_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692567_HBx_P-A Product feature CHAIN FJ692567_HBx_P-A of FT:mat_peptide FJ692567_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692570_HBx_P-A Product feature CHAIN FJ692570_HBx_P-A of FT:mat_peptide FJ692570_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFEGSLGTLSSPSPSAVPSDYGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692571_HBx_P-A Product feature CHAIN FJ692571_HBx_P-A of FT:mat_peptide FJ692571_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|FJ692572_HBx_P-A Product feature CHAIN FJ692572_HBx_P-A of FT:mat_peptide FJ692572_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50013). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFTGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692573_HBx_P-A Product feature CHAIN FJ692573_HBx_P-A of FT:mat_peptide FJ692573_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50014). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692574_HBx_P-A Product feature CHAIN FJ692574_HBx_P-A of FT:mat_peptide FJ692574_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692575_HBx_P-A Product feature CHAIN FJ692575_HBx_P-A of FT:mat_peptide FJ692575_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692576_HBx_P-A Product feature CHAIN FJ692576_HBx_P-A of FT:mat_peptide FJ692576_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692577_HBx_P-A Product feature CHAIN FJ692577_HBx_P-A of FT:mat_peptide FJ692577_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNTHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692578_HBx_P-A Product feature CHAIN FJ692578_HBx_P-A of FT:mat_peptide FJ692578_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692579_HBx_P-A Product feature CHAIN FJ692579_HBx_P-A of FT:mat_peptide FJ692579_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692580_HBx_P-A Product feature CHAIN FJ692580_HBx_P-A of FT:mat_peptide FJ692580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692581_HBx_P-A Product feature CHAIN FJ692581_HBx_P-A of FT:mat_peptide FJ692581_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692582_HBx_P-A Product feature CHAIN FJ692582_HBx_P-A of FT:mat_peptide FJ692582_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692583_HBx_P-A Product feature CHAIN FJ692583_HBx_P-A of FT:mat_peptide FJ692583_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692584_HBx_P-A Product feature CHAIN FJ692584_HBx_P-A of FT:mat_peptide FJ692584_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692585_HBx_P-A Product feature CHAIN FJ692585_HBx_P-A of FT:mat_peptide FJ692585_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692586_HBx_P-A Product feature CHAIN FJ692586_HBx_P-A of FT:mat_peptide FJ692586_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692587_HBx_P-A Product feature CHAIN FJ692587_HBx_P-A of FT:mat_peptide FJ692587_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSTSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPFPCNFFTSA
>gnl|hbvpro|FJ692588_HBx_P-A Product feature CHAIN FJ692588_HBx_P-A of FT:mat_peptide FJ692588_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692590_HBx_P-A Product feature CHAIN FJ692590_HBx_P-A of FT:mat_peptide FJ692590_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TAVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692591_HBx_P-A Product feature CHAIN FJ692591_HBx_P-A of FT:mat_peptide FJ692591_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TAVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692592_HBx_P-A Product feature CHAIN FJ692592_HBx_P-A of FT:mat_peptide FJ692592_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692593_HBx_P-A Product feature CHAIN FJ692593_HBx_P-A of FT:mat_peptide FJ692593_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692595_HBx_P-A Product feature CHAIN FJ692595_HBx_P-A of FT:mat_peptide FJ692595_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692596_HBx_P-A Product feature CHAIN FJ692596_HBx_P-A of FT:mat_peptide FJ692596_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692597_HBx_P-A Product feature CHAIN FJ692597_HBx_P-A of FT:mat_peptide FJ692597_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTXA
>gnl|hbvpro|FJ692598_HBx_P-A Product feature CHAIN FJ692598_HBx_P-A of FT:mat_peptide FJ692598_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692599_HBx_P-A Product feature CHAIN FJ692599_HBx_P-A of FT:mat_peptide FJ692599_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692600_HBx_P-A Product feature CHAIN FJ692600_HBx_P-A of FT:mat_peptide FJ692600_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692601_HBx_P-A Product feature CHAIN FJ692601_HBx_P-A of FT:mat_peptide FJ692601_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692602_HBx_P-A Product feature CHAIN FJ692602_HBx_P-A of FT:mat_peptide FJ692602_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSRNFFTSA
>gnl|hbvpro|FJ692603_HBx_P-A Product feature CHAIN FJ692603_HBx_P-A of FT:mat_peptide FJ692603_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPPAVPAXHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692604_HBx_P-A Product feature CHAIN FJ692604_HBx_P-A of FT:mat_peptide FJ692604_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692605_HBx_P-A Product feature CHAIN FJ692605_HBx_P-A of FT:mat_peptide FJ692605_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPECAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692606_HBx_P-A Product feature CHAIN FJ692606_HBx_P-A of FT:mat_peptide FJ692606_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692607_HBx_P-A Product feature CHAIN FJ692607_HBx_P-A of FT:mat_peptide FJ692607_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692608_HBx_P-A Product feature CHAIN FJ692608_HBx_P-A of FT:mat_peptide FJ692608_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHWILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692609_HBx_P-A Product feature CHAIN FJ692609_HBx_P-A of FT:mat_peptide FJ692609_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|FJ692610_HBx_P-A Product feature CHAIN FJ692610_HBx_P-A of FT:mat_peptide FJ692610_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAXRLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXSCNFFTSA
>gnl|hbvpro|FJ692611_HBx_P-A Product feature CHAIN FJ692611_HBx_P-A of FT:mat_peptide FJ692611_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692612_HBx_P-A Product feature CHAIN FJ692612_HBx_P-A of FT:mat_peptide FJ692612_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692613_HBx_P-A Product feature CHAIN FJ692613_HBx_P-A of FT:mat_peptide FJ692613_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ904411_HBx_P-A Product feature CHAIN FJ904411_HBx_P-A of FT:mat_peptide FJ904411_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A55). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPSMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904434_HBx_P-A Product feature CHAIN FJ904434_HBx_P-A of FT:mat_peptide FJ904434_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FM199974_HBx_P-A Product feature CHAIN FM199974_HBx_P-A of FT:mat_peptide FM199974_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLXSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199975_HBx_P-A Product feature CHAIN FM199975_HBx_P-A of FT:mat_peptide FM199975_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199976_HBx_P-A Product feature CHAIN FM199976_HBx_P-A of FT:mat_peptide FM199976_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199977_HBx_P-A Product feature CHAIN FM199977_HBx_P-A of FT:mat_peptide FM199977_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCAPSFCNFFTSA
>gnl|hbvpro|FM199979_HBx_P-A Product feature CHAIN FM199979_HBx_P-A of FT:mat_peptide FM199979_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199980_HBx_P-A Product feature CHAIN FM199980_HBx_P-A of FT:mat_peptide FM199980_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199981_HBx_P-A Product feature CHAIN FM199981_HBx_P-A of FT:mat_peptide FM199981_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSX
>gnl|hbvpro|FN545825_HBx_P-A Product feature CHAIN FN545825_HBx_P-A of FT:mat_peptide FN545825_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGSVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPTSCNFFTSA
>gnl|hbvpro|FN545826_HBx_P-A Product feature CHAIN FN545826_HBx_P-A of FT:mat_peptide FN545826_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLYKRTLGLPAMSMTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545828_HBx_P-A Product feature CHAIN FN545828_HBx_P-A of FT:mat_peptide FN545828_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|FN545829_HBx_P-A Product feature CHAIN FN545829_HBx_P-A of FT:mat_peptide FN545829_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFTSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545830_HBx_P-A Product feature CHAIN FN545830_HBx_P-A of FT:mat_peptide FN545830_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545831_HBx_P-A Product feature CHAIN FN545831_HBx_P-A of FT:mat_peptide FN545831_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVDAESRGRPLSGPLGALSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|FN545832_HBx_P-A Product feature CHAIN FN545832_HBx_P-A of FT:mat_peptide FN545832_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545833_HBx_P-A Product feature CHAIN FN545833_HBx_P-A of FT:mat_peptide FN545833_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545834_HBx_P-A Product feature CHAIN FN545834_HBx_P-A of FT:mat_peptide FN545834_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXXVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545835_HBx_P-A Product feature CHAIN FN545835_HBx_P-A of FT:mat_peptide FN545835_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|FN545836_HBx_P-A Product feature CHAIN FN545836_HBx_P-A of FT:mat_peptide FN545836_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|FN545837_HBx_P-A Product feature CHAIN FN545837_HBx_P-A of FT:mat_peptide FN545837_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|FN545838_HBx_P-A Product feature CHAIN FN545838_HBx_P-A of FT:mat_peptide FN545838_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545839_HBx_P-A Product feature CHAIN FN545839_HBx_P-A of FT:mat_peptide FN545839_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545840_HBx_P-A Product feature CHAIN FN545840_HBx_P-A of FT:mat_peptide FN545840_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GQ161813_HBx_P-A Product feature CHAIN GQ161813_HBx_P-A of FT:mat_peptide GQ161813_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GQ184323_HBx_P-A Product feature CHAIN GQ184323_HBx_P-A of FT:mat_peptide GQ184323_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYSQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ184324_HBx_P-A Product feature CHAIN GQ184324_HBx_P-A of FT:mat_peptide GQ184324_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ331046_HBx_P-A Product feature CHAIN GQ331046_HBx_P-A of FT:mat_peptide GQ331046_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ331047_HBx_P-A Product feature CHAIN GQ331047_HBx_P-A of FT:mat_peptide GQ331047_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ414522_HBx_P-A Product feature CHAIN GQ414522_HBx_P-A of FT:mat_peptide GQ414522_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477461_HBx_P-A Product feature CHAIN GQ477461_HBx_P-A of FT:mat_peptide GQ477461_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477462_HBx_P-A Product feature CHAIN GQ477462_HBx_P-A of FT:mat_peptide GQ477462_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477463_HBx_P-A Product feature CHAIN GQ477463_HBx_P-A of FT:mat_peptide GQ477463_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GQ477464_HBx_P-A Product feature CHAIN GQ477464_HBx_P-A of FT:mat_peptide GQ477464_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477465_HBx_P-A Product feature CHAIN GQ477465_HBx_P-A of FT:mat_peptide GQ477465_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477466_HBx_P-A Product feature CHAIN GQ477466_HBx_P-A of FT:mat_peptide GQ477466_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477467_HBx_P-A Product feature CHAIN GQ477467_HBx_P-A of FT:mat_peptide GQ477467_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477468_HBx_P-A Product feature CHAIN GQ477468_HBx_P-A of FT:mat_peptide GQ477468_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477469_HBx_P-A Product feature CHAIN GQ477469_HBx_P-A of FT:mat_peptide GQ477469_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHRILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477470_HBx_P-A Product feature CHAIN GQ477470_HBx_P-A of FT:mat_peptide GQ477470_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477472_HBx_P-A Product feature CHAIN GQ477472_HBx_P-A of FT:mat_peptide GQ477472_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477473_HBx_P-A Product feature CHAIN GQ477473_HBx_P-A of FT:mat_peptide GQ477473_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477474_HBx_P-A Product feature CHAIN GQ477474_HBx_P-A of FT:mat_peptide GQ477474_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477475_HBx_P-A Product feature CHAIN GQ477475_HBx_P-A of FT:mat_peptide GQ477475_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRAVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477476_HBx_P-A Product feature CHAIN GQ477476_HBx_P-A of FT:mat_peptide GQ477476_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477477_HBx_P-A Product feature CHAIN GQ477477_HBx_P-A of FT:mat_peptide GQ477477_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477478_HBx_P-A Product feature CHAIN GQ477478_HBx_P-A of FT:mat_peptide GQ477478_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477479_HBx_P-A Product feature CHAIN GQ477479_HBx_P-A of FT:mat_peptide GQ477479_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESSGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477480_HBx_P-A Product feature CHAIN GQ477480_HBx_P-A of FT:mat_peptide GQ477480_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477482_HBx_P-A Product feature CHAIN GQ477482_HBx_P-A of FT:mat_peptide GQ477482_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477484_HBx_P-A Product feature CHAIN GQ477484_HBx_P-A of FT:mat_peptide GQ477484_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477486_HBx_P-A Product feature CHAIN GQ477486_HBx_P-A of FT:mat_peptide GQ477486_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSPTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GQ477487_HBx_P-A Product feature CHAIN GQ477487_HBx_P-A of FT:mat_peptide GQ477487_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVFCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|GQ477488_HBx_P-A Product feature CHAIN GQ477488_HBx_P-A of FT:mat_peptide GQ477488_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|GQ477490_HBx_P-A Product feature CHAIN GQ477490_HBx_P-A of FT:mat_peptide GQ477490_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477491_HBx_P-A Product feature CHAIN GQ477491_HBx_P-A of FT:mat_peptide GQ477491_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|GQ477493_HBx_P-A Product feature CHAIN GQ477493_HBx_P-A of FT:mat_peptide GQ477493_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477494_HBx_P-A Product feature CHAIN GQ477494_HBx_P-A of FT:mat_peptide GQ477494_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAKLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477495_HBx_P-A Product feature CHAIN GQ477495_HBx_P-A of FT:mat_peptide GQ477495_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477496_HBx_P-A Product feature CHAIN GQ477496_HBx_P-A of FT:mat_peptide GQ477496_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477497_HBx_P-A Product feature CHAIN GQ477497_HBx_P-A of FT:mat_peptide GQ477497_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477499_HBx_P-A Product feature CHAIN GQ477499_HBx_P-A of FT:mat_peptide GQ477499_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P105). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477500_HBx_P-A Product feature CHAIN GQ477500_HBx_P-A of FT:mat_peptide GQ477500_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTFSSPSPSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPYNFFTSA
>gnl|hbvpro|GQ477501_HBx_P-A Product feature CHAIN GQ477501_HBx_P-A of FT:mat_peptide GQ477501_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477502_HBx_P-A Product feature CHAIN GQ477502_HBx_P-A of FT:mat_peptide GQ477502_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477503_HBx_P-A Product feature CHAIN GQ477503_HBx_P-A of FT:mat_peptide GQ477503_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477504_HBx_P-A Product feature CHAIN GQ477504_HBx_P-A of FT:mat_peptide GQ477504_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563545_HBx_P-A Product feature CHAIN GU563545_HBx_P-A of FT:mat_peptide GU563545_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPSSCNFFTSA
>gnl|hbvpro|GU563546_HBx_P-A Product feature CHAIN GU563546_HBx_P-A of FT:mat_peptide GU563546_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563547_HBx_P-A Product feature CHAIN GU563547_HBx_P-A of FT:mat_peptide GU563547_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEDWLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GU563548_HBx_P-A Product feature CHAIN GU563548_HBx_P-A of FT:mat_peptide GU563548_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GU563550_HBx_P-A Product feature CHAIN GU563550_HBx_P-A of FT:mat_peptide GU563550_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLIIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563551_HBx_P-A Product feature CHAIN GU563551_HBx_P-A of FT:mat_peptide GU563551_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563553_HBx_P-A Product feature CHAIN GU563553_HBx_P-A of FT:mat_peptide GU563553_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563554_HBx_P-A Product feature CHAIN GU563554_HBx_P-A of FT:mat_peptide GU563554_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563555_HBx_P-A Product feature CHAIN GU563555_HBx_P-A of FT:mat_peptide GU563555_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563557_HBx_P-A Product feature CHAIN GU563557_HBx_P-A of FT:mat_peptide GU563557_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGSCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563558_HBx_P-A Product feature CHAIN GU563558_HBx_P-A of FT:mat_peptide GU563558_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563562_HBx_P-A Product feature CHAIN GU563562_HBx_P-A of FT:mat_peptide GU563562_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGKEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE576988_HBx_P-A Product feature CHAIN HE576988_HBx_P-A of FT:mat_peptide HE576988_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE576989_HBx_P-A Product feature CHAIN HE576989_HBx_P-A of FT:mat_peptide HE576989_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HM011485_HBx_P-A Product feature CHAIN HM011485_HBx_P-A of FT:mat_peptide HM011485_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TTVNAHQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRXKLVCAPSSCNFFTSA
>gnl|hbvpro|HM535200_HBx_P-A Product feature CHAIN HM535200_HBx_P-A of FT:mat_peptide HM535200_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHPILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|HM535205_HBx_P-A Product feature CHAIN HM535205_HBx_P-A of FT:mat_peptide HM535205_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JN182318_HBx_P-A Product feature CHAIN JN182318_HBx_P-A of FT:mat_peptide JN182318_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKGCVFKDWEELGEEIRLKAFVLGGCRHKLVCAPAPXXFFTSA
>gnl|hbvpro|JN182321_HBx_P-A Product feature CHAIN JN182321_HBx_P-A of FT:mat_peptide JN182321_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
TAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNTHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGGEIRLRVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JN182322_HBx_P-A Product feature CHAIN JN182322_HBx_P-A of FT:mat_peptide JN182322_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVXXXXXXXFFTSA
>gnl|hbvpro|JN182323_HBx_P-A Product feature CHAIN JN182323_HBx_P-A of FT:mat_peptide JN182323_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDRVFKDWEELGEETRLKVFVLGGCRHKLVXXXXXXXFFTSA
>gnl|hbvpro|JN182324_HBx_P-A Product feature CHAIN JN182324_HBx_P-A of FT:mat_peptide JN182324_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN182325_HBx_P-A Product feature CHAIN JN182325_HBx_P-A of FT:mat_peptide JN182325_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182328_HBx_P-A Product feature CHAIN JN182328_HBx_P-A of FT:mat_peptide JN182328_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182330_HBx_P-A Product feature CHAIN JN182330_HBx_P-A of FT:mat_peptide JN182330_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JN182331_HBx_P-A Product feature CHAIN JN182331_HBx_P-A of FT:mat_peptide JN182331_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182332_HBx_P-A Product feature CHAIN JN182332_HBx_P-A of FT:mat_peptide JN182332_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182333_HBx_P-A Product feature CHAIN JN182333_HBx_P-A of FT:mat_peptide JN182333_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JQ023660_HBx_P-A Product feature CHAIN JQ023660_HBx_P-A of FT:mat_peptide JQ023660_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ023661_HBx_P-A Product feature CHAIN JQ023661_HBx_P-A of FT:mat_peptide JQ023661_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ023662_HBx_P-A Product feature CHAIN JQ023662_HBx_P-A of FT:mat_peptide JQ023662_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1164). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ023663_HBx_P-A Product feature CHAIN JQ023663_HBx_P-A of FT:mat_peptide JQ023663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1159). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ687529_HBx_P-A Product feature CHAIN JQ687529_HBx_P-A of FT:mat_peptide JQ687529_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ687533_HBx_P-A Product feature CHAIN JQ687533_HBx_P-A of FT:mat_peptide JQ687533_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707299_HBx_P-A Product feature CHAIN JQ707299_HBx_P-A of FT:mat_peptide JQ707299_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707300_HBx_P-A Product feature CHAIN JQ707300_HBx_P-A of FT:mat_peptide JQ707300_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707301_HBx_P-A Product feature CHAIN JQ707301_HBx_P-A of FT:mat_peptide JQ707301_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707302_HBx_P-A Product feature CHAIN JQ707302_HBx_P-A of FT:mat_peptide JQ707302_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707303_HBx_P-A Product feature CHAIN JQ707303_HBx_P-A of FT:mat_peptide JQ707303_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707304_HBx_P-A Product feature CHAIN JQ707304_HBx_P-A of FT:mat_peptide JQ707304_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707305_HBx_P-A Product feature CHAIN JQ707305_HBx_P-A of FT:mat_peptide JQ707305_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707306_HBx_P-A Product feature CHAIN JQ707306_HBx_P-A of FT:mat_peptide JQ707306_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MADRLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRLTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707307_HBx_P-A Product feature CHAIN JQ707307_HBx_P-A of FT:mat_peptide JQ707307_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707308_HBx_P-A Product feature CHAIN JQ707308_HBx_P-A of FT:mat_peptide JQ707308_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707309_HBx_P-A Product feature CHAIN JQ707309_HBx_P-A of FT:mat_peptide JQ707309_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKHCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707310_HBx_P-A Product feature CHAIN JQ707310_HBx_P-A of FT:mat_peptide JQ707310_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707311_HBx_P-A Product feature CHAIN JQ707311_HBx_P-A of FT:mat_peptide JQ707311_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707312_HBx_P-A Product feature CHAIN JQ707312_HBx_P-A of FT:mat_peptide JQ707312_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707313_HBx_P-A Product feature CHAIN JQ707313_HBx_P-A of FT:mat_peptide JQ707313_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707314_HBx_P-A Product feature CHAIN JQ707314_HBx_P-A of FT:mat_peptide JQ707314_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707315_HBx_P-A Product feature CHAIN JQ707315_HBx_P-A of FT:mat_peptide JQ707315_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707316_HBx_P-A Product feature CHAIN JQ707316_HBx_P-A of FT:mat_peptide JQ707316_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707317_HBx_P-A Product feature CHAIN JQ707317_HBx_P-A of FT:mat_peptide JQ707317_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707318_HBx_P-A Product feature CHAIN JQ707318_HBx_P-A of FT:mat_peptide JQ707318_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707319_HBx_P-A Product feature CHAIN JQ707319_HBx_P-A of FT:mat_peptide JQ707319_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707320_HBx_P-A Product feature CHAIN JQ707320_HBx_P-A of FT:mat_peptide JQ707320_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707321_HBx_P-A Product feature CHAIN JQ707321_HBx_P-A of FT:mat_peptide JQ707321_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707322_HBx_P-A Product feature CHAIN JQ707322_HBx_P-A of FT:mat_peptide JQ707322_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707323_HBx_P-A Product feature CHAIN JQ707323_HBx_P-A of FT:mat_peptide JQ707323_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707324_HBx_P-A Product feature CHAIN JQ707324_HBx_P-A of FT:mat_peptide JQ707324_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707325_HBx_P-A Product feature CHAIN JQ707325_HBx_P-A of FT:mat_peptide JQ707325_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707326_HBx_P-A Product feature CHAIN JQ707326_HBx_P-A of FT:mat_peptide JQ707326_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707327_HBx_P-A Product feature CHAIN JQ707327_HBx_P-A of FT:mat_peptide JQ707327_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707328_HBx_P-A Product feature CHAIN JQ707328_HBx_P-A of FT:mat_peptide JQ707328_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707329_HBx_P-A Product feature CHAIN JQ707329_HBx_P-A of FT:mat_peptide JQ707329_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCALSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707330_HBx_P-A Product feature CHAIN JQ707330_HBx_P-A of FT:mat_peptide JQ707330_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707331_HBx_P-A Product feature CHAIN JQ707331_HBx_P-A of FT:mat_peptide JQ707331_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707332_HBx_P-A Product feature CHAIN JQ707332_HBx_P-A of FT:mat_peptide JQ707332_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707333_HBx_P-A Product feature CHAIN JQ707333_HBx_P-A of FT:mat_peptide JQ707333_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707334_HBx_P-A Product feature CHAIN JQ707334_HBx_P-A of FT:mat_peptide JQ707334_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707335_HBx_P-A Product feature CHAIN JQ707335_HBx_P-A of FT:mat_peptide JQ707335_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C44). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707336_HBx_P-A Product feature CHAIN JQ707336_HBx_P-A of FT:mat_peptide JQ707336_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707337_HBx_P-A Product feature CHAIN JQ707337_HBx_P-A of FT:mat_peptide JQ707337_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707338_HBx_P-A Product feature CHAIN JQ707338_HBx_P-A of FT:mat_peptide JQ707338_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707339_HBx_P-A Product feature CHAIN JQ707339_HBx_P-A of FT:mat_peptide JQ707339_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707340_HBx_P-A Product feature CHAIN JQ707340_HBx_P-A of FT:mat_peptide JQ707340_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALHFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707341_HBx_P-A Product feature CHAIN JQ707341_HBx_P-A of FT:mat_peptide JQ707341_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707342_HBx_P-A Product feature CHAIN JQ707342_HBx_P-A of FT:mat_peptide JQ707342_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707343_HBx_P-A Product feature CHAIN JQ707343_HBx_P-A of FT:mat_peptide JQ707343_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707344_HBx_P-A Product feature CHAIN JQ707344_HBx_P-A of FT:mat_peptide JQ707344_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707345_HBx_P-A Product feature CHAIN JQ707345_HBx_P-A of FT:mat_peptide JQ707345_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707346_HBx_P-A Product feature CHAIN JQ707346_HBx_P-A of FT:mat_peptide JQ707346_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707347_HBx_P-A Product feature CHAIN JQ707347_HBx_P-A of FT:mat_peptide JQ707347_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707348_HBx_P-A Product feature CHAIN JQ707348_HBx_P-A of FT:mat_peptide JQ707348_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVRAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707349_HBx_P-A Product feature CHAIN JQ707349_HBx_P-A of FT:mat_peptide JQ707349_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707350_HBx_P-A Product feature CHAIN JQ707350_HBx_P-A of FT:mat_peptide JQ707350_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707351_HBx_P-A Product feature CHAIN JQ707351_HBx_P-A of FT:mat_peptide JQ707351_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707352_HBx_P-A Product feature CHAIN JQ707352_HBx_P-A of FT:mat_peptide JQ707352_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707353_HBx_P-A Product feature CHAIN JQ707353_HBx_P-A of FT:mat_peptide JQ707353_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCFRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707354_HBx_P-A Product feature CHAIN JQ707354_HBx_P-A of FT:mat_peptide JQ707354_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707355_HBx_P-A Product feature CHAIN JQ707355_HBx_P-A of FT:mat_peptide JQ707355_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707356_HBx_P-A Product feature CHAIN JQ707356_HBx_P-A of FT:mat_peptide JQ707356_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707357_HBx_P-A Product feature CHAIN JQ707357_HBx_P-A of FT:mat_peptide JQ707357_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707358_HBx_P-A Product feature CHAIN JQ707358_HBx_P-A of FT:mat_peptide JQ707358_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707359_HBx_P-A Product feature CHAIN JQ707359_HBx_P-A of FT:mat_peptide JQ707359_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707360_HBx_P-A Product feature CHAIN JQ707360_HBx_P-A of FT:mat_peptide JQ707360_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707361_HBx_P-A Product feature CHAIN JQ707361_HBx_P-A of FT:mat_peptide JQ707361_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707362_HBx_P-A Product feature CHAIN JQ707362_HBx_P-A of FT:mat_peptide JQ707362_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDNVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707363_HBx_P-A Product feature CHAIN JQ707363_HBx_P-A of FT:mat_peptide JQ707363_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707364_HBx_P-A Product feature CHAIN JQ707364_HBx_P-A of FT:mat_peptide JQ707364_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707365_HBx_P-A Product feature CHAIN JQ707365_HBx_P-A of FT:mat_peptide JQ707365_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707366_HBx_P-A Product feature CHAIN JQ707366_HBx_P-A of FT:mat_peptide JQ707366_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707367_HBx_P-A Product feature CHAIN JQ707367_HBx_P-A of FT:mat_peptide JQ707367_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707368_HBx_P-A Product feature CHAIN JQ707368_HBx_P-A of FT:mat_peptide JQ707368_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707369_HBx_P-A Product feature CHAIN JQ707369_HBx_P-A of FT:mat_peptide JQ707369_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707370_HBx_P-A Product feature CHAIN JQ707370_HBx_P-A of FT:mat_peptide JQ707370_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707371_HBx_P-A Product feature CHAIN JQ707371_HBx_P-A of FT:mat_peptide JQ707371_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707372_HBx_P-A Product feature CHAIN JQ707372_HBx_P-A of FT:mat_peptide JQ707372_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707373_HBx_P-A Product feature CHAIN JQ707373_HBx_P-A of FT:mat_peptide JQ707373_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707374_HBx_P-A Product feature CHAIN JQ707374_HBx_P-A of FT:mat_peptide JQ707374_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGQCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707375_HBx_P-A Product feature CHAIN JQ707375_HBx_P-A of FT:mat_peptide JQ707375_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707376_HBx_P-A Product feature CHAIN JQ707376_HBx_P-A of FT:mat_peptide JQ707376_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707377_HBx_P-A Product feature CHAIN JQ707377_HBx_P-A of FT:mat_peptide JQ707377_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707378_HBx_P-A Product feature CHAIN JQ707378_HBx_P-A of FT:mat_peptide JQ707378_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707379_HBx_P-A Product feature CHAIN JQ707379_HBx_P-A of FT:mat_peptide JQ707379_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707380_HBx_P-A Product feature CHAIN JQ707380_HBx_P-A of FT:mat_peptide JQ707380_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707381_HBx_P-A Product feature CHAIN JQ707381_HBx_P-A of FT:mat_peptide JQ707381_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707382_HBx_P-A Product feature CHAIN JQ707382_HBx_P-A of FT:mat_peptide JQ707382_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707383_HBx_P-A Product feature CHAIN JQ707383_HBx_P-A of FT:mat_peptide JQ707383_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPTMSTTDLEAYFKDSVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707384_HBx_P-A Product feature CHAIN JQ707384_HBx_P-A of FT:mat_peptide JQ707384_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707385_HBx_P-A Product feature CHAIN JQ707385_HBx_P-A of FT:mat_peptide JQ707385_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707386_HBx_P-A Product feature CHAIN JQ707386_HBx_P-A of FT:mat_peptide JQ707386_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707387_HBx_P-A Product feature CHAIN JQ707387_HBx_P-A of FT:mat_peptide JQ707387_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707388_HBx_P-A Product feature CHAIN JQ707388_HBx_P-A of FT:mat_peptide JQ707388_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707389_HBx_P-A Product feature CHAIN JQ707389_HBx_P-A of FT:mat_peptide JQ707389_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707390_HBx_P-A Product feature CHAIN JQ707390_HBx_P-A of FT:mat_peptide JQ707390_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707391_HBx_P-A Product feature CHAIN JQ707391_HBx_P-A of FT:mat_peptide JQ707391_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707392_HBx_P-A Product feature CHAIN JQ707392_HBx_P-A of FT:mat_peptide JQ707392_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707393_HBx_P-A Product feature CHAIN JQ707393_HBx_P-A of FT:mat_peptide JQ707393_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707394_HBx_P-A Product feature CHAIN JQ707394_HBx_P-A of FT:mat_peptide JQ707394_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707395_HBx_P-A Product feature CHAIN JQ707395_HBx_P-A of FT:mat_peptide JQ707395_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707396_HBx_P-A Product feature CHAIN JQ707396_HBx_P-A of FT:mat_peptide JQ707396_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707397_HBx_P-A Product feature CHAIN JQ707397_HBx_P-A of FT:mat_peptide JQ707397_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLRGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707398_HBx_P-A Product feature CHAIN JQ707398_HBx_P-A of FT:mat_peptide JQ707398_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707399_HBx_P-A Product feature CHAIN JQ707399_HBx_P-A of FT:mat_peptide JQ707399_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707400_HBx_P-A Product feature CHAIN JQ707400_HBx_P-A of FT:mat_peptide JQ707400_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707402_HBx_P-A Product feature CHAIN JQ707402_HBx_P-A of FT:mat_peptide JQ707402_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707403_HBx_P-A Product feature CHAIN JQ707403_HBx_P-A of FT:mat_peptide JQ707403_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707404_HBx_P-A Product feature CHAIN JQ707404_HBx_P-A of FT:mat_peptide JQ707404_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707405_HBx_P-A Product feature CHAIN JQ707405_HBx_P-A of FT:mat_peptide JQ707405_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGFRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707406_HBx_P-A Product feature CHAIN JQ707406_HBx_P-A of FT:mat_peptide JQ707406_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707407_HBx_P-A Product feature CHAIN JQ707407_HBx_P-A of FT:mat_peptide JQ707407_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707408_HBx_P-A Product feature CHAIN JQ707408_HBx_P-A of FT:mat_peptide JQ707408_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707409_HBx_P-A Product feature CHAIN JQ707409_HBx_P-A of FT:mat_peptide JQ707409_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707410_HBx_P-A Product feature CHAIN JQ707410_HBx_P-A of FT:mat_peptide JQ707410_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707411_HBx_P-A Product feature CHAIN JQ707411_HBx_P-A of FT:mat_peptide JQ707411_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAQQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707412_HBx_P-A Product feature CHAIN JQ707412_HBx_P-A of FT:mat_peptide JQ707412_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707413_HBx_P-A Product feature CHAIN JQ707413_HBx_P-A of FT:mat_peptide JQ707413_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707414_HBx_P-A Product feature CHAIN JQ707414_HBx_P-A of FT:mat_peptide JQ707414_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707415_HBx_P-A Product feature CHAIN JQ707415_HBx_P-A of FT:mat_peptide JQ707415_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707416_HBx_P-A Product feature CHAIN JQ707416_HBx_P-A of FT:mat_peptide JQ707416_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707417_HBx_P-A Product feature CHAIN JQ707417_HBx_P-A of FT:mat_peptide JQ707417_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707418_HBx_P-A Product feature CHAIN JQ707418_HBx_P-A of FT:mat_peptide JQ707418_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707419_HBx_P-A Product feature CHAIN JQ707419_HBx_P-A of FT:mat_peptide JQ707419_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707420_HBx_P-A Product feature CHAIN JQ707420_HBx_P-A of FT:mat_peptide JQ707420_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707531_HBx_P-A Product feature CHAIN JQ707531_HBx_P-A of FT:mat_peptide JQ707531_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707532_HBx_P-A Product feature CHAIN JQ707532_HBx_P-A of FT:mat_peptide JQ707532_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707533_HBx_P-A Product feature CHAIN JQ707533_HBx_P-A of FT:mat_peptide JQ707533_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707534_HBx_P-A Product feature CHAIN JQ707534_HBx_P-A of FT:mat_peptide JQ707534_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707535_HBx_P-A Product feature CHAIN JQ707535_HBx_P-A of FT:mat_peptide JQ707535_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707536_HBx_P-A Product feature CHAIN JQ707536_HBx_P-A of FT:mat_peptide JQ707536_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707537_HBx_P-A Product feature CHAIN JQ707537_HBx_P-A of FT:mat_peptide JQ707537_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707538_HBx_P-A Product feature CHAIN JQ707538_HBx_P-A of FT:mat_peptide JQ707538_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707539_HBx_P-A Product feature CHAIN JQ707539_HBx_P-A of FT:mat_peptide JQ707539_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707540_HBx_P-A Product feature CHAIN JQ707540_HBx_P-A of FT:mat_peptide JQ707540_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707541_HBx_P-A Product feature CHAIN JQ707541_HBx_P-A of FT:mat_peptide JQ707541_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707542_HBx_P-A Product feature CHAIN JQ707542_HBx_P-A of FT:mat_peptide JQ707542_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707543_HBx_P-A Product feature CHAIN JQ707543_HBx_P-A of FT:mat_peptide JQ707543_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707544_HBx_P-A Product feature CHAIN JQ707544_HBx_P-A of FT:mat_peptide JQ707544_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707545_HBx_P-A Product feature CHAIN JQ707545_HBx_P-A of FT:mat_peptide JQ707545_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707546_HBx_P-A Product feature CHAIN JQ707546_HBx_P-A of FT:mat_peptide JQ707546_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707547_HBx_P-A Product feature CHAIN JQ707547_HBx_P-A of FT:mat_peptide JQ707547_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707548_HBx_P-A Product feature CHAIN JQ707548_HBx_P-A of FT:mat_peptide JQ707548_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707549_HBx_P-A Product feature CHAIN JQ707549_HBx_P-A of FT:mat_peptide JQ707549_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707550_HBx_P-A Product feature CHAIN JQ707550_HBx_P-A of FT:mat_peptide JQ707550_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707551_HBx_P-A Product feature CHAIN JQ707551_HBx_P-A of FT:mat_peptide JQ707551_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707552_HBx_P-A Product feature CHAIN JQ707552_HBx_P-A of FT:mat_peptide JQ707552_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707553_HBx_P-A Product feature CHAIN JQ707553_HBx_P-A of FT:mat_peptide JQ707553_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707554_HBx_P-A Product feature CHAIN JQ707554_HBx_P-A of FT:mat_peptide JQ707554_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707555_HBx_P-A Product feature CHAIN JQ707555_HBx_P-A of FT:mat_peptide JQ707555_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707556_HBx_P-A Product feature CHAIN JQ707556_HBx_P-A of FT:mat_peptide JQ707556_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707557_HBx_P-A Product feature CHAIN JQ707557_HBx_P-A of FT:mat_peptide JQ707557_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707558_HBx_P-A Product feature CHAIN JQ707558_HBx_P-A of FT:mat_peptide JQ707558_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707559_HBx_P-A Product feature CHAIN JQ707559_HBx_P-A of FT:mat_peptide JQ707559_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707560_HBx_P-A Product feature CHAIN JQ707560_HBx_P-A of FT:mat_peptide JQ707560_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSTGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707561_HBx_P-A Product feature CHAIN JQ707561_HBx_P-A of FT:mat_peptide JQ707561_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707562_HBx_P-A Product feature CHAIN JQ707562_HBx_P-A of FT:mat_peptide JQ707562_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707563_HBx_P-A Product feature CHAIN JQ707563_HBx_P-A of FT:mat_peptide JQ707563_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707564_HBx_P-A Product feature CHAIN JQ707564_HBx_P-A of FT:mat_peptide JQ707564_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707565_HBx_P-A Product feature CHAIN JQ707565_HBx_P-A of FT:mat_peptide JQ707565_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707566_HBx_P-A Product feature CHAIN JQ707566_HBx_P-A of FT:mat_peptide JQ707566_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707567_HBx_P-A Product feature CHAIN JQ707567_HBx_P-A of FT:mat_peptide JQ707567_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707568_HBx_P-A Product feature CHAIN JQ707568_HBx_P-A of FT:mat_peptide JQ707568_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707569_HBx_P-A Product feature CHAIN JQ707569_HBx_P-A of FT:mat_peptide JQ707569_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707572_HBx_P-A Product feature CHAIN JQ707572_HBx_P-A of FT:mat_peptide JQ707572_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707573_HBx_P-A Product feature CHAIN JQ707573_HBx_P-A of FT:mat_peptide JQ707573_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707574_HBx_P-A Product feature CHAIN JQ707574_HBx_P-A of FT:mat_peptide JQ707574_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707575_HBx_P-A Product feature CHAIN JQ707575_HBx_P-A of FT:mat_peptide JQ707575_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707576_HBx_P-A Product feature CHAIN JQ707576_HBx_P-A of FT:mat_peptide JQ707576_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707577_HBx_P-A Product feature CHAIN JQ707577_HBx_P-A of FT:mat_peptide JQ707577_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707578_HBx_P-A Product feature CHAIN JQ707578_HBx_P-A of FT:mat_peptide JQ707578_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707579_HBx_P-A Product feature CHAIN JQ707579_HBx_P-A of FT:mat_peptide JQ707579_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707580_HBx_P-A Product feature CHAIN JQ707580_HBx_P-A of FT:mat_peptide JQ707580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707581_HBx_P-A Product feature CHAIN JQ707581_HBx_P-A of FT:mat_peptide JQ707581_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
VAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHKILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707582_HBx_P-A Product feature CHAIN JQ707582_HBx_P-A of FT:mat_peptide JQ707582_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707583_HBx_P-A Product feature CHAIN JQ707583_HBx_P-A of FT:mat_peptide JQ707583_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707584_HBx_P-A Product feature CHAIN JQ707584_HBx_P-A of FT:mat_peptide JQ707584_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707585_HBx_P-A Product feature CHAIN JQ707585_HBx_P-A of FT:mat_peptide JQ707585_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707586_HBx_P-A Product feature CHAIN JQ707586_HBx_P-A of FT:mat_peptide JQ707586_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707587_HBx_P-A Product feature CHAIN JQ707587_HBx_P-A of FT:mat_peptide JQ707587_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707588_HBx_P-A Product feature CHAIN JQ707588_HBx_P-A of FT:mat_peptide JQ707588_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707589_HBx_P-A Product feature CHAIN JQ707589_HBx_P-A of FT:mat_peptide JQ707589_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLETLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707590_HBx_P-A Product feature CHAIN JQ707590_HBx_P-A of FT:mat_peptide JQ707590_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707591_HBx_P-A Product feature CHAIN JQ707591_HBx_P-A of FT:mat_peptide JQ707591_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707592_HBx_P-A Product feature CHAIN JQ707592_HBx_P-A of FT:mat_peptide JQ707592_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707593_HBx_P-A Product feature CHAIN JQ707593_HBx_P-A of FT:mat_peptide JQ707593_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707594_HBx_P-A Product feature CHAIN JQ707594_HBx_P-A of FT:mat_peptide JQ707594_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707595_HBx_P-A Product feature CHAIN JQ707595_HBx_P-A of FT:mat_peptide JQ707595_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707596_HBx_P-A Product feature CHAIN JQ707596_HBx_P-A of FT:mat_peptide JQ707596_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707597_HBx_P-A Product feature CHAIN JQ707597_HBx_P-A of FT:mat_peptide JQ707597_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707598_HBx_P-A Product feature CHAIN JQ707598_HBx_P-A of FT:mat_peptide JQ707598_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707599_HBx_P-A Product feature CHAIN JQ707599_HBx_P-A of FT:mat_peptide JQ707599_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707600_HBx_P-A Product feature CHAIN JQ707600_HBx_P-A of FT:mat_peptide JQ707600_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707601_HBx_P-A Product feature CHAIN JQ707601_HBx_P-A of FT:mat_peptide JQ707601_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707602_HBx_P-A Product feature CHAIN JQ707602_HBx_P-A of FT:mat_peptide JQ707602_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707603_HBx_P-A Product feature CHAIN JQ707603_HBx_P-A of FT:mat_peptide JQ707603_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707604_HBx_P-A Product feature CHAIN JQ707604_HBx_P-A of FT:mat_peptide JQ707604_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707605_HBx_P-A Product feature CHAIN JQ707605_HBx_P-A of FT:mat_peptide JQ707605_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707606_HBx_P-A Product feature CHAIN JQ707606_HBx_P-A of FT:mat_peptide JQ707606_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707607_HBx_P-A Product feature CHAIN JQ707607_HBx_P-A of FT:mat_peptide JQ707607_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707608_HBx_P-A Product feature CHAIN JQ707608_HBx_P-A of FT:mat_peptide JQ707608_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707609_HBx_P-A Product feature CHAIN JQ707609_HBx_P-A of FT:mat_peptide JQ707609_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707610_HBx_P-A Product feature CHAIN JQ707610_HBx_P-A of FT:mat_peptide JQ707610_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707611_HBx_P-A Product feature CHAIN JQ707611_HBx_P-A of FT:mat_peptide JQ707611_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDSVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707612_HBx_P-A Product feature CHAIN JQ707612_HBx_P-A of FT:mat_peptide JQ707612_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707613_HBx_P-A Product feature CHAIN JQ707613_HBx_P-A of FT:mat_peptide JQ707613_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707614_HBx_P-A Product feature CHAIN JQ707614_HBx_P-A of FT:mat_peptide JQ707614_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707615_HBx_P-A Product feature CHAIN JQ707615_HBx_P-A of FT:mat_peptide JQ707615_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707616_HBx_P-A Product feature CHAIN JQ707616_HBx_P-A of FT:mat_peptide JQ707616_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707617_HBx_P-A Product feature CHAIN JQ707617_HBx_P-A of FT:mat_peptide JQ707617_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRYTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707618_HBx_P-A Product feature CHAIN JQ707618_HBx_P-A of FT:mat_peptide JQ707618_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707619_HBx_P-A Product feature CHAIN JQ707619_HBx_P-A of FT:mat_peptide JQ707619_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707620_HBx_P-A Product feature CHAIN JQ707620_HBx_P-A of FT:mat_peptide JQ707620_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707621_HBx_P-A Product feature CHAIN JQ707621_HBx_P-A of FT:mat_peptide JQ707621_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707622_HBx_P-A Product feature CHAIN JQ707622_HBx_P-A of FT:mat_peptide JQ707622_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707623_HBx_P-A Product feature CHAIN JQ707623_HBx_P-A of FT:mat_peptide JQ707623_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707624_HBx_P-A Product feature CHAIN JQ707624_HBx_P-A of FT:mat_peptide JQ707624_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707625_HBx_P-A Product feature CHAIN JQ707625_HBx_P-A of FT:mat_peptide JQ707625_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYMFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707626_HBx_P-A Product feature CHAIN JQ707626_HBx_P-A of FT:mat_peptide JQ707626_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707627_HBx_P-A Product feature CHAIN JQ707627_HBx_P-A of FT:mat_peptide JQ707627_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707628_HBx_P-A Product feature CHAIN JQ707628_HBx_P-A of FT:mat_peptide JQ707628_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707629_HBx_P-A Product feature CHAIN JQ707629_HBx_P-A of FT:mat_peptide JQ707629_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707630_HBx_P-A Product feature CHAIN JQ707630_HBx_P-A of FT:mat_peptide JQ707630_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707631_HBx_P-A Product feature CHAIN JQ707631_HBx_P-A of FT:mat_peptide JQ707631_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707632_HBx_P-A Product feature CHAIN JQ707632_HBx_P-A of FT:mat_peptide JQ707632_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707633_HBx_P-A Product feature CHAIN JQ707633_HBx_P-A of FT:mat_peptide JQ707633_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707634_HBx_P-A Product feature CHAIN JQ707634_HBx_P-A of FT:mat_peptide JQ707634_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707635_HBx_P-A Product feature CHAIN JQ707635_HBx_P-A of FT:mat_peptide JQ707635_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707636_HBx_P-A Product feature CHAIN JQ707636_HBx_P-A of FT:mat_peptide JQ707636_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707637_HBx_P-A Product feature CHAIN JQ707637_HBx_P-A of FT:mat_peptide JQ707637_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707638_HBx_P-A Product feature CHAIN JQ707638_HBx_P-A of FT:mat_peptide JQ707638_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707639_HBx_P-A Product feature CHAIN JQ707639_HBx_P-A of FT:mat_peptide JQ707639_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707640_HBx_P-A Product feature CHAIN JQ707640_HBx_P-A of FT:mat_peptide JQ707640_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707641_HBx_P-A Product feature CHAIN JQ707641_HBx_P-A of FT:mat_peptide JQ707641_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707642_HBx_P-A Product feature CHAIN JQ707642_HBx_P-A of FT:mat_peptide JQ707642_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707643_HBx_P-A Product feature CHAIN JQ707643_HBx_P-A of FT:mat_peptide JQ707643_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707644_HBx_P-A Product feature CHAIN JQ707644_HBx_P-A of FT:mat_peptide JQ707644_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707645_HBx_P-A Product feature CHAIN JQ707645_HBx_P-A of FT:mat_peptide JQ707645_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707646_HBx_P-A Product feature CHAIN JQ707646_HBx_P-A of FT:mat_peptide JQ707646_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707647_HBx_P-A Product feature CHAIN JQ707647_HBx_P-A of FT:mat_peptide JQ707647_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707648_HBx_P-A Product feature CHAIN JQ707648_HBx_P-A of FT:mat_peptide JQ707648_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707649_HBx_P-A Product feature CHAIN JQ707649_HBx_P-A of FT:mat_peptide JQ707649_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707650_HBx_P-A Product feature CHAIN JQ707650_HBx_P-A of FT:mat_peptide JQ707650_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYMFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707651_HBx_P-A Product feature CHAIN JQ707651_HBx_P-A of FT:mat_peptide JQ707651_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707652_HBx_P-A Product feature CHAIN JQ707652_HBx_P-A of FT:mat_peptide JQ707652_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707653_HBx_P-A Product feature CHAIN JQ707653_HBx_P-A of FT:mat_peptide JQ707653_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707654_HBx_P-A Product feature CHAIN JQ707654_HBx_P-A of FT:mat_peptide JQ707654_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707655_HBx_P-A Product feature CHAIN JQ707655_HBx_P-A of FT:mat_peptide JQ707655_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707656_HBx_P-A Product feature CHAIN JQ707656_HBx_P-A of FT:mat_peptide JQ707656_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707658_HBx_P-A Product feature CHAIN JQ707658_HBx_P-A of FT:mat_peptide JQ707658_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707659_HBx_P-A Product feature CHAIN JQ707659_HBx_P-A of FT:mat_peptide JQ707659_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHTRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707661_HBx_P-A Product feature CHAIN JQ707661_HBx_P-A of FT:mat_peptide JQ707661_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707662_HBx_P-A Product feature CHAIN JQ707662_HBx_P-A of FT:mat_peptide JQ707662_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707663_HBx_P-A Product feature CHAIN JQ707663_HBx_P-A of FT:mat_peptide JQ707663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707664_HBx_P-A Product feature CHAIN JQ707664_HBx_P-A of FT:mat_peptide JQ707664_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707665_HBx_P-A Product feature CHAIN JQ707665_HBx_P-A of FT:mat_peptide JQ707665_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707667_HBx_P-A Product feature CHAIN JQ707667_HBx_P-A of FT:mat_peptide JQ707667_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707669_HBx_P-A Product feature CHAIN JQ707669_HBx_P-A of FT:mat_peptide JQ707669_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707670_HBx_P-A Product feature CHAIN JQ707670_HBx_P-A of FT:mat_peptide JQ707670_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707672_HBx_P-A Product feature CHAIN JQ707672_HBx_P-A of FT:mat_peptide JQ707672_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707674_HBx_P-A Product feature CHAIN JQ707674_HBx_P-A of FT:mat_peptide JQ707674_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707675_HBx_P-A Product feature CHAIN JQ707675_HBx_P-A of FT:mat_peptide JQ707675_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707676_HBx_P-A Product feature CHAIN JQ707676_HBx_P-A of FT:mat_peptide JQ707676_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707681_HBx_P-A Product feature CHAIN JQ707681_HBx_P-A of FT:mat_peptide JQ707681_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX096952_HBx_P-A Product feature CHAIN JX096952_HBx_P-A of FT:mat_peptide JX096952_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX096953_HBx_P-A Product feature CHAIN JX096953_HBx_P-A of FT:mat_peptide JX096953_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX154579_HBx_P-A Product feature CHAIN JX154579_HBx_P-A of FT:mat_peptide JX154579_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|JX154580_HBx_P-A Product feature CHAIN JX154580_HBx_P-A of FT:mat_peptide JX154580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|JX154581_HBx_P-A Product feature CHAIN JX154581_HBx_P-A of FT:mat_peptide JX154581_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|JX154582_HBx_P-A Product feature CHAIN JX154582_HBx_P-A of FT:mat_peptide JX154582_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMICVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX310722_HBx_P-A Product feature CHAIN JX310722_HBx_P-A of FT:mat_peptide JX310722_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXXXXXXXSA
>gnl|hbvpro|JX310723_HBx_P-A Product feature CHAIN JX310723_HBx_P-A of FT:mat_peptide JX310723_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXXXXXXXSA
>gnl|hbvpro|KC875251_HBx_P-A Product feature CHAIN KC875251_HBx_P-A of FT:mat_peptide KC875251_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTVGLPAMSTTDLEASFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875252_HBx_P-A Product feature CHAIN KC875252_HBx_P-A of FT:mat_peptide KC875252_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875253_HBx_P-A Product feature CHAIN KC875253_HBx_P-A of FT:mat_peptide KC875253_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSMTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875254_HBx_P-A Product feature CHAIN KC875254_HBx_P-A of FT:mat_peptide KC875254_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV12). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSTRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPDCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGSCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875255_HBx_P-A Product feature CHAIN KC875255_HBx_P-A of FT:mat_peptide KC875255_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHGAHLSLHGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875256_HBx_P-A Product feature CHAIN KC875256_HBx_P-A of FT:mat_peptide KC875256_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHGAHLSLHGLPVCAFSPAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSRNFFTSA
>gnl|hbvpro|KC875257_HBx_P-A Product feature CHAIN KC875257_HBx_P-A of FT:mat_peptide KC875257_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESPGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875258_HBx_P-A Product feature CHAIN KC875258_HBx_P-A of FT:mat_peptide KC875258_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV66). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875259_HBx_P-A Product feature CHAIN KC875259_HBx_P-A of FT:mat_peptide KC875259_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEITLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875260_HBx_P-A Product feature CHAIN KC875260_HBx_P-A of FT:mat_peptide KC875260_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF214657_HBx_P-A Product feature CHAIN KF214657_HBx_P-A of FT:mat_peptide KF214657_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF214658_HBx_P-A Product feature CHAIN KF214658_HBx_P-A of FT:mat_peptide KF214658_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAHFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF214659_HBx_P-A Product feature CHAIN KF214659_HBx_P-A of FT:mat_peptide KF214659_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF214660_HBx_P-A Product feature CHAIN KF214660_HBx_P-A of FT:mat_peptide KF214660_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSASAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPSMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF214661_HBx_P-A Product feature CHAIN KF214661_HBx_P-A of FT:mat_peptide KF214661_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHPVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF214662_HBx_P-A Product feature CHAIN KF214662_HBx_P-A of FT:mat_peptide KF214662_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEDLGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF214663_HBx_P-A Product feature CHAIN KF214663_HBx_P-A of FT:mat_peptide KF214663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF214665_HBx_P-A Product feature CHAIN KF214665_HBx_P-A of FT:mat_peptide KF214665_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214666_HBx_P-A Product feature CHAIN KF214666_HBx_P-A of FT:mat_peptide KF214666_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922406_HBx_P-A Product feature CHAIN KF922406_HBx_P-A of FT:mat_peptide KF922406_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922407_HBx_P-A Product feature CHAIN KF922407_HBx_P-A of FT:mat_peptide KF922407_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922408_HBx_P-A Product feature CHAIN KF922408_HBx_P-A of FT:mat_peptide KF922408_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922409_HBx_P-A Product feature CHAIN KF922409_HBx_P-A of FT:mat_peptide KF922409_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922414_HBx_P-A Product feature CHAIN KF922414_HBx_P-A of FT:mat_peptide KF922414_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KF922415_HBx_P-A Product feature CHAIN KF922415_HBx_P-A of FT:mat_peptide KF922415_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KF922416_HBx_P-A Product feature CHAIN KF922416_HBx_P-A of FT:mat_peptide KF922416_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KF922417_HBx_P-A Product feature CHAIN KF922417_HBx_P-A of FT:mat_peptide KF922417_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922418_HBx_P-A Product feature CHAIN KF922418_HBx_P-A of FT:mat_peptide KF922418_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922419_HBx_P-A Product feature CHAIN KF922419_HBx_P-A of FT:mat_peptide KF922419_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922420_HBx_P-A Product feature CHAIN KF922420_HBx_P-A of FT:mat_peptide KF922420_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922421_HBx_P-A Product feature CHAIN KF922421_HBx_P-A of FT:mat_peptide KF922421_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922424_HBx_P-A Product feature CHAIN KF922424_HBx_P-A of FT:mat_peptide KF922424_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TSVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922425_HBx_P-A Product feature CHAIN KF922425_HBx_P-A of FT:mat_peptide KF922425_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TSVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922426_HBx_P-A Product feature CHAIN KF922426_HBx_P-A of FT:mat_peptide KF922426_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922427_HBx_P-A Product feature CHAIN KF922427_HBx_P-A of FT:mat_peptide KF922427_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922428_HBx_P-A Product feature CHAIN KF922428_HBx_P-A of FT:mat_peptide KF922428_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922429_HBx_P-A Product feature CHAIN KF922429_HBx_P-A of FT:mat_peptide KF922429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922430_HBx_P-A Product feature CHAIN KF922430_HBx_P-A of FT:mat_peptide KF922430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922431_HBx_P-A Product feature CHAIN KF922431_HBx_P-A of FT:mat_peptide KF922431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922433_HBx_P-A Product feature CHAIN KF922433_HBx_P-A of FT:mat_peptide KF922433_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF922434_HBx_P-A Product feature CHAIN KF922434_HBx_P-A of FT:mat_peptide KF922434_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF922435_HBx_P-A Product feature CHAIN KF922435_HBx_P-A of FT:mat_peptide KF922435_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922436_HBx_P-A Product feature CHAIN KF922436_HBx_P-A of FT:mat_peptide KF922436_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922437_HBx_P-A Product feature CHAIN KF922437_HBx_P-A of FT:mat_peptide KF922437_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ010776_HBx_P-A Product feature CHAIN KJ010776_HBx_P-A of FT:mat_peptide KJ010776_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ010777_HBx_P-A Product feature CHAIN KJ010777_HBx_P-A of FT:mat_peptide KJ010777_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ010778_HBx_P-A Product feature CHAIN KJ010778_HBx_P-A of FT:mat_peptide KJ010778_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ586809_HBx_P-A Product feature CHAIN KJ586809_HBx_P-A of FT:mat_peptide KJ586809_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843166_HBx_P-A Product feature CHAIN KJ843166_HBx_P-A of FT:mat_peptide KJ843166_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843172_HBx_P-A Product feature CHAIN KJ843172_HBx_P-A of FT:mat_peptide KJ843172_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843173_HBx_P-A Product feature CHAIN KJ843173_HBx_P-A of FT:mat_peptide KJ843173_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843182_HBx_P-A Product feature CHAIN KJ843182_HBx_P-A of FT:mat_peptide KJ843182_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843183_HBx_P-A Product feature CHAIN KJ843183_HBx_P-A of FT:mat_peptide KJ843183_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KJ843184_HBx_P-A Product feature CHAIN KJ843184_HBx_P-A of FT:mat_peptide KJ843184_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPTVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCXXKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843186_HBx_P-A Product feature CHAIN KJ843186_HBx_P-A of FT:mat_peptide KJ843186_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843188_HBx_P-A Product feature CHAIN KJ843188_HBx_P-A of FT:mat_peptide KJ843188_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843192_HBx_P-A Product feature CHAIN KJ843192_HBx_P-A of FT:mat_peptide KJ843192_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843214_HBx_P-A Product feature CHAIN KJ843214_HBx_P-A of FT:mat_peptide KJ843214_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843215_HBx_P-A Product feature CHAIN KJ843215_HBx_P-A of FT:mat_peptide KJ843215_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSGMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843216_HBx_P-A Product feature CHAIN KJ843216_HBx_P-A of FT:mat_peptide KJ843216_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSGMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843217_HBx_P-A Product feature CHAIN KJ843217_HBx_P-A of FT:mat_peptide KJ843217_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843218_HBx_P-A Product feature CHAIN KJ843218_HBx_P-A of FT:mat_peptide KJ843218_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854685_HBx_P-A Product feature CHAIN KJ854685_HBx_P-A of FT:mat_peptide KJ854685_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854686_HBx_P-A Product feature CHAIN KJ854686_HBx_P-A of FT:mat_peptide KJ854686_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854687_HBx_P-A Product feature CHAIN KJ854687_HBx_P-A of FT:mat_peptide KJ854687_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCAVRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854688_HBx_P-A Product feature CHAIN KJ854688_HBx_P-A of FT:mat_peptide KJ854688_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854689_HBx_P-A Product feature CHAIN KJ854689_HBx_P-A of FT:mat_peptide KJ854689_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXPCNFFTSA
>gnl|hbvpro|KJ854690_HBx_P-A Product feature CHAIN KJ854690_HBx_P-A of FT:mat_peptide KJ854690_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854691_HBx_P-A Product feature CHAIN KJ854691_HBx_P-A of FT:mat_peptide KJ854691_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854692_HBx_P-A Product feature CHAIN KJ854692_HBx_P-A of FT:mat_peptide KJ854692_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854694_HBx_P-A Product feature CHAIN KJ854694_HBx_P-A of FT:mat_peptide KJ854694_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854695_HBx_P-A Product feature CHAIN KJ854695_HBx_P-A of FT:mat_peptide KJ854695_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1814-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFXXXX
>gnl|hbvpro|KJ854696_HBx_P-A Product feature CHAIN KJ854696_HBx_P-A of FT:mat_peptide KJ854696_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854697_HBx_P-A Product feature CHAIN KJ854697_HBx_P-A of FT:mat_peptide KJ854697_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854699_HBx_P-A Product feature CHAIN KJ854699_HBx_P-A of FT:mat_peptide KJ854699_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHGAHFSLRSLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854700_HBx_P-A Product feature CHAIN KJ854700_HBx_P-A of FT:mat_peptide KJ854700_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGSLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854701_HBx_P-A Product feature CHAIN KJ854701_HBx_P-A of FT:mat_peptide KJ854701_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854702_HBx_P-A Product feature CHAIN KJ854702_HBx_P-A of FT:mat_peptide KJ854702_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854703_HBx_P-A Product feature CHAIN KJ854703_HBx_P-A of FT:mat_peptide KJ854703_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854704_HBx_P-A Product feature CHAIN KJ854704_HBx_P-A of FT:mat_peptide KJ854704_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVCAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854705_HBx_P-A Product feature CHAIN KJ854705_HBx_P-A of FT:mat_peptide KJ854705_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854706_HBx_P-A Product feature CHAIN KJ854706_HBx_P-A of FT:mat_peptide KJ854706_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854707_HBx_P-A Product feature CHAIN KJ854707_HBx_P-A of FT:mat_peptide KJ854707_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTRPLGNLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854708_HBx_P-A Product feature CHAIN KJ854708_HBx_P-A of FT:mat_peptide KJ854708_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854709_HBx_P-A Product feature CHAIN KJ854709_HBx_P-A of FT:mat_peptide KJ854709_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSGGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVXXXXXXXFFTSA
>gnl|hbvpro|KJ854710_HBx_P-A Product feature CHAIN KJ854710_HBx_P-A of FT:mat_peptide KJ854710_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM243029_HBx_P-A Product feature CHAIN KM243029_HBx_P-A of FT:mat_peptide KM243029_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM519452_HBx_P-A Product feature CHAIN KM519452_HBx_P-A of FT:mat_peptide KM519452_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KM519453_HBx_P-A Product feature CHAIN KM519453_HBx_P-A of FT:mat_peptide KM519453_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KM519454_HBx_P-A Product feature CHAIN KM519454_HBx_P-A of FT:mat_peptide KM519454_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIKLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606737_HBx_P-A Product feature CHAIN KM606737_HBx_P-A of FT:mat_peptide KM606737_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPTSCNFFTSA
>gnl|hbvpro|KM606742_HBx_P-A Product feature CHAIN KM606742_HBx_P-A of FT:mat_peptide KM606742_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606746_HBx_P-A Product feature CHAIN KM606746_HBx_P-A of FT:mat_peptide KM606746_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606748_HBx_P-A Product feature CHAIN KM606748_HBx_P-A of FT:mat_peptide KM606748_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KM606749_HBx_P-A Product feature CHAIN KM606749_HBx_P-A of FT:mat_peptide KM606749_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168422_HBx_P-A Product feature CHAIN KP168422_HBx_P-A of FT:mat_peptide KP168422_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN136). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHWILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168423_HBx_P-A Product feature CHAIN KP168423_HBx_P-A of FT:mat_peptide KP168423_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSTSTVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168424_HBx_P-A Product feature CHAIN KP168424_HBx_P-A of FT:mat_peptide KP168424_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYWQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALPFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168425_HBx_P-A Product feature CHAIN KP168425_HBx_P-A of FT:mat_peptide KP168425_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLXLPTMSATDLEAYFKDCVFKDWEELGEEIKLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168426_HBx_P-A Product feature CHAIN KP168426_HBx_P-A of FT:mat_peptide KP168426_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGTLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168427_HBx_P-A Product feature CHAIN KP168427_HBx_P-A of FT:mat_peptide KP168427_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRXRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168428_HBx_P-A Product feature CHAIN KP168428_HBx_P-A of FT:mat_peptide KP168428_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KP168429_HBx_P-A Product feature CHAIN KP168429_HBx_P-A of FT:mat_peptide KP168429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168430_HBx_P-A Product feature CHAIN KP168430_HBx_P-A of FT:mat_peptide KP168430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KP168431_HBx_P-A Product feature CHAIN KP168431_HBx_P-A of FT:mat_peptide KP168431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPXCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KP168432_HBx_P-A Product feature CHAIN KP168432_HBx_P-A of FT:mat_peptide KP168432_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPICAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|KP168433_HBx_P-A Product feature CHAIN KP168433_HBx_P-A of FT:mat_peptide KP168433_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPICAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXXCNFFTSA
>gnl|hbvpro|KP168434_HBx_P-A Product feature CHAIN KP168434_HBx_P-A of FT:mat_peptide KP168434_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLARTLGSVSSPSPSTVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168435_HBx_P-A Product feature CHAIN KP168435_HBx_P-A of FT:mat_peptide KP168435_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDSSRDVLCLRSVGAESRGRPLSGPLGALSAPSPSAVPSDHGAHLSLRGLPVRSSSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP274925_HBx_P-A Product feature CHAIN KP274925_HBx_P-A of FT:mat_peptide KP274925_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP274927_HBx_P-A Product feature CHAIN KP274927_HBx_P-A of FT:mat_peptide KP274927_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP274928_HBx_P-A Product feature CHAIN KP274928_HBx_P-A of FT:mat_peptide KP274928_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718085_HBx_P-A Product feature CHAIN KP718085_HBx_P-A of FT:mat_peptide KP718085_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRXLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718086_HBx_P-A Product feature CHAIN KP718086_HBx_P-A of FT:mat_peptide KP718086_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKXTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718087_HBx_P-A Product feature CHAIN KP718087_HBx_P-A of FT:mat_peptide KP718087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718088_HBx_P-A Product feature CHAIN KP718088_HBx_P-A of FT:mat_peptide KP718088_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718089_HBx_P-A Product feature CHAIN KP718089_HBx_P-A of FT:mat_peptide KP718089_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718090_HBx_P-A Product feature CHAIN KP718090_HBx_P-A of FT:mat_peptide KP718090_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTXA
>gnl|hbvpro|KP718091_HBx_P-A Product feature CHAIN KP718091_HBx_P-A of FT:mat_peptide KP718091_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTXA
>gnl|hbvpro|KP718092_HBx_P-A Product feature CHAIN KP718092_HBx_P-A of FT:mat_peptide KP718092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718093_HBx_P-A Product feature CHAIN KP718093_HBx_P-A of FT:mat_peptide KP718093_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFYTSA
>gnl|hbvpro|KP718094_HBx_P-A Product feature CHAIN KP718094_HBx_P-A of FT:mat_peptide KP718094_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718095_HBx_P-A Product feature CHAIN KP718095_HBx_P-A of FT:mat_peptide KP718095_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718096_HBx_P-A Product feature CHAIN KP718096_HBx_P-A of FT:mat_peptide KP718096_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718097_HBx_P-A Product feature CHAIN KP718097_HBx_P-A of FT:mat_peptide KP718097_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718098_HBx_P-A Product feature CHAIN KP718098_HBx_P-A of FT:mat_peptide KP718098_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718099_HBx_P-A Product feature CHAIN KP718099_HBx_P-A of FT:mat_peptide KP718099_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718100_HBx_P-A Product feature CHAIN KP718100_HBx_P-A of FT:mat_peptide KP718100_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718101_HBx_P-A Product feature CHAIN KP718101_HBx_P-A of FT:mat_peptide KP718101_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718102_HBx_P-A Product feature CHAIN KP718102_HBx_P-A of FT:mat_peptide KP718102_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP12-1400). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALHFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP995108_HBx_P-A Product feature CHAIN KP995108_HBx_P-A of FT:mat_peptide KP995108_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAVLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR905425_HBx_P-A Product feature CHAIN KR905425_HBx_P-A of FT:mat_peptide KR905425_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905426_HBx_P-A Product feature CHAIN KR905426_HBx_P-A of FT:mat_peptide KR905426_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905427_HBx_P-A Product feature CHAIN KR905427_HBx_P-A of FT:mat_peptide KR905427_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHPVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905429_HBx_P-A Product feature CHAIN KR905429_HBx_P-A of FT:mat_peptide KR905429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLRLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905430_HBx_P-A Product feature CHAIN KR905430_HBx_P-A of FT:mat_peptide KR905430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905431_HBx_P-A Product feature CHAIN KR905431_HBx_P-A of FT:mat_peptide KR905431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151611_HBx_P-A Product feature CHAIN KT151611_HBx_P-A of FT:mat_peptide KT151611_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXSFGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTLNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151612_HBx_P-A Product feature CHAIN KT151612_HBx_P-A of FT:mat_peptide KT151612_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKMVCAPSSCNFFTSA
>gnl|hbvpro|KT151613_HBx_P-A Product feature CHAIN KT151613_HBx_P-A of FT:mat_peptide KT151613_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGBVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151614_HBx_P-A Product feature CHAIN KT151614_HBx_P-A of FT:mat_peptide KT151614_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLXAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT151615_HBx_P-A Product feature CHAIN KT151615_HBx_P-A of FT:mat_peptide KT151615_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLXKRTLGLSAMSTTDLEAYFKDCVFKDWEEXGEEIRLXXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151616_HBx_P-A Product feature CHAIN KT151616_HBx_P-A of FT:mat_peptide KT151616_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151617_HBx_P-A Product feature CHAIN KT151617_HBx_P-A of FT:mat_peptide KT151617_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSPXGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKMVCAPSSCNFFTSA
>gnl|hbvpro|KT151618_HBx_P-A Product feature CHAIN KT151618_HBx_P-A of FT:mat_peptide KT151618_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT347087_HBx_P-A Product feature CHAIN KT347087_HBx_P-A of FT:mat_peptide KT347087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT347088_HBx_P-A Product feature CHAIN KT347088_HBx_P-A of FT:mat_peptide KT347088_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT347091_HBx_P-A Product feature CHAIN KT347091_HBx_P-A of FT:mat_peptide KT347091_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHRILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT347092_HBx_P-A Product feature CHAIN KT347092_HBx_P-A of FT:mat_peptide KT347092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366466_HBx_P-A Product feature CHAIN KT366466_HBx_P-A of FT:mat_peptide KT366466_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366467_HBx_P-A Product feature CHAIN KT366467_HBx_P-A of FT:mat_peptide KT366467_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366468_HBx_P-A Product feature CHAIN KT366468_HBx_P-A of FT:mat_peptide KT366468_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366469_HBx_P-A Product feature CHAIN KT366469_HBx_P-A of FT:mat_peptide KT366469_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366470_HBx_P-A Product feature CHAIN KT366470_HBx_P-A of FT:mat_peptide KT366470_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366471_HBx_P-A Product feature CHAIN KT366471_HBx_P-A of FT:mat_peptide KT366471_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT749822_HBx_P-A Product feature CHAIN KT749822_HBx_P-A of FT:mat_peptide KT749822_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749824_HBx_P-A Product feature CHAIN KT749824_HBx_P-A of FT:mat_peptide KT749824_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749825_HBx_P-A Product feature CHAIN KT749825_HBx_P-A of FT:mat_peptide KT749825_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749826_HBx_P-A Product feature CHAIN KT749826_HBx_P-A of FT:mat_peptide KT749826_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749829_HBx_P-A Product feature CHAIN KT749829_HBx_P-A of FT:mat_peptide KT749829_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749830_HBx_P-A Product feature CHAIN KT749830_HBx_P-A of FT:mat_peptide KT749830_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749831_HBx_P-A Product feature CHAIN KT749831_HBx_P-A of FT:mat_peptide KT749831_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749832_HBx_P-A Product feature CHAIN KT749832_HBx_P-A of FT:mat_peptide KT749832_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749833_HBx_P-A Product feature CHAIN KT749833_HBx_P-A of FT:mat_peptide KT749833_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749834_HBx_P-A Product feature CHAIN KT749834_HBx_P-A of FT:mat_peptide KT749834_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749835_HBx_P-A Product feature CHAIN KT749835_HBx_P-A of FT:mat_peptide KT749835_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749836_HBx_P-A Product feature CHAIN KT749836_HBx_P-A of FT:mat_peptide KT749836_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749837_HBx_P-A Product feature CHAIN KT749837_HBx_P-A of FT:mat_peptide KT749837_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749838_HBx_P-A Product feature CHAIN KT749838_HBx_P-A of FT:mat_peptide KT749838_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749839_HBx_P-A Product feature CHAIN KT749839_HBx_P-A of FT:mat_peptide KT749839_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749840_HBx_P-A Product feature CHAIN KT749840_HBx_P-A of FT:mat_peptide KT749840_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TPVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749842_HBx_P-A Product feature CHAIN KT749842_HBx_P-A of FT:mat_peptide KT749842_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KT749843_HBx_P-A Product feature CHAIN KT749843_HBx_P-A of FT:mat_peptide KT749843_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749844_HBx_P-A Product feature CHAIN KT749844_HBx_P-A of FT:mat_peptide KT749844_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749846_HBx_P-A Product feature CHAIN KT749846_HBx_P-A of FT:mat_peptide KT749846_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749847_HBx_P-A Product feature CHAIN KT749847_HBx_P-A of FT:mat_peptide KT749847_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749849_HBx_P-A Product feature CHAIN KT749849_HBx_P-A of FT:mat_peptide KT749849_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749850_HBx_P-A Product feature CHAIN KT749850_HBx_P-A of FT:mat_peptide KT749850_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605532_HBx_P-A Product feature CHAIN KU605532_HBx_P-A of FT:mat_peptide KU605532_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605533_HBx_P-A Product feature CHAIN KU605533_HBx_P-A of FT:mat_peptide KU605533_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRSKVFVLGGCRHKLVCAPSSCKFFTSA
>gnl|hbvpro|KU605534_HBx_P-A Product feature CHAIN KU605534_HBx_P-A of FT:mat_peptide KU605534_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTGNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDSMFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KU605535_HBx_P-A Product feature CHAIN KU605535_HBx_P-A of FT:mat_peptide KU605535_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=153 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQLKLVCAPCNFFTSA
>gnl|hbvpro|KU605536_HBx_P-A Product feature CHAIN KU605536_HBx_P-A of FT:mat_peptide KU605536_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=153 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSRSPKFFTSA
>gnl|hbvpro|KU605537_HBx_P-A Product feature CHAIN KU605537_HBx_P-A of FT:mat_peptide KU605537_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605538_HBx_P-A Product feature CHAIN KU605538_HBx_P-A of FT:mat_peptide KU605538_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605539_HBx_P-A Product feature CHAIN KU605539_HBx_P-A of FT:mat_peptide KU605539_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736918_HBx_P-A Product feature CHAIN KU736918_HBx_P-A of FT:mat_peptide KU736918_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KU736919_HBx_P-A Product feature CHAIN KU736919_HBx_P-A of FT:mat_peptide KU736919_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KU736920_HBx_P-A Product feature CHAIN KU736920_HBx_P-A of FT:mat_peptide KU736920_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHGAHLSLXGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX276769_HBx_P-A Product feature CHAIN KX276769_HBx_P-A of FT:mat_peptide KX276769_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVXAESRGRPLAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357642_HBx_P-A Product feature CHAIN KX357642_HBx_P-A of FT:mat_peptide KX357642_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357643_HBx_P-A Product feature CHAIN KX357643_HBx_P-A of FT:mat_peptide KX357643_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357644_HBx_P-A Product feature CHAIN KX357644_HBx_P-A of FT:mat_peptide KX357644_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHRSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357645_HBx_P-A Product feature CHAIN KX357645_HBx_P-A of FT:mat_peptide KX357645_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357646_HBx_P-A Product feature CHAIN KX357646_HBx_P-A of FT:mat_peptide KX357646_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357647_HBx_P-A Product feature CHAIN KX357647_HBx_P-A of FT:mat_peptide KX357647_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSNHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHWILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357649_HBx_P-A Product feature CHAIN KX357649_HBx_P-A of FT:mat_peptide KX357649_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRSLARPLGSLSSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTIGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357650_HBx_P-A Product feature CHAIN KX357650_HBx_P-A of FT:mat_peptide KX357650_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA46ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRIKIFVLGGRRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX648547_HBx_P-A Product feature CHAIN KX648547_HBx_P-A of FT:mat_peptide KX648547_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX648548_HBx_P-A Product feature CHAIN KX648548_HBx_P-A of FT:mat_peptide KX648548_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX648549_HBx_P-A Product feature CHAIN KX648549_HBx_P-A of FT:mat_peptide KX648549_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX827293_HBx_P-A Product feature CHAIN KX827293_HBx_P-A of FT:mat_peptide KX827293_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827294_HBx_P-A Product feature CHAIN KX827294_HBx_P-A of FT:mat_peptide KX827294_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827295_HBx_P-A Product feature CHAIN KX827295_HBx_P-A of FT:mat_peptide KX827295_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827296_HBx_P-A Product feature CHAIN KX827296_HBx_P-A of FT:mat_peptide KX827296_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827297_HBx_P-A Product feature CHAIN KX827297_HBx_P-A of FT:mat_peptide KX827297_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827298_HBx_P-A Product feature CHAIN KX827298_HBx_P-A of FT:mat_peptide KX827298_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVSAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY003230_HBx_P-A Product feature CHAIN KY003230_HBx_P-A of FT:mat_peptide KY003230_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY382410_HBx_P-A Product feature CHAIN KY382410_HBx_P-A of FT:mat_peptide KY382410_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY886219_HBx_P-A Product feature CHAIN KY886219_HBx_P-A of FT:mat_peptide KY886219_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|L13994_HBx_P-A Product feature CHAIN L13994_HBx_P-A of FT:mat_peptide L13994_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MGARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVCVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC051141_HBx_P-A Product feature CHAIN LC051141_HBx_P-A of FT:mat_peptide LC051141_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|LC074724_HBx_P-A Product feature CHAIN LC074724_HBx_P-A of FT:mat_peptide LC074724_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC311241_HBx_P-A Product feature CHAIN LC311241_HBx_P-A of FT:mat_peptide LC311241_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC311242_HBx_P-A Product feature CHAIN LC311242_HBx_P-A of FT:mat_peptide LC311242_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC311243_HBx_P-A Product feature CHAIN LC311243_HBx_P-A of FT:mat_peptide LC311243_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC458430_HBx_P-A Product feature CHAIN LC458430_HBx_P-A of FT:mat_peptide LC458430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC458431_HBx_P-A Product feature CHAIN LC458431_HBx_P-A of FT:mat_peptide LC458431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LT992441_HBx_P-A Product feature CHAIN LT992441_HBx_P-A of FT:mat_peptide LT992441_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGFLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALHFTXARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|M57663_HBx_P-A Product feature CHAIN M57663_HBx_P-A of FT:mat_peptide M57663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
IAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|MF772344_HBx_P-A Product feature CHAIN MF772344_HBx_P-A of FT:mat_peptide MF772344_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772345_HBx_P-A Product feature CHAIN MF772345_HBx_P-A of FT:mat_peptide MF772345_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1959). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772346_HBx_P-A Product feature CHAIN MF772346_HBx_P-A of FT:mat_peptide MF772346_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFTSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772347_HBx_P-A Product feature CHAIN MF772347_HBx_P-A of FT:mat_peptide MF772347_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772348_HBx_P-A Product feature CHAIN MF772348_HBx_P-A of FT:mat_peptide MF772348_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772349_HBx_P-A Product feature CHAIN MF772349_HBx_P-A of FT:mat_peptide MF772349_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1840). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772350_HBx_P-A Product feature CHAIN MF772350_HBx_P-A of FT:mat_peptide MF772350_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCKHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772351_HBx_P-A Product feature CHAIN MF772351_HBx_P-A of FT:mat_peptide MF772351_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHLILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772353_HBx_P-A Product feature CHAIN MF772353_HBx_P-A of FT:mat_peptide MF772353_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925361_HBx_P-A Product feature CHAIN MF925361_HBx_P-A of FT:mat_peptide MF925361_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925362_HBx_P-A Product feature CHAIN MF925362_HBx_P-A of FT:mat_peptide MF925362_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV05). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925368_HBx_P-A Product feature CHAIN MF925368_HBx_P-A of FT:mat_peptide MF925368_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPALSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925372_HBx_P-A Product feature CHAIN MF925372_HBx_P-A of FT:mat_peptide MF925372_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSLSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925373_HBx_P-A Product feature CHAIN MF925373_HBx_P-A of FT:mat_peptide MF925373_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925385_HBx_P-A Product feature CHAIN MF925385_HBx_P-A of FT:mat_peptide MF925385_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925400_HBx_P-A Product feature CHAIN MF925400_HBx_P-A of FT:mat_peptide MF925400_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGDLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925407_HBx_P-A Product feature CHAIN MF925407_HBx_P-A of FT:mat_peptide MF925407_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464808_HBx_P-A Product feature CHAIN MH464808_HBx_P-A of FT:mat_peptide MH464808_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLTGPLXTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAXQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464809_HBx_P-A Product feature CHAIN MH464809_HBx_P-A of FT:mat_peptide MH464809_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA87). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVXVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464810_HBx_P-A Product feature CHAIN MH464810_HBx_P-A of FT:mat_peptide MH464810_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSXNFFTSA
>gnl|hbvpro|MH464811_HBx_P-A Product feature CHAIN MH464811_HBx_P-A of FT:mat_peptide MH464811_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA89). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARXME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|MH464812_HBx_P-A Product feature CHAIN MH464812_HBx_P-A of FT:mat_peptide MH464812_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA90). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVSSVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464813_HBx_P-A Product feature CHAIN MH464813_HBx_P-A of FT:mat_peptide MH464813_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464814_HBx_P-A Product feature CHAIN MH464814_HBx_P-A of FT:mat_peptide MH464814_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464815_HBx_P-A Product feature CHAIN MH464815_HBx_P-A of FT:mat_peptide MH464815_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464817_HBx_P-A Product feature CHAIN MH464817_HBx_P-A of FT:mat_peptide MH464817_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464818_HBx_P-A Product feature CHAIN MH464818_HBx_P-A of FT:mat_peptide MH464818_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464825_HBx_P-A Product feature CHAIN MH464825_HBx_P-A of FT:mat_peptide MH464825_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|MH464828_HBx_P-A Product feature CHAIN MH464828_HBx_P-A of FT:mat_peptide MH464828_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464830_HBx_P-A Product feature CHAIN MH464830_HBx_P-A of FT:mat_peptide MH464830_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH580627_HBx_P-A Product feature CHAIN MH580627_HBx_P-A of FT:mat_peptide MH580627_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH580639_HBx_P-A Product feature CHAIN MH580639_HBx_P-A of FT:mat_peptide MH580639_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH580642_HBx_P-A Product feature CHAIN MH580642_HBx_P-A of FT:mat_peptide MH580642_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH580643_HBx_P-A Product feature CHAIN MH580643_HBx_P-A of FT:mat_peptide MH580643_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH932713_HBx_P-A Product feature CHAIN MH932713_HBx_P-A of FT:mat_peptide MH932713_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK512456_HBx_P-A Product feature CHAIN MK512456_HBx_P-A of FT:mat_peptide MK512456_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVGAFSPAGPCALRVTSARCME
TTVNAHQSLPKVLHKRTLGLPAMATTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPYSCNFFTSA
>gnl|hbvpro|MK512457_HBx_P-A Product feature CHAIN MK512457_HBx_P-A of FT:mat_peptide MK512457_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPWSCNFFTSA
>gnl|hbvpro|MK512458_HBx_P-A Product feature CHAIN MK512458_HBx_P-A of FT:mat_peptide MK512458_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2244). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSTVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512459_HBx_P-A Product feature CHAIN MK512459_HBx_P-A of FT:mat_peptide MK512459_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2226). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512461_HBx_P-A Product feature CHAIN MK512461_HBx_P-A of FT:mat_peptide MK512461_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2157). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSLAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512462_HBx_P-A Product feature CHAIN MK512462_HBx_P-A of FT:mat_peptide MK512462_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSSNFFTSA
>gnl|hbvpro|MK512463_HBx_P-A Product feature CHAIN MK512463_HBx_P-A of FT:mat_peptide MK512463_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2086). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKYCVFKDWEELGEEIRLKVYVLGGCRHKLVCSPSSCNFFTSA
>gnl|hbvpro|MK512464_HBx_P-A Product feature CHAIN MK512464_HBx_P-A of FT:mat_peptide MK512464_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGSESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSPAGPCALRVTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGDEIRLMVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512465_HBx_P-A Product feature CHAIN MK512465_HBx_P-A of FT:mat_peptide MK512465_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSSSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLSIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512466_HBx_P-A Product feature CHAIN MK512466_HBx_P-A of FT:mat_peptide MK512466_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYLLRGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512468_HBx_P-A Product feature CHAIN MK512468_HBx_P-A of FT:mat_peptide MK512468_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-203). Complete genome. [Hepadnaviridae] (length=154 residues).
MAPRLLCQPDSSRDVLCLRPVGAESRGRPLQGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512469_HBx_P-A Product feature CHAIN MK512469_HBx_P-A of FT:mat_peptide MK512469_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-136). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYYQQDSSLDVLCLRSVGAESRARPLQVPPGTGSSPSPSAIPSYHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|MK512470_HBx_P-A Product feature CHAIN MK512470_HBx_P-A of FT:mat_peptide MK512470_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRHVGAESRGRPLQETLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGSCALRFTSARCMA
TNVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512471_HBx_P-A Product feature CHAIN MK512471_HBx_P-A of FT:mat_peptide MK512471_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGALGTLPSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512472_HBx_P-A Product feature CHAIN MK512472_HBx_P-A of FT:mat_peptide MK512472_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|MK512473_HBx_P-A Product feature CHAIN MK512473_HBx_P-A of FT:mat_peptide MK512473_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512474_HBx_P-A Product feature CHAIN MK512474_HBx_P-A of FT:mat_peptide MK512474_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512475_HBx_P-A Product feature CHAIN MK512475_HBx_P-A of FT:mat_peptide MK512475_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512476_HBx_P-A Product feature CHAIN MK512476_HBx_P-A of FT:mat_peptide MK512476_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512477_HBx_P-A Product feature CHAIN MK512477_HBx_P-A of FT:mat_peptide MK512477_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-03). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILRKVLHKRTLGLPAMSTTDREAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|V00866_HBx_P-A Product feature CHAIN V00866_HBx_P-A of FT:mat_peptide V00866_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X02763_HBx_C-A Product feature CHAIN X02763_HBx_C-A of FT:mat_peptide X02763_HBx_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X51970_HBx_P-A Product feature CHAIN X51970_HBx_P-A of FT:mat_peptide X51970_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MATRLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X70185_HBx_P-A Product feature CHAIN X70185_HBx_P-A of FT:mat_peptide X70185_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|Z35717_HBx_P-A Product feature CHAIN Z35717_HBx_P-A of FT:mat_peptide Z35717_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|Z72478_HBx_P-A Product feature CHAIN Z72478_HBx_P-A of FT:mat_peptide Z72478_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
© 1998-2019