HBVdb

Dataset for protein MHBs of genotype A

[Download (right click)] [Alignment] [Repertoires]

1463 sequence(s)

>gnl|hbvpro|AB014370_MHBs_P-A Product feature CHAIN AB014370_MHBs_P-A of FT:mat_peptide AB014370_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB064314_MHBs_P-A Product feature CHAIN AB064314_MHBs_P-A of FT:mat_peptide AB064314_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076678_MHBs_P-A Product feature CHAIN AB076678_MHBs_P-A of FT:mat_peptide AB076678_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076679_MHBs_P-A Product feature CHAIN AB076679_MHBs_P-A of FT:mat_peptide AB076679_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNFTAFQQALQDPRVRGIYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGVPPVCRGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076680_MHBs_P-A Product feature CHAIN AB076680_MHBs_P-A of FT:mat_peptide AB076680_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTVSHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076681_MHBs_P-A Product feature CHAIN AB076681_MHBs_P-A of FT:mat_peptide AB076681_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRDLCLPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076682_MHBs_P-A Product feature CHAIN AB076682_MHBs_P-A of FT:mat_peptide AB076682_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNLQQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076683_MHBs_P-A Product feature CHAIN AB076683_MHBs_P-A of FT:mat_peptide AB076683_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076685_MHBs_P-A Product feature CHAIN AB076685_MHBs_P-A of FT:mat_peptide AB076685_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPXLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLEGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIAGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LXPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076686_MHBs_P-A Product feature CHAIN AB076686_MHBs_P-A of FT:mat_peptide AB076686_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076687_MHBs_P-A Product feature CHAIN AB076687_MHBs_P-A of FT:mat_peptide AB076687_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTVFHQALQDPRVRGLYFPAGGSSSETLNPVPNIASHISSTSSRTGDPALNMENITSGFLRPLLVLQAGFFLLTRI
LTIPQNLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLQRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076688_MHBs_P-A Product feature CHAIN AB076688_MHBs_P-A of FT:mat_peptide AB076688_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076689_MHBs_P-A Product feature CHAIN AB076689_MHBs_P-A of FT:mat_peptide AB076689_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076690_MHBs_P-A Product feature CHAIN AB076690_MHBs_P-A of FT:mat_peptide AB076690_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116076_MHBs_P-A Product feature CHAIN AB116076_MHBs_P-A of FT:mat_peptide AB116076_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPKVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116077_MHBs_P-A Product feature CHAIN AB116077_MHBs_P-A of FT:mat_peptide AB116077_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCMTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQCFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116078_MHBs_P-A Product feature CHAIN AB116078_MHBs_P-A of FT:mat_peptide AB116078_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116079_MHBs_P-A Product feature CHAIN AB116079_MHBs_P-A of FT:mat_peptide AB116079_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116080_MHBs_P-A Product feature CHAIN AB116080_MHBs_P-A of FT:mat_peptide AB116080_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116081_MHBs_P-A Product feature CHAIN AB116081_MHBs_P-A of FT:mat_peptide AB116081_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116082_MHBs_P-A Product feature CHAIN AB116082_MHBs_P-A of FT:mat_peptide AB116082_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDTRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGLLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGRSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116083_MHBs_P-A Product feature CHAIN AB116083_MHBs_P-A of FT:mat_peptide AB116083_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYIPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116084_MHBs_P-A Product feature CHAIN AB116084_MHBs_P-A of FT:mat_peptide AB116084_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYIPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116085_MHBs_P-A Product feature CHAIN AB116085_MHBs_P-A of FT:mat_peptide AB116085_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAVHQALQDPRVRGLYIPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQLFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116086_MHBs_P-A Product feature CHAIN AB116086_MHBs_P-A of FT:mat_peptide AB116086_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSTTFHQALQDPRVRSLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116087_MHBs_P-A Product feature CHAIN AB116087_MHBs_P-A of FT:mat_peptide AB116087_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116088_MHBs_P-A Product feature CHAIN AB116088_MHBs_P-A of FT:mat_peptide AB116088_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPGCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWFWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB116089_MHBs_P-A Product feature CHAIN AB116089_MHBs_P-A of FT:mat_peptide AB116089_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116090_MHBs_P-A Product feature CHAIN AB116090_MHBs_P-A of FT:mat_peptide AB116090_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSRFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116091_MHBs_P-A Product feature CHAIN AB116091_MHBs_P-A of FT:mat_peptide AB116091_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFRQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116092_MHBs_P-A Product feature CHAIN AB116092_MHBs_P-A of FT:mat_peptide AB116092_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWGFAKFLWEWASVRFSCLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|AB116093_MHBs_P-A Product feature CHAIN AB116093_MHBs_P-A of FT:mat_peptide AB116093_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116094_MHBs_P-A Product feature CHAIN AB116094_MHBs_P-A of FT:mat_peptide AB116094_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFRQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCRTCTTPAQGNSTFPSCCCTKPTGGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTAWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB126580_MHBs_P-A Product feature CHAIN AB126580_MHBs_P-A of FT:mat_peptide AB126580_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=281 residues).
KQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVNPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194950_MHBs_P-A Product feature CHAIN AB194950_MHBs_P-A of FT:mat_peptide AB194950_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=281 residues).
IKWNSPAFHQALQDPRVKGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194951_MHBs_P-A Product feature CHAIN AB194951_MHBs_P-A of FT:mat_peptide AB194951_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFWLWAYI
>gnl|hbvpro|AB194952_MHBs_P-A Product feature CHAIN AB194952_MHBs_P-A of FT:mat_peptide AB194952_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTKFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRIGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205118_MHBs_P-A Product feature CHAIN AB205118_MHBs_P-A of FT:mat_peptide AB205118_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQEPRVRGPYLPAGGSSSGTVNPAPNIASHVSSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGPTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB222707_MHBs_P-A Product feature CHAIN AB222707_MHBs_P-A of FT:mat_peptide AB222707_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWAYI
>gnl|hbvpro|AB241114_MHBs_P-A Product feature CHAIN AB241114_MHBs_P-A of FT:mat_peptide AB241114_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRIRGLYFPAGGSTSGTVNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB241115_MHBs_P-A Product feature CHAIN AB241115_MHBs_P-A of FT:mat_peptide AB241115_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246335_MHBs_P-A Product feature CHAIN AB246335_MHBs_P-A of FT:mat_peptide AB246335_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRIRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246336_MHBs_P-A Product feature CHAIN AB246336_MHBs_P-A of FT:mat_peptide AB246336_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
VRWNSTTFHQTLQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB246337_MHBs_P-A Product feature CHAIN AB246337_MHBs_P-A of FT:mat_peptide AB246337_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246338_MHBs_P-A Product feature CHAIN AB246338_MHBs_P-A of FT:mat_peptide AB246338_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB263406_MHBs_P-A Product feature CHAIN AB263406_MHBs_P-A of FT:mat_peptide AB263406_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MonB04-023E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB300366_MHBs_P-A Product feature CHAIN AB300366_MHBs_P-A of FT:mat_peptide AB300366_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB300367_MHBs_P-A Product feature CHAIN AB300367_MHBs_P-A of FT:mat_peptide AB300367_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB362931_MHBs_P-A Product feature CHAIN AB362931_MHBs_P-A of FT:mat_peptide AB362931_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453979_MHBs_P-A Product feature CHAIN AB453979_MHBs_P-A of FT:mat_peptide AB453979_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453980_MHBs_P-A Product feature CHAIN AB453980_MHBs_P-A of FT:mat_peptide AB453980_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453981_MHBs_P-A Product feature CHAIN AB453981_MHBs_P-A of FT:mat_peptide AB453981_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453982_MHBs_P-A Product feature CHAIN AB453982_MHBs_P-A of FT:mat_peptide AB453982_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453983_MHBs_P-A Product feature CHAIN AB453983_MHBs_P-A of FT:mat_peptide AB453983_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGRSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453984_MHBs_P-A Product feature CHAIN AB453984_MHBs_P-A of FT:mat_peptide AB453984_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453986_MHBs_P-A Product feature CHAIN AB453986_MHBs_P-A of FT:mat_peptide AB453986_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSTSSRIGDPAANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGPPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453987_MHBs_P-A Product feature CHAIN AB453987_MHBs_P-A of FT:mat_peptide AB453987_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453988_MHBs_P-A Product feature CHAIN AB453988_MHBs_P-A of FT:mat_peptide AB453988_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGQSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|AB453989_MHBs_P-A Product feature CHAIN AB453989_MHBs_P-A of FT:mat_peptide AB453989_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLEGATVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480036_MHBs_P-A Product feature CHAIN AB480036_MHBs_P-A of FT:mat_peptide AB480036_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480038_MHBs_P-A Product feature CHAIN AB480038_MHBs_P-A of FT:mat_peptide AB480038_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480039_MHBs_P-A Product feature CHAIN AB480039_MHBs_P-A of FT:mat_peptide AB480039_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480040_MHBs_P-A Product feature CHAIN AB480040_MHBs_P-A of FT:mat_peptide AB480040_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYXPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480041_MHBs_P-A Product feature CHAIN AB480041_MHBs_P-A of FT:mat_peptide AB480041_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLMLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB549213_MHBs_P-A Product feature CHAIN AB549213_MHBs_P-A of FT:mat_peptide AB549213_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AB697487_MHBs_P-A Product feature CHAIN AB697487_MHBs_P-A of FT:mat_peptide AB697487_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLISGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697488_MHBs_P-A Product feature CHAIN AB697488_MHBs_P-A of FT:mat_peptide AB697488_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIXSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697489_MHBs_P-A Product feature CHAIN AB697489_MHBs_P-A of FT:mat_peptide AB697489_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697491_MHBs_P-A Product feature CHAIN AB697491_MHBs_P-A of FT:mat_peptide AB697491_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697492_MHBs_P-A Product feature CHAIN AB697492_MHBs_P-A of FT:mat_peptide AB697492_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697493_MHBs_P-A Product feature CHAIN AB697493_MHBs_P-A of FT:mat_peptide AB697493_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697495_MHBs_P-A Product feature CHAIN AB697495_MHBs_P-A of FT:mat_peptide AB697495_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697496_MHBs_P-A Product feature CHAIN AB697496_MHBs_P-A of FT:mat_peptide AB697496_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697497_MHBs_P-A Product feature CHAIN AB697497_MHBs_P-A of FT:mat_peptide AB697497_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697498_MHBs_P-A Product feature CHAIN AB697498_MHBs_P-A of FT:mat_peptide AB697498_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697499_MHBs_P-A Product feature CHAIN AB697499_MHBs_P-A of FT:mat_peptide AB697499_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697501_MHBs_P-A Product feature CHAIN AB697501_MHBs_P-A of FT:mat_peptide AB697501_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697503_MHBs_P-A Product feature CHAIN AB697503_MHBs_P-A of FT:mat_peptide AB697503_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697504_MHBs_P-A Product feature CHAIN AB697504_MHBs_P-A of FT:mat_peptide AB697504_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697505_MHBs_P-A Product feature CHAIN AB697505_MHBs_P-A of FT:mat_peptide AB697505_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697506_MHBs_P-A Product feature CHAIN AB697506_MHBs_P-A of FT:mat_peptide AB697506_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697507_MHBs_P-A Product feature CHAIN AB697507_MHBs_P-A of FT:mat_peptide AB697507_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697508_MHBs_P-A Product feature CHAIN AB697508_MHBs_P-A of FT:mat_peptide AB697508_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697509_MHBs_P-A Product feature CHAIN AB697509_MHBs_P-A of FT:mat_peptide AB697509_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697511_MHBs_P-A Product feature CHAIN AB697511_MHBs_P-A of FT:mat_peptide AB697511_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGIVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGXRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697512_MHBs_P-A Product feature CHAIN AB697512_MHBs_P-A of FT:mat_peptide AB697512_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775198_MHBs_P-A Product feature CHAIN AB775198_MHBs_P-A of FT:mat_peptide AB775198_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775199_MHBs_P-A Product feature CHAIN AB775199_MHBs_P-A of FT:mat_peptide AB775199_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775200_MHBs_P-A Product feature CHAIN AB775200_MHBs_P-A of FT:mat_peptide AB775200_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775201_MHBs_P-A Product feature CHAIN AB775201_MHBs_P-A of FT:mat_peptide AB775201_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786643_MHBs_P-A Product feature CHAIN AB786643_MHBs_P-A of FT:mat_peptide AB786643_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20401). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786645_MHBs_P-A Product feature CHAIN AB786645_MHBs_P-A of FT:mat_peptide AB786645_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20403). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786646_MHBs_P-A Product feature CHAIN AB786646_MHBs_P-A of FT:mat_peptide AB786646_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20404). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786647_MHBs_P-A Product feature CHAIN AB786647_MHBs_P-A of FT:mat_peptide AB786647_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20405). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786648_MHBs_P-A Product feature CHAIN AB786648_MHBs_P-A of FT:mat_peptide AB786648_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20406). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786649_MHBs_P-A Product feature CHAIN AB786649_MHBs_P-A of FT:mat_peptide AB786649_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20407). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786651_MHBs_P-A Product feature CHAIN AB786651_MHBs_P-A of FT:mat_peptide AB786651_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20409). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYF
>gnl|hbvpro|AB786652_MHBs_P-A Product feature CHAIN AB786652_MHBs_P-A of FT:mat_peptide AB786652_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20410). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786654_MHBs_P-A Product feature CHAIN AB786654_MHBs_P-A of FT:mat_peptide AB786654_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20412). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786655_MHBs_P-A Product feature CHAIN AB786655_MHBs_P-A of FT:mat_peptide AB786655_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20413). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786656_MHBs_P-A Product feature CHAIN AB786656_MHBs_P-A of FT:mat_peptide AB786656_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20417). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDLWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786657_MHBs_P-A Product feature CHAIN AB786657_MHBs_P-A of FT:mat_peptide AB786657_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20419). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786658_MHBs_P-A Product feature CHAIN AB786658_MHBs_P-A of FT:mat_peptide AB786658_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20420). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786659_MHBs_P-A Product feature CHAIN AB786659_MHBs_P-A of FT:mat_peptide AB786659_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20421). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786660_MHBs_P-A Product feature CHAIN AB786660_MHBs_P-A of FT:mat_peptide AB786660_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20422). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=280 residues).
WNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYIK
>gnl|hbvpro|AB786661_MHBs_P-A Product feature CHAIN AB786661_MHBs_P-A of FT:mat_peptide AB786661_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20425). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFSLLTRILT
IPQSLDSWWTSLNFLGGPAVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786662_MHBs_P-A Product feature CHAIN AB786662_MHBs_P-A of FT:mat_peptide AB786662_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20427). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786663_MHBs_P-A Product feature CHAIN AB786663_MHBs_P-A of FT:mat_peptide AB786663_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20429). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGPPVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937791_MHBs_P-A Product feature CHAIN AB937791_MHBs_P-A of FT:mat_peptide AB937791_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937792_MHBs_P-A Product feature CHAIN AB937792_MHBs_P-A of FT:mat_peptide AB937792_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937793_MHBs_P-A Product feature CHAIN AB937793_MHBs_P-A of FT:mat_peptide AB937793_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937794_MHBs_P-A Product feature CHAIN AB937794_MHBs_P-A of FT:mat_peptide AB937794_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937795_MHBs_P-A Product feature CHAIN AB937795_MHBs_P-A of FT:mat_peptide AB937795_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISLKTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLXPGSTTTSTGPCKTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937796_MHBs_P-A Product feature CHAIN AB937796_MHBs_P-A of FT:mat_peptide AB937796_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937797_MHBs_P-A Product feature CHAIN AB937797_MHBs_P-A of FT:mat_peptide AB937797_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYLPAGGSSSXTVNPAPNIASHISSXSARTGDPVTNMENITSGFLGPRLVLQAGFXLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPXICXGYRWMCLRRFIIFLFILPLCLIFLLVLLDYQGILP
VCPLIPGSTXNXTGXCKXCTXPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMILYWGPNLYSIVSPFILLLPIFFCLWVYI
>gnl|hbvpro|AB937798_MHBs_P-A Product feature CHAIN AB937798_MHBs_P-A of FT:mat_peptide AB937798_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF043560_MHBs_P-A Product feature CHAIN AF043560_MHBs_P-A of FT:mat_peptide AF043560_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF043580_MHBs_P-A Product feature CHAIN AF043580_MHBs_P-A of FT:mat_peptide AF043580_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090838_MHBs_P-A Product feature CHAIN AF090838_MHBs_P-A of FT:mat_peptide AF090838_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSETVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090839_MHBs_P-A Product feature CHAIN AF090839_MHBs_P-A of FT:mat_peptide AF090839_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090840_MHBs_P-A Product feature CHAIN AF090840_MHBs_P-A of FT:mat_peptide AF090840_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090841_MHBs_P-A Product feature CHAIN AF090841_MHBs_P-A of FT:mat_peptide AF090841_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQVLQDPRVRGLYFPAGGFSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090842_MHBs_P-A Product feature CHAIN AF090842_MHBs_P-A of FT:mat_peptide AF090842_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSILSPFIPVLPIFFCLWVYI
>gnl|hbvpro|AF143298_MHBs_P-A Product feature CHAIN AF143298_MHBs_P-A of FT:mat_peptide AF143298_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPTIASHISSISARTGDPVTNMENITSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297621_MHBs_P-A Product feature CHAIN AF297621_MHBs_P-A of FT:mat_peptide AF297621_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASLISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297622_MHBs_P-A Product feature CHAIN AF297622_MHBs_P-A of FT:mat_peptide AF297622_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNIENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWLVG
ISPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297624_MHBs_P-A Product feature CHAIN AF297624_MHBs_P-A of FT:mat_peptide AF297624_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297625_MHBs_P-A Product feature CHAIN AF297625_MHBs_P-A of FT:mat_peptide AF297625_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQYPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF536524_MHBs_P-A Product feature CHAIN AF536524_MHBs_P-A of FT:mat_peptide AF536524_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVFI
>gnl|hbvpro|AF537371_MHBs_P-A Product feature CHAIN AF537371_MHBs_P-A of FT:mat_peptide AF537371_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTEPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSTVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF537372_MHBs_P-A Product feature CHAIN AF537372_MHBs_P-A of FT:mat_peptide AF537372_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLRRI
LTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLMPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ012207_MHBs_P-A Product feature CHAIN AJ012207_MHBs_P-A of FT:mat_peptide AJ012207_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ309369_MHBs_P-A Product feature CHAIN AJ309369_MHBs_P-A of FT:mat_peptide AJ309369_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGPYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLGSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTGTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ309370_MHBs_P-A Product feature CHAIN AJ309370_MHBs_P-A of FT:mat_peptide AJ309370_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ309371_MHBs_P-A Product feature CHAIN AJ309371_MHBs_P-A of FT:mat_peptide AJ309371_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ344115_MHBs_P-A Product feature CHAIN AJ344115_MHBs_P-A of FT:mat_peptide AJ344115_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLRPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLP
VCPQTTRSTTTSTGSCKTCTIPARGKSMFPSCCCTKPTDGNCTCIPIPSSWAFASYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ627227_MHBs_P-A Product feature CHAIN AJ627227_MHBs_P-A of FT:mat_peptide AJ627227_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LIIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSXIWMMWXWGPDLYSIVRPFXPLLPIFFCLWVYI
>gnl|hbvpro|AM180624_MHBs_P-A Product feature CHAIN AM180624_MHBs_P-A of FT:mat_peptide AM180624_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLKPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLX
VCPLIPGSXTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AM184125_MHBs_P-A Product feature CHAIN AM184125_MHBs_P-A of FT:mat_peptide AM184125_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTVSPVQNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM184126_MHBs_P-A Product feature CHAIN AM184126_MHBs_P-A of FT:mat_peptide AM184126_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM282986_MHBs_P-A Product feature CHAIN AM282986_MHBs_P-A of FT:mat_peptide AM282986_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295795_MHBs_P-A Product feature CHAIN AM295795_MHBs_P-A of FT:mat_peptide AM295795_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295797_MHBs_P-A Product feature CHAIN AM295797_MHBs_P-A of FT:mat_peptide AM295797_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295798_MHBs_P-A Product feature CHAIN AM295798_MHBs_P-A of FT:mat_peptide AM295798_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295799_MHBs_P-A Product feature CHAIN AM295799_MHBs_P-A of FT:mat_peptide AM295799_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM410963_MHBs_P-A Product feature CHAIN AM410963_MHBs_P-A of FT:mat_peptide AM410963_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494718_MHBs_P-A Product feature CHAIN AM494718_MHBs_P-A of FT:mat_peptide AM494718_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY034878_MHBs_P-A Product feature CHAIN AY034878_MHBs_P-A of FT:mat_peptide AY034878_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY128092_MHBs_P-A Product feature CHAIN AY128092_MHBs_P-A of FT:mat_peptide AY128092_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY152726_MHBs_P-A Product feature CHAIN AY152726_MHBs_P-A of FT:mat_peptide AY152726_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAQNIASHISSISARTGDPVTNMENITSGFLEPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLMPGSTTTSTGPCKTCTTPAQGNSTLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY161138_MHBs_P-A Product feature CHAIN AY161138_MHBs_P-A of FT:mat_peptide AY161138_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=282 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLVLCLIFLLVLLDYQGML
LVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFV
GLSPTVWLSAMWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY161139_MHBs_P-A Product feature CHAIN AY161139_MHBs_P-A of FT:mat_peptide AY161139_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY230117_MHBs_P-A Product feature CHAIN AY230117_MHBs_P-A of FT:mat_peptide AY230117_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPNLCNIVRPFIPLLSIFCCLWVYI
>gnl|hbvpro|AY230118_MHBs_P-A Product feature CHAIN AY230118_MHBs_P-A of FT:mat_peptide AY230118_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY232836_MHBs_P-A Product feature CHAIN AY232836_MHBs_P-A of FT:mat_peptide AY232836_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISAWTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLQIFCCLWVFI
>gnl|hbvpro|AY232837_MHBs_P-A Product feature CHAIN AY232837_MHBs_P-A of FT:mat_peptide AY232837_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAHVCLGQNSQSPTSNHSPTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLLVLLEYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPNLFSIARPCIPLLPIFLCPWVYI
>gnl|hbvpro|AY232838_MHBs_P-A Product feature CHAIN AY232838_MHBs_P-A of FT:mat_peptide AY232838_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISAWTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLQIFCCLWVFI
>gnl|hbvpro|AY232839_MHBs_P-A Product feature CHAIN AY232839_MHBs_P-A of FT:mat_peptide AY232839_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVCPFTPLLQIFCCLWVFI
>gnl|hbvpro|AY232840_MHBs_P-A Product feature CHAIN AY232840_MHBs_P-A of FT:mat_peptide AY232840_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFTPLLQIFCCLWVFI
>gnl|hbvpro|AY233274_MHBs_P-A Product feature CHAIN AY233274_MHBs_P-A of FT:mat_peptide AY233274_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISPISSRTGDPAWNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233275_MHBs_P-A Product feature CHAIN AY233275_MHBs_P-A of FT:mat_peptide AY233275_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTHNPVPNIASHISSISSKTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233276_MHBs_P-A Product feature CHAIN AY233276_MHBs_P-A of FT:mat_peptide AY233276_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233278_MHBs_P-A Product feature CHAIN AY233278_MHBs_P-A of FT:mat_peptide AY233278_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVQNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233279_MHBs_P-A Product feature CHAIN AY233279_MHBs_P-A of FT:mat_peptide AY233279_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233280_MHBs_P-A Product feature CHAIN AY233280_MHBs_P-A of FT:mat_peptide AY233280_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMRLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233281_MHBs_P-A Product feature CHAIN AY233281_MHBs_P-A of FT:mat_peptide AY233281_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTHNPVPNIASHISPISSKTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQNNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233282_MHBs_P-A Product feature CHAIN AY233282_MHBs_P-A of FT:mat_peptide AY233282_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFVIFLFILLLCLIFLLVLLDYQGILP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233283_MHBs_P-A Product feature CHAIN AY233283_MHBs_P-A of FT:mat_peptide AY233283_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRIGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233284_MHBs_P-A Product feature CHAIN AY233284_MHBs_P-A of FT:mat_peptide AY233284_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTHNPVPNIASHISSISSKTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233285_MHBs_P-A Product feature CHAIN AY233285_MHBs_P-A of FT:mat_peptide AY233285_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNPTAFHQALQDPRVRGLYFPAGGSSSGPLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPRKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233286_MHBs_P-A Product feature CHAIN AY233286_MHBs_P-A of FT:mat_peptide AY233286_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLRPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTTPTDGNCTCIPIPSSWTFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPAVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233287_MHBs_P-A Product feature CHAIN AY233287_MHBs_P-A of FT:mat_peptide AY233287_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRIGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSRPPICPGYRGMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWVSVRFSWLSLLVPFVQWFVG
LSPTAWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233288_MHBs_P-A Product feature CHAIN AY233288_MHBs_P-A of FT:mat_peptide AY233288_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIAFHISSISSRIGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233289_MHBs_P-A Product feature CHAIN AY233289_MHBs_P-A of FT:mat_peptide AY233289_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233290_MHBs_P-A Product feature CHAIN AY233290_MHBs_P-A of FT:mat_peptide AY233290_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFPGGPPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY373428_MHBs_P-A Product feature CHAIN AY373428_MHBs_P-A of FT:mat_peptide AY373428_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFYLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY373429_MHBs_P-A Product feature CHAIN AY373429_MHBs_P-A of FT:mat_peptide AY373429_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTTASHISSISSRIGDPAPNMDNITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSGIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY373432_MHBs_P-A Product feature CHAIN AY373432_MHBs_P-A of FT:mat_peptide AY373432_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQNPKDRGLYLPAGGSSSGTLNPVPTIASHISSISSRIGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AY707087_MHBs_P-A Product feature CHAIN AY707087_MHBs_P-A of FT:mat_peptide AY707087_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738139_MHBs_P-A Product feature CHAIN AY738139_MHBs_P-A of FT:mat_peptide AY738139_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITLGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLA
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWELASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738140_MHBs_P-A Product feature CHAIN AY738140_MHBs_P-A of FT:mat_peptide AY738140_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLSFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDSQSMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWELASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738141_MHBs_P-A Product feature CHAIN AY738141_MHBs_P-A of FT:mat_peptide AY738141_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLSFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDSQNMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWELASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738142_MHBs_P-A Product feature CHAIN AY738142_MHBs_P-A of FT:mat_peptide AY738142_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLSFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDSQSMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWELASVRFSWLSLLVPFVQWFVG
PSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738143_MHBs_P-A Product feature CHAIN AY738143_MHBs_P-A of FT:mat_peptide AY738143_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITLGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLA
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWELASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY862867_MHBs_P-A Product feature CHAIN AY862867_MHBs_P-A of FT:mat_peptide AY862867_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY862868_MHBs_P-A Product feature CHAIN AY862868_MHBs_P-A of FT:mat_peptide AY862868_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY902775_MHBs_P-A Product feature CHAIN AY902775_MHBs_P-A of FT:mat_peptide AY902775_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY903452_MHBs_P-A Product feature CHAIN AY903452_MHBs_P-A of FT:mat_peptide AY903452_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934763_MHBs_P-A Product feature CHAIN AY934763_MHBs_P-A of FT:mat_peptide AY934763_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRSCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFGKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934764_MHBs_P-A Product feature CHAIN AY934764_MHBs_P-A of FT:mat_peptide AY934764_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGIVNPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVW
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934765_MHBs_P-A Product feature CHAIN AY934765_MHBs_P-A of FT:mat_peptide AY934765_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934766_MHBs_P-A Product feature CHAIN AY934766_MHBs_P-A of FT:mat_peptide AY934766_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAANMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934767_MHBs_P-A Product feature CHAIN AY934767_MHBs_P-A of FT:mat_peptide AY934767_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934768_MHBs_P-A Product feature CHAIN AY934768_MHBs_P-A of FT:mat_peptide AY934768_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMVPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934769_MHBs_P-A Product feature CHAIN AY934769_MHBs_P-A of FT:mat_peptide AY934769_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934770_MHBs_P-A Product feature CHAIN AY934770_MHBs_P-A of FT:mat_peptide AY934770_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPSIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934771_MHBs_P-A Product feature CHAIN AY934771_MHBs_P-A of FT:mat_peptide AY934771_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934772_MHBs_P-A Product feature CHAIN AY934772_MHBs_P-A of FT:mat_peptide AY934772_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934773_MHBs_P-A Product feature CHAIN AY934773_MHBs_P-A of FT:mat_peptide AY934773_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMDNITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934774_MHBs_P-A Product feature CHAIN AY934774_MHBs_P-A of FT:mat_peptide AY934774_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ020002_MHBs_P-A Product feature CHAIN DQ020002_MHBs_P-A of FT:mat_peptide DQ020002_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ020003_MHBs_P-A Product feature CHAIN DQ020003_MHBs_P-A of FT:mat_peptide DQ020003_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ131121_MHBs_P-A Product feature CHAIN DQ131121_MHBs_P-A of FT:mat_peptide DQ131121_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLVPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ298161_MHBs_P-A Product feature CHAIN DQ298161_MHBs_P-A of FT:mat_peptide DQ298161_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSIAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
PTIPQSLDSWWTSLSFLGEAPVCPGQNSQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ298162_MHBs_P-A Product feature CHAIN DQ298162_MHBs_P-A of FT:mat_peptide DQ298162_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPNLCNIVRPFIPLLSIFCCLWVYI
>gnl|hbvpro|DQ298163_MHBs_P-A Product feature CHAIN DQ298163_MHBs_P-A of FT:mat_peptide DQ298163_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFTPLLQIFCCLWVFI
>gnl|hbvpro|DQ298164_MHBs_P-A Product feature CHAIN DQ298164_MHBs_P-A of FT:mat_peptide DQ298164_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVRNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLQIFCCLWVFI
>gnl|hbvpro|DQ298165_MHBs_P-A Product feature CHAIN DQ298165_MHBs_P-A of FT:mat_peptide DQ298165_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTRNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVCPFTPLLQIFCCLWVFI
>gnl|hbvpro|DQ788725_MHBs_P-A Product feature CHAIN DQ788725_MHBs_P-A of FT:mat_peptide DQ788725_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAVHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCPIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF103278_MHBs_P-A Product feature CHAIN EF103278_MHBs_P-A of FT:mat_peptide EF103278_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRLSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSHFIPLLPIFFCLWVYI
>gnl|hbvpro|EF208113_MHBs_P-A Product feature CHAIN EF208113_MHBs_P-A of FT:mat_peptide EF208113_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSTVSPFILLLPIFFCLWVYI
>gnl|hbvpro|EU054331_MHBs_C-A Product feature CHAIN EU054331_MHBs_C-A of FT:mat_peptide EU054331_MHBs_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGCSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVRWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU086721_MHBs_P-A Product feature CHAIN EU086721_MHBs_P-A of FT:mat_peptide EU086721_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU159676_MHBs_P-A Product feature CHAIN EU159676_MHBs_P-A of FT:mat_peptide EU159676_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Irish-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU185787_MHBs_P-A Product feature CHAIN EU185787_MHBs_P-A of FT:mat_peptide EU185787_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPXNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGILP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGXCTCXXIPSSWAXAKYLWEWGSARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLXSIVSXFIPLLPIFFCLWVYI
>gnl|hbvpro|EU185788_MHBs_P-A Product feature CHAIN EU185788_MHBs_P-A of FT:mat_peptide EU185788_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU19). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQXLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGILP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGXCTCXXIPSSWAXAKYLWEWGSARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSXFIPLLPIFFCLWVYI
>gnl|hbvpro|EU185789_MHBs_P-A Product feature CHAIN EU185789_MHBs_P-A of FT:mat_peptide EU185789_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTXDPVTNMENIXSGLLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGILP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGXCTCXXXPSSWAXAKYLWEWGSARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSXFIPLLPIFFCLWVYI
>gnl|hbvpro|EU366129_MHBs_P-A Product feature CHAIN EU366129_MHBs_P-A of FT:mat_peptide EU366129_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPNLLNTLKPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU410082_MHBs_P-A Product feature CHAIN EU410082_MHBs_P-A of FT:mat_peptide EU410082_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU414132_MHBs_P-A Product feature CHAIN EU414132_MHBs_P-A of FT:mat_peptide EU414132_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU414133_MHBs_P-A Product feature CHAIN EU414133_MHBs_P-A of FT:mat_peptide EU414133_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594383_MHBs_P-A Product feature CHAIN EU594383_MHBs_P-A of FT:mat_peptide EU594383_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594384_MHBs_P-A Product feature CHAIN EU594384_MHBs_P-A of FT:mat_peptide EU594384_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594385_MHBs_P-A Product feature CHAIN EU594385_MHBs_P-A of FT:mat_peptide EU594385_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594386_MHBs_P-A Product feature CHAIN EU594386_MHBs_P-A of FT:mat_peptide EU594386_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVFLDYQGMLP
VCPIIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594387_MHBs_P-A Product feature CHAIN EU594387_MHBs_P-A of FT:mat_peptide EU594387_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594388_MHBs_P-A Product feature CHAIN EU594388_MHBs_P-A of FT:mat_peptide EU594388_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594389_MHBs_P-A Product feature CHAIN EU594389_MHBs_P-A of FT:mat_peptide EU594389_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594390_MHBs_P-A Product feature CHAIN EU594390_MHBs_P-A of FT:mat_peptide EU594390_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594391_MHBs_P-A Product feature CHAIN EU594391_MHBs_P-A of FT:mat_peptide EU594391_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594392_MHBs_P-A Product feature CHAIN EU594392_MHBs_P-A of FT:mat_peptide EU594392_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594393_MHBs_P-A Product feature CHAIN EU594393_MHBs_P-A of FT:mat_peptide EU594393_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594394_MHBs_P-A Product feature CHAIN EU594394_MHBs_P-A of FT:mat_peptide EU594394_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594395_MHBs_P-A Product feature CHAIN EU594395_MHBs_P-A of FT:mat_peptide EU594395_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU747320_MHBs_P-A Product feature CHAIN EU747320_MHBs_P-A of FT:mat_peptide EU747320_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V51). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQILDSWWNSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859898_MHBs_P-A Product feature CHAIN EU859898_MHBs_P-A of FT:mat_peptide EU859898_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859899_MHBs_P-A Product feature CHAIN EU859899_MHBs_P-A of FT:mat_peptide EU859899_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859900_MHBs_P-A Product feature CHAIN EU859900_MHBs_P-A of FT:mat_peptide EU859900_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLRGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859901_MHBs_P-A Product feature CHAIN EU859901_MHBs_P-A of FT:mat_peptide EU859901_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859902_MHBs_P-A Product feature CHAIN EU859902_MHBs_P-A of FT:mat_peptide EU859902_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859903_MHBs_P-A Product feature CHAIN EU859903_MHBs_P-A of FT:mat_peptide EU859903_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859904_MHBs_P-A Product feature CHAIN EU859904_MHBs_P-A of FT:mat_peptide EU859904_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859905_MHBs_P-A Product feature CHAIN EU859905_MHBs_P-A of FT:mat_peptide EU859905_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859906_MHBs_P-A Product feature CHAIN EU859906_MHBs_P-A of FT:mat_peptide EU859906_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859907_MHBs_P-A Product feature CHAIN EU859907_MHBs_P-A of FT:mat_peptide EU859907_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRDLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859908_MHBs_P-A Product feature CHAIN EU859908_MHBs_P-A of FT:mat_peptide EU859908_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859909_MHBs_P-A Product feature CHAIN EU859909_MHBs_P-A of FT:mat_peptide EU859909_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859910_MHBs_P-A Product feature CHAIN EU859910_MHBs_P-A of FT:mat_peptide EU859910_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859911_MHBs_P-A Product feature CHAIN EU859911_MHBs_P-A of FT:mat_peptide EU859911_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859912_MHBs_P-A Product feature CHAIN EU859912_MHBs_P-A of FT:mat_peptide EU859912_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859913_MHBs_P-A Product feature CHAIN EU859913_MHBs_P-A of FT:mat_peptide EU859913_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859914_MHBs_P-A Product feature CHAIN EU859914_MHBs_P-A of FT:mat_peptide EU859914_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859915_MHBs_P-A Product feature CHAIN EU859915_MHBs_P-A of FT:mat_peptide EU859915_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859916_MHBs_P-A Product feature CHAIN EU859916_MHBs_P-A of FT:mat_peptide EU859916_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859917_MHBs_P-A Product feature CHAIN EU859917_MHBs_P-A of FT:mat_peptide EU859917_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859918_MHBs_P-A Product feature CHAIN EU859918_MHBs_P-A of FT:mat_peptide EU859918_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859919_MHBs_P-A Product feature CHAIN EU859919_MHBs_P-A of FT:mat_peptide EU859919_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859920_MHBs_P-A Product feature CHAIN EU859920_MHBs_P-A of FT:mat_peptide EU859920_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859921_MHBs_P-A Product feature CHAIN EU859921_MHBs_P-A of FT:mat_peptide EU859921_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTFNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859922_MHBs_P-A Product feature CHAIN EU859922_MHBs_P-A of FT:mat_peptide EU859922_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859923_MHBs_P-A Product feature CHAIN EU859923_MHBs_P-A of FT:mat_peptide EU859923_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859924_MHBs_P-A Product feature CHAIN EU859924_MHBs_P-A of FT:mat_peptide EU859924_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859925_MHBs_P-A Product feature CHAIN EU859925_MHBs_P-A of FT:mat_peptide EU859925_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859926_MHBs_P-A Product feature CHAIN EU859926_MHBs_P-A of FT:mat_peptide EU859926_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859927_MHBs_P-A Product feature CHAIN EU859927_MHBs_P-A of FT:mat_peptide EU859927_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859928_MHBs_P-A Product feature CHAIN EU859928_MHBs_P-A of FT:mat_peptide EU859928_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859929_MHBs_P-A Product feature CHAIN EU859929_MHBs_P-A of FT:mat_peptide EU859929_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859930_MHBs_P-A Product feature CHAIN EU859930_MHBs_P-A of FT:mat_peptide EU859930_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859931_MHBs_P-A Product feature CHAIN EU859931_MHBs_P-A of FT:mat_peptide EU859931_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859932_MHBs_P-A Product feature CHAIN EU859932_MHBs_P-A of FT:mat_peptide EU859932_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859933_MHBs_P-A Product feature CHAIN EU859933_MHBs_P-A of FT:mat_peptide EU859933_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859934_MHBs_P-A Product feature CHAIN EU859934_MHBs_P-A of FT:mat_peptide EU859934_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDANCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859935_MHBs_P-A Product feature CHAIN EU859935_MHBs_P-A of FT:mat_peptide EU859935_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859936_MHBs_P-A Product feature CHAIN EU859936_MHBs_P-A of FT:mat_peptide EU859936_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859937_MHBs_P-A Product feature CHAIN EU859937_MHBs_P-A of FT:mat_peptide EU859937_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859938_MHBs_P-A Product feature CHAIN EU859938_MHBs_P-A of FT:mat_peptide EU859938_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859939_MHBs_P-A Product feature CHAIN EU859939_MHBs_P-A of FT:mat_peptide EU859939_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859940_MHBs_P-A Product feature CHAIN EU859940_MHBs_P-A of FT:mat_peptide EU859940_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859941_MHBs_P-A Product feature CHAIN EU859941_MHBs_P-A of FT:mat_peptide EU859941_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859942_MHBs_P-A Product feature CHAIN EU859942_MHBs_P-A of FT:mat_peptide EU859942_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859943_MHBs_P-A Product feature CHAIN EU859943_MHBs_P-A of FT:mat_peptide EU859943_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859944_MHBs_P-A Product feature CHAIN EU859944_MHBs_P-A of FT:mat_peptide EU859944_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859945_MHBs_P-A Product feature CHAIN EU859945_MHBs_P-A of FT:mat_peptide EU859945_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859946_MHBs_P-A Product feature CHAIN EU859946_MHBs_P-A of FT:mat_peptide EU859946_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859947_MHBs_P-A Product feature CHAIN EU859947_MHBs_P-A of FT:mat_peptide EU859947_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859948_MHBs_P-A Product feature CHAIN EU859948_MHBs_P-A of FT:mat_peptide EU859948_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859949_MHBs_P-A Product feature CHAIN EU859949_MHBs_P-A of FT:mat_peptide EU859949_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859951_MHBs_P-A Product feature CHAIN EU859951_MHBs_P-A of FT:mat_peptide EU859951_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859952_MHBs_P-A Product feature CHAIN EU859952_MHBs_P-A of FT:mat_peptide EU859952_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVQNIASHISSISSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859953_MHBs_P-A Product feature CHAIN EU859953_MHBs_P-A of FT:mat_peptide EU859953_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFSLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859954_MHBs_P-A Product feature CHAIN EU859954_MHBs_P-A of FT:mat_peptide EU859954_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859955_MHBs_P-A Product feature CHAIN EU859955_MHBs_P-A of FT:mat_peptide EU859955_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSSSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859956_MHBs_P-A Product feature CHAIN EU859956_MHBs_P-A of FT:mat_peptide EU859956_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSSSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349224_MHBs_P-A Product feature CHAIN FJ349224_MHBs_P-A of FT:mat_peptide FJ349224_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349296_MHBs_P-A Product feature CHAIN FJ349296_MHBs_P-A of FT:mat_peptide FJ349296_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692554_MHBs_P-A Product feature CHAIN FJ692554_MHBs_P-A of FT:mat_peptide FJ692554_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKSCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FJ692557_MHBs_P-A Product feature CHAIN FJ692557_MHBs_P-A of FT:mat_peptide FJ692557_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692558_MHBs_P-A Product feature CHAIN FJ692558_MHBs_P-A of FT:mat_peptide FJ692558_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=281 residues).
LXWNSTALHXTQQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISARTGDPALNMENITSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLXIFFXLWVYI
>gnl|hbvpro|FJ692559_MHBs_P-A Product feature CHAIN FJ692559_MHBs_P-A of FT:mat_peptide FJ692559_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692561_MHBs_P-A Product feature CHAIN FJ692561_MHBs_P-A of FT:mat_peptide FJ692561_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692562_MHBs_P-A Product feature CHAIN FJ692562_MHBs_P-A of FT:mat_peptide FJ692562_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYFPAGGSSSKILNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692563_MHBs_P-A Product feature CHAIN FJ692563_MHBs_P-A of FT:mat_peptide FJ692563_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|FJ692564_MHBs_P-A Product feature CHAIN FJ692564_MHBs_P-A of FT:mat_peptide FJ692564_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692565_MHBs_P-A Product feature CHAIN FJ692565_MHBs_P-A of FT:mat_peptide FJ692565_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|FJ692566_MHBs_P-A Product feature CHAIN FJ692566_MHBs_P-A of FT:mat_peptide FJ692566_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPHIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692567_MHBs_P-A Product feature CHAIN FJ692567_MHBs_P-A of FT:mat_peptide FJ692567_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692571_MHBs_P-A Product feature CHAIN FJ692571_MHBs_P-A of FT:mat_peptide FJ692571_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692572_MHBs_P-A Product feature CHAIN FJ692572_MHBs_P-A of FT:mat_peptide FJ692572_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50013). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSXXPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692574_MHBs_P-A Product feature CHAIN FJ692574_MHBs_P-A of FT:mat_peptide FJ692574_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692575_MHBs_P-A Product feature CHAIN FJ692575_MHBs_P-A of FT:mat_peptide FJ692575_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTAFHQALQDPKVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSAIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692576_MHBs_P-A Product feature CHAIN FJ692576_MHBs_P-A of FT:mat_peptide FJ692576_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQXLQDPRXRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPKLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|FJ692577_MHBs_P-A Product feature CHAIN FJ692577_MHBs_P-A of FT:mat_peptide FJ692577_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLXNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692578_MHBs_P-A Product feature CHAIN FJ692578_MHBs_P-A of FT:mat_peptide FJ692578_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692579_MHBs_P-A Product feature CHAIN FJ692579_MHBs_P-A of FT:mat_peptide FJ692579_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692580_MHBs_P-A Product feature CHAIN FJ692580_MHBs_P-A of FT:mat_peptide FJ692580_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692581_MHBs_P-A Product feature CHAIN FJ692581_MHBs_P-A of FT:mat_peptide FJ692581_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692582_MHBs_P-A Product feature CHAIN FJ692582_MHBs_P-A of FT:mat_peptide FJ692582_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692583_MHBs_P-A Product feature CHAIN FJ692583_MHBs_P-A of FT:mat_peptide FJ692583_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692584_MHBs_P-A Product feature CHAIN FJ692584_MHBs_P-A of FT:mat_peptide FJ692584_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692585_MHBs_P-A Product feature CHAIN FJ692585_MHBs_P-A of FT:mat_peptide FJ692585_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692588_MHBs_P-A Product feature CHAIN FJ692588_MHBs_P-A of FT:mat_peptide FJ692588_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHNSSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692590_MHBs_P-A Product feature CHAIN FJ692590_MHBs_P-A of FT:mat_peptide FJ692590_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692591_MHBs_P-A Product feature CHAIN FJ692591_MHBs_P-A of FT:mat_peptide FJ692591_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTXFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692592_MHBs_P-A Product feature CHAIN FJ692592_MHBs_P-A of FT:mat_peptide FJ692592_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRALYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692595_MHBs_P-A Product feature CHAIN FJ692595_MHBs_P-A of FT:mat_peptide FJ692595_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTAFHXALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692596_MHBs_P-A Product feature CHAIN FJ692596_MHBs_P-A of FT:mat_peptide FJ692596_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692597_MHBs_P-A Product feature CHAIN FJ692597_MHBs_P-A of FT:mat_peptide FJ692597_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692598_MHBs_P-A Product feature CHAIN FJ692598_MHBs_P-A of FT:mat_peptide FJ692598_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692599_MHBs_P-A Product feature CHAIN FJ692599_MHBs_P-A of FT:mat_peptide FJ692599_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAQTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692600_MHBs_P-A Product feature CHAIN FJ692600_MHBs_P-A of FT:mat_peptide FJ692600_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692601_MHBs_P-A Product feature CHAIN FJ692601_MHBs_P-A of FT:mat_peptide FJ692601_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692602_MHBs_P-A Product feature CHAIN FJ692602_MHBs_P-A of FT:mat_peptide FJ692602_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692603_MHBs_P-A Product feature CHAIN FJ692603_MHBs_P-A of FT:mat_peptide FJ692603_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQXLQDPRVRXLCLPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWLTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692604_MHBs_P-A Product feature CHAIN FJ692604_MHBs_P-A of FT:mat_peptide FJ692604_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692605_MHBs_P-A Product feature CHAIN FJ692605_MHBs_P-A of FT:mat_peptide FJ692605_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHILSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFXGXSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692606_MHBs_P-A Product feature CHAIN FJ692606_MHBs_P-A of FT:mat_peptide FJ692606_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPVFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFXXPPLVLQAGSFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTXSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692607_MHBs_P-A Product feature CHAIN FJ692607_MHBs_P-A of FT:mat_peptide FJ692607_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAQTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692608_MHBs_P-A Product feature CHAIN FJ692608_MHBs_P-A of FT:mat_peptide FJ692608_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHTSSISSRTGDPVPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692609_MHBs_P-A Product feature CHAIN FJ692609_MHBs_P-A of FT:mat_peptide FJ692609_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGSLGPLLVLQAGFFLWTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692610_MHBs_P-A Product feature CHAIN FJ692610_MHBs_P-A of FT:mat_peptide FJ692610_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGSLGPLLVLQAGFFLWTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692611_MHBs_P-A Product feature CHAIN FJ692611_MHBs_P-A of FT:mat_peptide FJ692611_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTAFHQALQDPTVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLIRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692612_MHBs_P-A Product feature CHAIN FJ692612_MHBs_P-A of FT:mat_peptide FJ692612_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAQTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|FJ692613_MHBs_P-A Product feature CHAIN FJ692613_MHBs_P-A of FT:mat_peptide FJ692613_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSILPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNIVRPFMPLLPIFFCLWAYI
>gnl|hbvpro|FM199974_MHBs_P-A Product feature CHAIN FM199974_MHBs_P-A of FT:mat_peptide FM199974_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSXAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199976_MHBs_P-A Product feature CHAIN FM199976_MHBs_P-A of FT:mat_peptide FM199976_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199977_MHBs_P-A Product feature CHAIN FM199977_MHBs_P-A of FT:mat_peptide FM199977_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|FM199978_MHBs_P-A Product feature CHAIN FM199978_MHBs_P-A of FT:mat_peptide FM199978_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199979_MHBs_P-A Product feature CHAIN FM199979_MHBs_P-A of FT:mat_peptide FM199979_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFQQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199980_MHBs_P-A Product feature CHAIN FM199980_MHBs_P-A of FT:mat_peptide FM199980_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGXSMFPSCCCTKXTAGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199981_MHBs_P-A Product feature CHAIN FM199981_MHBs_P-A of FT:mat_peptide FM199981_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGXLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545825_MHBs_P-A Product feature CHAIN FN545825_MHBs_P-A of FT:mat_peptide FN545825_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVTPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTXI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545826_MHBs_P-A Product feature CHAIN FN545826_MHBs_P-A of FT:mat_peptide FN545826_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISSRTGDPAPNMENITSGFLRPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|FN545828_MHBs_P-A Product feature CHAIN FN545828_MHBs_P-A of FT:mat_peptide FN545828_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPNTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILTPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545829_MHBs_P-A Product feature CHAIN FN545829_MHBs_P-A of FT:mat_peptide FN545829_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALQDPKVRGLYFPAGGSNSGTVNPVPNTASHISSISARTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545830_MHBs_P-A Product feature CHAIN FN545830_MHBs_P-A of FT:mat_peptide FN545830_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
XQWXSTTFHQALQDPRVRGLYLPAGGSNSGTVNPVPNTASHISSISSRTGDPAPTMENITSGXLGXLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545831_MHBs_P-A Product feature CHAIN FN545831_MHBs_P-A of FT:mat_peptide FN545831_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545832_MHBs_P-A Product feature CHAIN FN545832_MHBs_P-A of FT:mat_peptide FN545832_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPNTASHISSISSRTGDPAPTMENITSGFLGPLPVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXHVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545833_MHBs_P-A Product feature CHAIN FN545833_MHBs_P-A of FT:mat_peptide FN545833_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALQDPRVRGLYLPAGGSNSGTVNPVPNTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545834_MHBs_P-A Product feature CHAIN FN545834_MHBs_P-A of FT:mat_peptide FN545834_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALQDPRVRGLYLPAGGSNSGTVNPVPNTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAXXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSXLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545835_MHBs_P-A Product feature CHAIN FN545835_MHBs_P-A of FT:mat_peptide FN545835_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPNTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545836_MHBs_P-A Product feature CHAIN FN545836_MHBs_P-A of FT:mat_peptide FN545836_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLXDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545838_MHBs_P-A Product feature CHAIN FN545838_MHBs_P-A of FT:mat_peptide FN545838_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTXFHQALXDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPPIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|GQ161813_MHBs_P-A Product feature CHAIN GQ161813_MHBs_P-A of FT:mat_peptide GQ161813_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ184323_MHBs_P-A Product feature CHAIN GQ184323_MHBs_P-A of FT:mat_peptide GQ184323_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNYTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTFFHCLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ184324_MHBs_P-A Product feature CHAIN GQ184324_MHBs_P-A of FT:mat_peptide GQ184324_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNYTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFFLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ331046_MHBs_P-A Product feature CHAIN GQ331046_MHBs_P-A of FT:mat_peptide GQ331046_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWESTTFHQALQDPRVRGLYFPAGGSSSGTVNPVQNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ331047_MHBs_P-A Product feature CHAIN GQ331047_MHBs_P-A of FT:mat_peptide GQ331047_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVQNIASHISSISSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ414522_MHBs_P-A Product feature CHAIN GQ414522_MHBs_P-A of FT:mat_peptide GQ414522_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477461_MHBs_P-A Product feature CHAIN GQ477461_MHBs_P-A of FT:mat_peptide GQ477461_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477462_MHBs_P-A Product feature CHAIN GQ477462_MHBs_P-A of FT:mat_peptide GQ477462_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWFWGPSLYNIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477463_MHBs_P-A Product feature CHAIN GQ477463_MHBs_P-A of FT:mat_peptide GQ477463_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIISLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477464_MHBs_P-A Product feature CHAIN GQ477464_MHBs_P-A of FT:mat_peptide GQ477464_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQNPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477465_MHBs_P-A Product feature CHAIN GQ477465_MHBs_P-A of FT:mat_peptide GQ477465_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
HSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477466_MHBs_P-A Product feature CHAIN GQ477466_MHBs_P-A of FT:mat_peptide GQ477466_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477467_MHBs_P-A Product feature CHAIN GQ477467_MHBs_P-A of FT:mat_peptide GQ477467_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477468_MHBs_P-A Product feature CHAIN GQ477468_MHBs_P-A of FT:mat_peptide GQ477468_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQSNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477469_MHBs_P-A Product feature CHAIN GQ477469_MHBs_P-A of FT:mat_peptide GQ477469_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGIPVCHGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477472_MHBs_P-A Product feature CHAIN GQ477472_MHBs_P-A of FT:mat_peptide GQ477472_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQDLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477473_MHBs_P-A Product feature CHAIN GQ477473_MHBs_P-A of FT:mat_peptide GQ477473_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGVPPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLCSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477475_MHBs_P-A Product feature CHAIN GQ477475_MHBs_P-A of FT:mat_peptide GQ477475_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLCNIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477477_MHBs_P-A Product feature CHAIN GQ477477_MHBs_P-A of FT:mat_peptide GQ477477_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAVHQDPQDPKVRGLCFPAGGSSSGTVNPAPNIASHISSISARTGDPVKNRENITSGFLGPLHVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLPCLIFLLVLLDYQGILP
VCPLIPGATTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477478_MHBs_P-A Product feature CHAIN GQ477478_MHBs_P-A of FT:mat_peptide GQ477478_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKDTRVRGLYSPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTIPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477479_MHBs_P-A Product feature CHAIN GQ477479_MHBs_P-A of FT:mat_peptide GQ477479_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477480_MHBs_P-A Product feature CHAIN GQ477480_MHBs_P-A of FT:mat_peptide GQ477480_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQNPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477482_MHBs_P-A Product feature CHAIN GQ477482_MHBs_P-A of FT:mat_peptide GQ477482_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPQIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477484_MHBs_P-A Product feature CHAIN GQ477484_MHBs_P-A of FT:mat_peptide GQ477484_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477486_MHBs_P-A Product feature CHAIN GQ477486_MHBs_P-A of FT:mat_peptide GQ477486_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477487_MHBs_P-A Product feature CHAIN GQ477487_MHBs_P-A of FT:mat_peptide GQ477487_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477488_MHBs_P-A Product feature CHAIN GQ477488_MHBs_P-A of FT:mat_peptide GQ477488_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477490_MHBs_P-A Product feature CHAIN GQ477490_MHBs_P-A of FT:mat_peptide GQ477490_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGVLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPNLYSTVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477491_MHBs_P-A Product feature CHAIN GQ477491_MHBs_P-A of FT:mat_peptide GQ477491_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477493_MHBs_P-A Product feature CHAIN GQ477493_MHBs_P-A of FT:mat_peptide GQ477493_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWSSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLEPPLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477494_MHBs_P-A Product feature CHAIN GQ477494_MHBs_P-A of FT:mat_peptide GQ477494_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMILYWGPSLYNIVSPFIPLLPIFFCLWVFI
>gnl|hbvpro|GQ477495_MHBs_P-A Product feature CHAIN GQ477495_MHBs_P-A of FT:mat_peptide GQ477495_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQNSSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477496_MHBs_P-A Product feature CHAIN GQ477496_MHBs_P-A of FT:mat_peptide GQ477496_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477497_MHBs_P-A Product feature CHAIN GQ477497_MHBs_P-A of FT:mat_peptide GQ477497_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVRPFIPLLPIFLCLWVYI
>gnl|hbvpro|GQ477498_MHBs_P-A Product feature CHAIN GQ477498_MHBs_P-A of FT:mat_peptide GQ477498_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPQLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477500_MHBs_P-A Product feature CHAIN GQ477500_MHBs_P-A of FT:mat_peptide GQ477500_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGILR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477501_MHBs_P-A Product feature CHAIN GQ477501_MHBs_P-A of FT:mat_peptide GQ477501_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477502_MHBs_P-A Product feature CHAIN GQ477502_MHBs_P-A of FT:mat_peptide GQ477502_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLSFLGETPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPHLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477503_MHBs_P-A Product feature CHAIN GQ477503_MHBs_P-A of FT:mat_peptide GQ477503_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477504_MHBs_P-A Product feature CHAIN GQ477504_MHBs_P-A of FT:mat_peptide GQ477504_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVRHFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563545_MHBs_P-A Product feature CHAIN GU563545_MHBs_P-A of FT:mat_peptide GU563545_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563546_MHBs_P-A Product feature CHAIN GU563546_MHBs_P-A of FT:mat_peptide GU563546_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563547_MHBs_P-A Product feature CHAIN GU563547_MHBs_P-A of FT:mat_peptide GU563547_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDSRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563548_MHBs_P-A Product feature CHAIN GU563548_MHBs_P-A of FT:mat_peptide GU563548_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563550_MHBs_P-A Product feature CHAIN GU563550_MHBs_P-A of FT:mat_peptide GU563550_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563551_MHBs_P-A Product feature CHAIN GU563551_MHBs_P-A of FT:mat_peptide GU563551_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563553_MHBs_P-A Product feature CHAIN GU563553_MHBs_P-A of FT:mat_peptide GU563553_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563554_MHBs_P-A Product feature CHAIN GU563554_MHBs_P-A of FT:mat_peptide GU563554_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563555_MHBs_P-A Product feature CHAIN GU563555_MHBs_P-A of FT:mat_peptide GU563555_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563557_MHBs_P-A Product feature CHAIN GU563557_MHBs_P-A of FT:mat_peptide GU563557_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563558_MHBs_P-A Product feature CHAIN GU563558_MHBs_P-A of FT:mat_peptide GU563558_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563562_MHBs_P-A Product feature CHAIN GU563562_MHBs_P-A of FT:mat_peptide GU563562_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE576988_MHBs_P-A Product feature CHAIN HE576988_MHBs_P-A of FT:mat_peptide HE576988_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFQGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTEGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE576989_MHBs_P-A Product feature CHAIN HE576989_MHBs_P-A of FT:mat_peptide HE576989_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNPTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTEGNCTCIPIPLSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM011485_MHBs_P-A Product feature CHAIN HM011485_MHBs_P-A of FT:mat_peptide HM011485_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTAWLSAIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363612_MHBs_P-A Product feature CHAIN HM363612_MHBs_P-A of FT:mat_peptide HM363612_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAQNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363613_MHBs_P-A Product feature CHAIN HM363613_MHBs_P-A of FT:mat_peptide HM363613_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVTPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM535200_MHBs_P-A Product feature CHAIN HM535200_MHBs_P-A of FT:mat_peptide HM535200_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSRFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM535205_MHBs_P-A Product feature CHAIN HM535205_MHBs_P-A of FT:mat_peptide HM535205_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRARGLYFPAGGSSSGTLNPVPNTASHISAISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439720_MHBs_P-A Product feature CHAIN JF439720_MHBs_P-A of FT:mat_peptide JF439720_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCRCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439721_MHBs_P-A Product feature CHAIN JF439721_MHBs_P-A of FT:mat_peptide JF439721_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMEKITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439722_MHBs_P-A Product feature CHAIN JF439722_MHBs_P-A of FT:mat_peptide JF439722_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439723_MHBs_P-A Product feature CHAIN JF439723_MHBs_P-A of FT:mat_peptide JF439723_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTAPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439724_MHBs_P-A Product feature CHAIN JF439724_MHBs_P-A of FT:mat_peptide JF439724_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439726_MHBs_P-A Product feature CHAIN JF439726_MHBs_P-A of FT:mat_peptide JF439726_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL452). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGSSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWALVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439729_MHBs_P-A Product feature CHAIN JF439729_MHBs_P-A of FT:mat_peptide JF439729_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439730_MHBs_P-A Product feature CHAIN JF439730_MHBs_P-A of FT:mat_peptide JF439730_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439731_MHBs_P-A Product feature CHAIN JF439731_MHBs_P-A of FT:mat_peptide JF439731_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL458). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWALVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439732_MHBs_P-A Product feature CHAIN JF439732_MHBs_P-A of FT:mat_peptide JF439732_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTTENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILPLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAKYLWEWAPVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439733_MHBs_P-A Product feature CHAIN JF439733_MHBs_P-A of FT:mat_peptide JF439733_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTTENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILPLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAKYLWEWAPVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439734_MHBs_P-A Product feature CHAIN JF439734_MHBs_P-A of FT:mat_peptide JF439734_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL461). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWALVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439735_MHBs_P-A Product feature CHAIN JF439735_MHBs_P-A of FT:mat_peptide JF439735_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439736_MHBs_P-A Product feature CHAIN JF439736_MHBs_P-A of FT:mat_peptide JF439736_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439737_MHBs_P-A Product feature CHAIN JF439737_MHBs_P-A of FT:mat_peptide JF439737_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439738_MHBs_P-A Product feature CHAIN JF439738_MHBs_P-A of FT:mat_peptide JF439738_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439739_MHBs_P-A Product feature CHAIN JF439739_MHBs_P-A of FT:mat_peptide JF439739_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL467). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439742_MHBs_P-A Product feature CHAIN JF439742_MHBs_P-A of FT:mat_peptide JF439742_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439743_MHBs_P-A Product feature CHAIN JF439743_MHBs_P-A of FT:mat_peptide JF439743_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFSCLWVYI
>gnl|hbvpro|JF439744_MHBs_P-A Product feature CHAIN JF439744_MHBs_P-A of FT:mat_peptide JF439744_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL473). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWALVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439745_MHBs_P-A Product feature CHAIN JF439745_MHBs_P-A of FT:mat_peptide JF439745_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL474). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439746_MHBs_P-A Product feature CHAIN JF439746_MHBs_P-A of FT:mat_peptide JF439746_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHRTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439747_MHBs_P-A Product feature CHAIN JF439747_MHBs_P-A of FT:mat_peptide JF439747_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSGSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439748_MHBs_P-A Product feature CHAIN JF439748_MHBs_P-A of FT:mat_peptide JF439748_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCGTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439751_MHBs_P-A Product feature CHAIN JF439751_MHBs_P-A of FT:mat_peptide JF439751_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439752_MHBs_P-A Product feature CHAIN JF439752_MHBs_P-A of FT:mat_peptide JF439752_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439753_MHBs_P-A Product feature CHAIN JF439753_MHBs_P-A of FT:mat_peptide JF439753_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439754_MHBs_P-A Product feature CHAIN JF439754_MHBs_P-A of FT:mat_peptide JF439754_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439755_MHBs_P-A Product feature CHAIN JF439755_MHBs_P-A of FT:mat_peptide JF439755_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439756_MHBs_P-A Product feature CHAIN JF439756_MHBs_P-A of FT:mat_peptide JF439756_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439757_MHBs_P-A Product feature CHAIN JF439757_MHBs_P-A of FT:mat_peptide JF439757_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439758_MHBs_P-A Product feature CHAIN JF439758_MHBs_P-A of FT:mat_peptide JF439758_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439759_MHBs_P-A Product feature CHAIN JF439759_MHBs_P-A of FT:mat_peptide JF439759_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439760_MHBs_P-A Product feature CHAIN JF439760_MHBs_P-A of FT:mat_peptide JF439760_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439761_MHBs_P-A Product feature CHAIN JF439761_MHBs_P-A of FT:mat_peptide JF439761_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439762_MHBs_P-A Product feature CHAIN JF439762_MHBs_P-A of FT:mat_peptide JF439762_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439763_MHBs_P-A Product feature CHAIN JF439763_MHBs_P-A of FT:mat_peptide JF439763_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439764_MHBs_P-A Product feature CHAIN JF439764_MHBs_P-A of FT:mat_peptide JF439764_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439765_MHBs_P-A Product feature CHAIN JF439765_MHBs_P-A of FT:mat_peptide JF439765_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439766_MHBs_P-A Product feature CHAIN JF439766_MHBs_P-A of FT:mat_peptide JF439766_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439767_MHBs_P-A Product feature CHAIN JF439767_MHBs_P-A of FT:mat_peptide JF439767_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439768_MHBs_P-A Product feature CHAIN JF439768_MHBs_P-A of FT:mat_peptide JF439768_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFPQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439769_MHBs_P-A Product feature CHAIN JF439769_MHBs_P-A of FT:mat_peptide JF439769_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFPQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439774_MHBs_P-A Product feature CHAIN JF439774_MHBs_P-A of FT:mat_peptide JF439774_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439777_MHBs_P-A Product feature CHAIN JF439777_MHBs_P-A of FT:mat_peptide JF439777_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439820_MHBs_P-A Product feature CHAIN JF439820_MHBs_P-A of FT:mat_peptide JF439820_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWISLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439821_MHBs_P-A Product feature CHAIN JF439821_MHBs_P-A of FT:mat_peptide JF439821_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNYTTFRQAMQDPRVRGMYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSRWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSGAFAKYLWEWASVRFYWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439822_MHBs_P-A Product feature CHAIN JF439822_MHBs_P-A of FT:mat_peptide JF439822_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439824_MHBs_P-A Product feature CHAIN JF439824_MHBs_P-A of FT:mat_peptide JF439824_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMSP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439825_MHBs_P-A Product feature CHAIN JF439825_MHBs_P-A of FT:mat_peptide JF439825_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439828_MHBs_P-A Product feature CHAIN JF439828_MHBs_P-A of FT:mat_peptide JF439828_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSPSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439829_MHBs_P-A Product feature CHAIN JF439829_MHBs_P-A of FT:mat_peptide JF439829_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439831_MHBs_P-A Product feature CHAIN JF439831_MHBs_P-A of FT:mat_peptide JF439831_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439832_MHBs_P-A Product feature CHAIN JF439832_MHBs_P-A of FT:mat_peptide JF439832_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSRWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439833_MHBs_P-A Product feature CHAIN JF439833_MHBs_P-A of FT:mat_peptide JF439833_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439834_MHBs_P-A Product feature CHAIN JF439834_MHBs_P-A of FT:mat_peptide JF439834_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99A4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSVVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439835_MHBs_P-A Product feature CHAIN JF439835_MHBs_P-A of FT:mat_peptide JF439835_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439836_MHBs_P-A Product feature CHAIN JF439836_MHBs_P-A of FT:mat_peptide JF439836_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439837_MHBs_P-A Product feature CHAIN JF439837_MHBs_P-A of FT:mat_peptide JF439837_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439838_MHBs_P-A Product feature CHAIN JF439838_MHBs_P-A of FT:mat_peptide JF439838_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439839_MHBs_P-A Product feature CHAIN JF439839_MHBs_P-A of FT:mat_peptide JF439839_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTVNPAPNIASHISSISARTGDSVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439840_MHBs_P-A Product feature CHAIN JF439840_MHBs_P-A of FT:mat_peptide JF439840_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439841_MHBs_P-A Product feature CHAIN JF439841_MHBs_P-A of FT:mat_peptide JF439841_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFTKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439842_MHBs_P-A Product feature CHAIN JF439842_MHBs_P-A of FT:mat_peptide JF439842_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVHFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439843_MHBs_P-A Product feature CHAIN JF439843_MHBs_P-A of FT:mat_peptide JF439843_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSCWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439844_MHBs_P-A Product feature CHAIN JF439844_MHBs_P-A of FT:mat_peptide JF439844_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439845_MHBs_P-A Product feature CHAIN JF439845_MHBs_P-A of FT:mat_peptide JF439845_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439846_MHBs_P-A Product feature CHAIN JF439846_MHBs_P-A of FT:mat_peptide JF439846_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSIFPSCCCTKPTDGNCTCIPIPSSWALAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439847_MHBs_P-A Product feature CHAIN JF439847_MHBs_P-A of FT:mat_peptide JF439847_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPLIPLLPIFFCLWVYI
>gnl|hbvpro|JF439848_MHBs_P-A Product feature CHAIN JF439848_MHBs_P-A of FT:mat_peptide JF439848_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439849_MHBs_P-A Product feature CHAIN JF439849_MHBs_P-A of FT:mat_peptide JF439849_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439850_MHBs_P-A Product feature CHAIN JF439850_MHBs_P-A of FT:mat_peptide JF439850_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVYLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439851_MHBs_P-A Product feature CHAIN JF439851_MHBs_P-A of FT:mat_peptide JF439851_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439852_MHBs_P-A Product feature CHAIN JF439852_MHBs_P-A of FT:mat_peptide JF439852_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDPWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439853_MHBs_P-A Product feature CHAIN JF439853_MHBs_P-A of FT:mat_peptide JF439853_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439854_MHBs_P-A Product feature CHAIN JF439854_MHBs_P-A of FT:mat_peptide JF439854_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439855_MHBs_P-A Product feature CHAIN JF439855_MHBs_P-A of FT:mat_peptide JF439855_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439856_MHBs_P-A Product feature CHAIN JF439856_MHBs_P-A of FT:mat_peptide JF439856_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439857_MHBs_P-A Product feature CHAIN JF439857_MHBs_P-A of FT:mat_peptide JF439857_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSPWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439858_MHBs_P-A Product feature CHAIN JF439858_MHBs_P-A of FT:mat_peptide JF439858_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439859_MHBs_P-A Product feature CHAIN JF439859_MHBs_P-A of FT:mat_peptide JF439859_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439860_MHBs_P-A Product feature CHAIN JF439860_MHBs_P-A of FT:mat_peptide JF439860_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439861_MHBs_P-A Product feature CHAIN JF439861_MHBs_P-A of FT:mat_peptide JF439861_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439862_MHBs_P-A Product feature CHAIN JF439862_MHBs_P-A of FT:mat_peptide JF439862_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05B7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPIRPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439864_MHBs_P-A Product feature CHAIN JF439864_MHBs_P-A of FT:mat_peptide JF439864_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQGLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439865_MHBs_P-A Product feature CHAIN JF439865_MHBs_P-A of FT:mat_peptide JF439865_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSYCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439866_MHBs_P-A Product feature CHAIN JF439866_MHBs_P-A of FT:mat_peptide JF439866_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05F7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQGPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLSILLLCLIFLLVLLDYRGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439867_MHBs_P-A Product feature CHAIN JF439867_MHBs_P-A of FT:mat_peptide JF439867_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05G8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAVHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMANITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439868_MHBs_P-A Product feature CHAIN JF439868_MHBs_P-A of FT:mat_peptide JF439868_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLNLLVPFVQWFVG
LSPTVWLSAMWMILYWGPSLYSIVSPFIPLSPIFFCLWVYI
>gnl|hbvpro|JF439869_MHBs_P-A Product feature CHAIN JF439869_MHBs_P-A of FT:mat_peptide JF439869_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439870_MHBs_P-A Product feature CHAIN JF439870_MHBs_P-A of FT:mat_peptide JF439870_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKTTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439871_MHBs_P-A Product feature CHAIN JF439871_MHBs_P-A of FT:mat_peptide JF439871_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439872_MHBs_P-A Product feature CHAIN JF439872_MHBs_P-A of FT:mat_peptide JF439872_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLNPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKTTAANCTCIPIPSSWAFAKYLWEWASARFYWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439873_MHBs_P-A Product feature CHAIN JF439873_MHBs_P-A of FT:mat_peptide JF439873_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439874_MHBs_P-A Product feature CHAIN JF439874_MHBs_P-A of FT:mat_peptide JF439874_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439875_MHBs_P-A Product feature CHAIN JF439875_MHBs_P-A of FT:mat_peptide JF439875_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVTGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439876_MHBs_P-A Product feature CHAIN JF439876_MHBs_P-A of FT:mat_peptide JF439876_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439877_MHBs_P-A Product feature CHAIN JF439877_MHBs_P-A of FT:mat_peptide JF439877_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMMPSCCCTKTTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439878_MHBs_P-A Product feature CHAIN JF439878_MHBs_P-A of FT:mat_peptide JF439878_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMMPSCCCTKTTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439879_MHBs_P-A Product feature CHAIN JF439879_MHBs_P-A of FT:mat_peptide JF439879_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439880_MHBs_P-A Product feature CHAIN JF439880_MHBs_P-A of FT:mat_peptide JF439880_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439881_MHBs_P-A Product feature CHAIN JF439881_MHBs_P-A of FT:mat_peptide JF439881_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439882_MHBs_P-A Product feature CHAIN JF439882_MHBs_P-A of FT:mat_peptide JF439882_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439883_MHBs_P-A Product feature CHAIN JF439883_MHBs_P-A of FT:mat_peptide JF439883_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439896_MHBs_P-A Product feature CHAIN JF439896_MHBs_P-A of FT:mat_peptide JF439896_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439897_MHBs_P-A Product feature CHAIN JF439897_MHBs_P-A of FT:mat_peptide JF439897_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439898_MHBs_P-A Product feature CHAIN JF439898_MHBs_P-A of FT:mat_peptide JF439898_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439899_MHBs_P-A Product feature CHAIN JF439899_MHBs_P-A of FT:mat_peptide JF439899_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439900_MHBs_P-A Product feature CHAIN JF439900_MHBs_P-A of FT:mat_peptide JF439900_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439901_MHBs_P-A Product feature CHAIN JF439901_MHBs_P-A of FT:mat_peptide JF439901_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439902_MHBs_P-A Product feature CHAIN JF439902_MHBs_P-A of FT:mat_peptide JF439902_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439903_MHBs_P-A Product feature CHAIN JF439903_MHBs_P-A of FT:mat_peptide JF439903_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439904_MHBs_P-A Product feature CHAIN JF439904_MHBs_P-A of FT:mat_peptide JF439904_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439905_MHBs_P-A Product feature CHAIN JF439905_MHBs_P-A of FT:mat_peptide JF439905_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439906_MHBs_P-A Product feature CHAIN JF439906_MHBs_P-A of FT:mat_peptide JF439906_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLSFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFTKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439907_MHBs_P-A Product feature CHAIN JF439907_MHBs_P-A of FT:mat_peptide JF439907_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439908_MHBs_P-A Product feature CHAIN JF439908_MHBs_P-A of FT:mat_peptide JF439908_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439909_MHBs_P-A Product feature CHAIN JF439909_MHBs_P-A of FT:mat_peptide JF439909_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439910_MHBs_P-A Product feature CHAIN JF439910_MHBs_P-A of FT:mat_peptide JF439910_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439911_MHBs_P-A Product feature CHAIN JF439911_MHBs_P-A of FT:mat_peptide JF439911_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439912_MHBs_P-A Product feature CHAIN JF439912_MHBs_P-A of FT:mat_peptide JF439912_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLFSIVRPFTPLLPIFFCLWVYI
>gnl|hbvpro|JF439913_MHBs_P-A Product feature CHAIN JF439913_MHBs_P-A of FT:mat_peptide JF439913_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439914_MHBs_P-A Product feature CHAIN JF439914_MHBs_P-A of FT:mat_peptide JF439914_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPILSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439915_MHBs_P-A Product feature CHAIN JF439915_MHBs_P-A of FT:mat_peptide JF439915_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHLSSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439916_MHBs_P-A Product feature CHAIN JF439916_MHBs_P-A of FT:mat_peptide JF439916_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRV
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439917_MHBs_P-A Product feature CHAIN JF439917_MHBs_P-A of FT:mat_peptide JF439917_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPLIPLLPIFFCLWVYI
>gnl|hbvpro|JF439918_MHBs_P-A Product feature CHAIN JF439918_MHBs_P-A of FT:mat_peptide JF439918_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISPISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439919_MHBs_P-A Product feature CHAIN JF439919_MHBs_P-A of FT:mat_peptide JF439919_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWASLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439920_MHBs_P-A Product feature CHAIN JF439920_MHBs_P-A of FT:mat_peptide JF439920_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMESITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLILLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439921_MHBs_P-A Product feature CHAIN JF439921_MHBs_P-A of FT:mat_peptide JF439921_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439922_MHBs_P-A Product feature CHAIN JF439922_MHBs_P-A of FT:mat_peptide JF439922_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439923_MHBs_P-A Product feature CHAIN JF439923_MHBs_P-A of FT:mat_peptide JF439923_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVRLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439924_MHBs_P-A Product feature CHAIN JF439924_MHBs_P-A of FT:mat_peptide JF439924_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTVPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439925_MHBs_P-A Product feature CHAIN JF439925_MHBs_P-A of FT:mat_peptide JF439925_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRLSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439927_MHBs_P-A Product feature CHAIN JF439927_MHBs_P-A of FT:mat_peptide JF439927_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439928_MHBs_P-A Product feature CHAIN JF439928_MHBs_P-A of FT:mat_peptide JF439928_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439929_MHBs_P-A Product feature CHAIN JF439929_MHBs_P-A of FT:mat_peptide JF439929_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439930_MHBs_P-A Product feature CHAIN JF439930_MHBs_P-A of FT:mat_peptide JF439930_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPATNMENITSGFLGPPLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439931_MHBs_P-A Product feature CHAIN JF439931_MHBs_P-A of FT:mat_peptide JF439931_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPATNMENITSGVLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLILLDYQGMSP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439932_MHBs_P-A Product feature CHAIN JF439932_MHBs_P-A of FT:mat_peptide JF439932_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439933_MHBs_P-A Product feature CHAIN JF439933_MHBs_P-A of FT:mat_peptide JF439933_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFPGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439934_MHBs_P-A Product feature CHAIN JF439934_MHBs_P-A of FT:mat_peptide JF439934_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439935_MHBs_P-A Product feature CHAIN JF439935_MHBs_P-A of FT:mat_peptide JF439935_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPATNMENITSGVLGPLLVLQAGFFLLTRI
LAIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLPCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439936_MHBs_P-A Product feature CHAIN JF439936_MHBs_P-A of FT:mat_peptide JF439936_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439937_MHBs_P-A Product feature CHAIN JF439937_MHBs_P-A of FT:mat_peptide JF439937_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIAPHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439938_MHBs_P-A Product feature CHAIN JF439938_MHBs_P-A of FT:mat_peptide JF439938_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTYIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439939_MHBs_P-A Product feature CHAIN JF439939_MHBs_P-A of FT:mat_peptide JF439939_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VRPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439940_MHBs_P-A Product feature CHAIN JF439940_MHBs_P-A of FT:mat_peptide JF439940_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439941_MHBs_P-A Product feature CHAIN JF439941_MHBs_P-A of FT:mat_peptide JF439941_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIAPHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439942_MHBs_P-A Product feature CHAIN JF439942_MHBs_P-A of FT:mat_peptide JF439942_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439943_MHBs_P-A Product feature CHAIN JF439943_MHBs_P-A of FT:mat_peptide JF439943_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439944_MHBs_P-A Product feature CHAIN JF439944_MHBs_P-A of FT:mat_peptide JF439944_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439945_MHBs_P-A Product feature CHAIN JF439945_MHBs_P-A of FT:mat_peptide JF439945_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439946_MHBs_P-A Product feature CHAIN JF439946_MHBs_P-A of FT:mat_peptide JF439946_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439947_MHBs_P-A Product feature CHAIN JF439947_MHBs_P-A of FT:mat_peptide JF439947_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMVWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439948_MHBs_P-A Product feature CHAIN JF439948_MHBs_P-A of FT:mat_peptide JF439948_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439949_MHBs_P-A Product feature CHAIN JF439949_MHBs_P-A of FT:mat_peptide JF439949_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGGPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWTMWYWGPSLYSIVRPFISLLPIFFCLWVYI
>gnl|hbvpro|JF439950_MHBs_P-A Product feature CHAIN JF439950_MHBs_P-A of FT:mat_peptide JF439950_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439951_MHBs_P-A Product feature CHAIN JF439951_MHBs_P-A of FT:mat_peptide JF439951_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSAGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439952_MHBs_P-A Product feature CHAIN JF439952_MHBs_P-A of FT:mat_peptide JF439952_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIMFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPADGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMRMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439953_MHBs_P-A Product feature CHAIN JF439953_MHBs_P-A of FT:mat_peptide JF439953_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439954_MHBs_P-A Product feature CHAIN JF439954_MHBs_P-A of FT:mat_peptide JF439954_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439955_MHBs_P-A Product feature CHAIN JF439955_MHBs_P-A of FT:mat_peptide JF439955_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439956_MHBs_P-A Product feature CHAIN JF439956_MHBs_P-A of FT:mat_peptide JF439956_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLVFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439957_MHBs_P-A Product feature CHAIN JF439957_MHBs_P-A of FT:mat_peptide JF439957_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439958_MHBs_P-A Product feature CHAIN JF439958_MHBs_P-A of FT:mat_peptide JF439958_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMESITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWASLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCRCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439959_MHBs_P-A Product feature CHAIN JF439959_MHBs_P-A of FT:mat_peptide JF439959_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439960_MHBs_P-A Product feature CHAIN JF439960_MHBs_P-A of FT:mat_peptide JF439960_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQGPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTDMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439961_MHBs_P-A Product feature CHAIN JF439961_MHBs_P-A of FT:mat_peptide JF439961_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSRAFTKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439962_MHBs_P-A Product feature CHAIN JF439962_MHBs_P-A of FT:mat_peptide JF439962_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439963_MHBs_P-A Product feature CHAIN JF439963_MHBs_P-A of FT:mat_peptide JF439963_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQGNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439964_MHBs_P-A Product feature CHAIN JF439964_MHBs_P-A of FT:mat_peptide JF439964_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNLLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439965_MHBs_P-A Product feature CHAIN JF439965_MHBs_P-A of FT:mat_peptide JF439965_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVHI
>gnl|hbvpro|JF439966_MHBs_P-A Product feature CHAIN JF439966_MHBs_P-A of FT:mat_peptide JF439966_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c8). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439967_MHBs_P-A Product feature CHAIN JF439967_MHBs_P-A of FT:mat_peptide JF439967_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439968_MHBs_P-A Product feature CHAIN JF439968_MHBs_P-A of FT:mat_peptide JF439968_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPSIPLLPIFFCLWVYI
>gnl|hbvpro|JF439969_MHBs_P-A Product feature CHAIN JF439969_MHBs_P-A of FT:mat_peptide JF439969_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439970_MHBs_P-A Product feature CHAIN JF439970_MHBs_P-A of FT:mat_peptide JF439970_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVWGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFEG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439971_MHBs_P-A Product feature CHAIN JF439971_MHBs_P-A of FT:mat_peptide JF439971_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439972_MHBs_P-A Product feature CHAIN JF439972_MHBs_P-A of FT:mat_peptide JF439972_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPSYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPNFFCLWVYI
>gnl|hbvpro|JF439973_MHBs_P-A Product feature CHAIN JF439973_MHBs_P-A of FT:mat_peptide JF439973_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWASLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439974_MHBs_P-A Product feature CHAIN JF439974_MHBs_P-A of FT:mat_peptide JF439974_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439975_MHBs_P-A Product feature CHAIN JF439975_MHBs_P-A of FT:mat_peptide JF439975_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTVPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVPLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439976_MHBs_P-A Product feature CHAIN JF439976_MHBs_P-A of FT:mat_peptide JF439976_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTSMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLRGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439977_MHBs_P-A Product feature CHAIN JF439977_MHBs_P-A of FT:mat_peptide JF439977_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSPYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439978_MHBs_P-A Product feature CHAIN JF439978_MHBs_P-A of FT:mat_peptide JF439978_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439979_MHBs_P-A Product feature CHAIN JF439979_MHBs_P-A of FT:mat_peptide JF439979_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPPIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTGGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439980_MHBs_P-A Product feature CHAIN JF439980_MHBs_P-A of FT:mat_peptide JF439980_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439981_MHBs_P-A Product feature CHAIN JF439981_MHBs_P-A of FT:mat_peptide JF439981_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLEGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKACTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439982_MHBs_P-A Product feature CHAIN JF439982_MHBs_P-A of FT:mat_peptide JF439982_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSPGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439983_MHBs_P-A Product feature CHAIN JF439983_MHBs_P-A of FT:mat_peptide JF439983_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVDPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439984_MHBs_P-A Product feature CHAIN JF439984_MHBs_P-A of FT:mat_peptide JF439984_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWGTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439985_MHBs_P-A Product feature CHAIN JF439985_MHBs_P-A of FT:mat_peptide JF439985_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439986_MHBs_P-A Product feature CHAIN JF439986_MHBs_P-A of FT:mat_peptide JF439986_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439987_MHBs_P-A Product feature CHAIN JF439987_MHBs_P-A of FT:mat_peptide JF439987_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTRPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439988_MHBs_P-A Product feature CHAIN JF439988_MHBs_P-A of FT:mat_peptide JF439988_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439989_MHBs_P-A Product feature CHAIN JF439989_MHBs_P-A of FT:mat_peptide JF439989_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LPPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439990_MHBs_P-A Product feature CHAIN JF439990_MHBs_P-A of FT:mat_peptide JF439990_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLPGPLLVLQAGFLLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPRIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439991_MHBs_P-A Product feature CHAIN JF439991_MHBs_P-A of FT:mat_peptide JF439991_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVCFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439992_MHBs_P-A Product feature CHAIN JF439992_MHBs_P-A of FT:mat_peptide JF439992_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWRTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439993_MHBs_P-A Product feature CHAIN JF439993_MHBs_P-A of FT:mat_peptide JF439993_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQGLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF440020_MHBs_P-A Product feature CHAIN JF440020_MHBs_P-A of FT:mat_peptide JF440020_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQNPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182318_MHBs_P-A Product feature CHAIN JN182318_MHBs_P-A of FT:mat_peptide JN182318_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182319_MHBs_P-A Product feature CHAIN JN182319_MHBs_P-A of FT:mat_peptide JN182319_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182320_MHBs_P-A Product feature CHAIN JN182320_MHBs_P-A of FT:mat_peptide JN182320_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNPMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182321_MHBs_P-A Product feature CHAIN JN182321_MHBs_P-A of FT:mat_peptide JN182321_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182322_MHBs_P-A Product feature CHAIN JN182322_MHBs_P-A of FT:mat_peptide JN182322_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182323_MHBs_P-A Product feature CHAIN JN182323_MHBs_P-A of FT:mat_peptide JN182323_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182324_MHBs_P-A Product feature CHAIN JN182324_MHBs_P-A of FT:mat_peptide JN182324_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNAMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182325_MHBs_P-A Product feature CHAIN JN182325_MHBs_P-A of FT:mat_peptide JN182325_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182326_MHBs_P-A Product feature CHAIN JN182326_MHBs_P-A of FT:mat_peptide JN182326_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182327_MHBs_P-A Product feature CHAIN JN182327_MHBs_P-A of FT:mat_peptide JN182327_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182328_MHBs_P-A Product feature CHAIN JN182328_MHBs_P-A of FT:mat_peptide JN182328_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGKLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182329_MHBs_P-A Product feature CHAIN JN182329_MHBs_P-A of FT:mat_peptide JN182329_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182330_MHBs_P-A Product feature CHAIN JN182330_MHBs_P-A of FT:mat_peptide JN182330_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTAPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182331_MHBs_P-A Product feature CHAIN JN182331_MHBs_P-A of FT:mat_peptide JN182331_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182332_MHBs_P-A Product feature CHAIN JN182332_MHBs_P-A of FT:mat_peptide JN182332_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLGYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYRGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182333_MHBs_P-A Product feature CHAIN JN182333_MHBs_P-A of FT:mat_peptide JN182333_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYRGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182334_MHBs_P-A Product feature CHAIN JN182334_MHBs_P-A of FT:mat_peptide JN182334_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVPLDYQGKLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604128_MHBs_P-A Product feature CHAIN JN604128_MHBs_P-A of FT:mat_peptide JN604128_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-4481-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENXTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSAIWMMWYWGPRLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604136_MHBs_P-A Product feature CHAIN JN604136_MHBs_P-A of FT:mat_peptide JN604136_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-5824-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604145_MHBs_P-A Product feature CHAIN JN604145_MHBs_P-A of FT:mat_peptide JN604145_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2097-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604150_MHBs_P-A Product feature CHAIN JN604150_MHBs_P-A of FT:mat_peptide JN604150_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-5814-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALXDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLXLQAGFFLLTRI
LTIPQSLDSWWTSLNFPGVXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|JN604155_MHBs_P-A Product feature CHAIN JN604155_MHBs_P-A of FT:mat_peptide JN604155_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 480-0815-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLXFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWXWGPRLLNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604156_MHBs_P-A Product feature CHAIN JN604156_MHBs_P-A of FT:mat_peptide JN604156_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-5439-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604158_MHBs_P-A Product feature CHAIN JN604158_MHBs_P-A of FT:mat_peptide JN604158_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-9282-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604159_MHBs_P-A Product feature CHAIN JN604159_MHBs_P-A of FT:mat_peptide JN604159_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0176-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604160_MHBs_P-A Product feature CHAIN JN604160_MHBs_P-A of FT:mat_peptide JN604160_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-1175-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604162_MHBs_P-A Product feature CHAIN JN604162_MHBs_P-A of FT:mat_peptide JN604162_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-3509-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALRDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604163_MHBs_P-A Product feature CHAIN JN604163_MHBs_P-A of FT:mat_peptide JN604163_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-4838-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQTLQDPRARGLCPPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCFGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604164_MHBs_P-A Product feature CHAIN JN604164_MHBs_P-A of FT:mat_peptide JN604164_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-7898-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604165_MHBs_P-A Product feature CHAIN JN604165_MHBs_P-A of FT:mat_peptide JN604165_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-8501-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFXLLTRI
LTIPQSLDSWWTSLNFLGGPXVCLGQNSQSPTSNHSPTSCPPXCPGYRXMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWYWGPXLCXIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604167_MHBs_P-A Product feature CHAIN JN604167_MHBs_P-A of FT:mat_peptide JN604167_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9638-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604169_MHBs_P-A Product feature CHAIN JN604169_MHBs_P-A of FT:mat_peptide JN604169_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9866-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604171_MHBs_P-A Product feature CHAIN JN604171_MHBs_P-A of FT:mat_peptide JN604171_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0079-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604172_MHBs_P-A Product feature CHAIN JN604172_MHBs_P-A of FT:mat_peptide JN604172_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0232-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGXSPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604173_MHBs_P-A Product feature CHAIN JN604173_MHBs_P-A of FT:mat_peptide JN604173_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0370-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604176_MHBs_P-A Product feature CHAIN JN604176_MHBs_P-A of FT:mat_peptide JN604176_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-2959-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPPLVLQAGFFLLTRI
LTIXKSLDSWWTSLNFLGGXPECXGLNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSXIWMMWXWGPXLXXXXSPXXXLLPIFFCLWVYI
>gnl|hbvpro|JN604178_MHBs_P-A Product feature CHAIN JN604178_MHBs_P-A of FT:mat_peptide JN604178_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-5662-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604179_MHBs_P-A Product feature CHAIN JN604179_MHBs_P-A of FT:mat_peptide JN604179_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-6727-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604180_MHBs_P-A Product feature CHAIN JN604180_MHBs_P-A of FT:mat_peptide JN604180_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-6919-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604181_MHBs_P-A Product feature CHAIN JN604181_MHBs_P-A of FT:mat_peptide JN604181_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7570-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLMPGSTTTSTGPCKTCTTPAQGNSTLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604183_MHBs_P-A Product feature CHAIN JN604183_MHBs_P-A of FT:mat_peptide JN604183_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7954-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
TQWXXNAFXQDLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604184_MHBs_P-A Product feature CHAIN JN604184_MHBs_P-A of FT:mat_peptide JN604184_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8107-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604185_MHBs_P-A Product feature CHAIN JN604185_MHBs_P-A of FT:mat_peptide JN604185_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9112-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604186_MHBs_P-A Product feature CHAIN JN604186_MHBs_P-A of FT:mat_peptide JN604186_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-0588-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MLWNSTAFHQALQDPXVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAKNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLXFLGGSHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSKTXSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFGKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604188_MHBs_P-A Product feature CHAIN JN604188_MHBs_P-A of FT:mat_peptide JN604188_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2496-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLXPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQXFAG
LSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604190_MHBs_P-A Product feature CHAIN JN604190_MHBs_P-A of FT:mat_peptide JN604190_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-3516-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESLVCLGQNSQFPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPGLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604191_MHBs_P-A Product feature CHAIN JN604191_MHBs_P-A of FT:mat_peptide JN604191_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-4278-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604193_MHBs_P-A Product feature CHAIN JN604193_MHBs_P-A of FT:mat_peptide JN604193_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-8520-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTMPQSLDSWWTSLNFLGESPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPGLHHILSPCTPLLPIFFCLWVYI
>gnl|hbvpro|JN604194_MHBs_P-A Product feature CHAIN JN604194_MHBs_P-A of FT:mat_peptide JN604194_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-9228-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604197_MHBs_P-A Product feature CHAIN JN604197_MHBs_P-A of FT:mat_peptide JN604197_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-9048-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYRIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604200_MHBs_P-A Product feature CHAIN JN604200_MHBs_P-A of FT:mat_peptide JN604200_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-8111-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604204_MHBs_P-A Product feature CHAIN JN604204_MHBs_P-A of FT:mat_peptide JN604204_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9847-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604214_MHBs_P-A Product feature CHAIN JN604214_MHBs_P-A of FT:mat_peptide JN604214_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0581-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSXDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604216_MHBs_P-A Product feature CHAIN JN604216_MHBs_P-A of FT:mat_peptide JN604216_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-1244-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604217_MHBs_P-A Product feature CHAIN JN604217_MHBs_P-A of FT:mat_peptide JN604217_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2075-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604220_MHBs_P-A Product feature CHAIN JN604220_MHBs_P-A of FT:mat_peptide JN604220_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-3827-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGNPVTNMENITSGFLGPLLALQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMVP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPRLCSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|JN604227_MHBs_P-A Product feature CHAIN JN604227_MHBs_P-A of FT:mat_peptide JN604227_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-8192-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSAIWMMWYWGPSLYSIVRPFIPLXPIFFCLWVYI
>gnl|hbvpro|JN604228_MHBs_P-A Product feature CHAIN JN604228_MHBs_P-A of FT:mat_peptide JN604228_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9065-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604230_MHBs_P-A Product feature CHAIN JN604230_MHBs_P-A of FT:mat_peptide JN604230_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9296-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLXFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLXLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604236_MHBs_P-A Product feature CHAIN JN604236_MHBs_P-A of FT:mat_peptide JN604236_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-2347-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSXVSPFIXLLPIFFCLWVYI
>gnl|hbvpro|JN604237_MHBs_P-A Product feature CHAIN JN604237_MHBs_P-A of FT:mat_peptide JN604237_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-4279-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604240_MHBs_P-A Product feature CHAIN JN604240_MHBs_P-A of FT:mat_peptide JN604240_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8326-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604241_MHBs_P-A Product feature CHAIN JN604241_MHBs_P-A of FT:mat_peptide JN604241_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8404-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=283 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPQIPGSTTTTTSAGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWF
VGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|JN604242_MHBs_P-A Product feature CHAIN JN604242_MHBs_P-A of FT:mat_peptide JN604242_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9283-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604247_MHBs_P-A Product feature CHAIN JN604247_MHBs_P-A of FT:mat_peptide JN604247_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-1752-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604249_MHBs_P-A Product feature CHAIN JN604249_MHBs_P-A of FT:mat_peptide JN604249_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2196-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPECXGQNSQCPTSNHSPTSCPPTCPGYXWMCLRXFIIFLFILLXCLIFXLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMXFWGPSLYSIVRPFIPLXPIFXCLWVYI
>gnl|hbvpro|JN604251_MHBs_P-A Product feature CHAIN JN604251_MHBs_P-A of FT:mat_peptide JN604251_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2814-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRIRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWPLAIWMMWFWGPSLRNTLSPFIQLLPIFFCLWVYI
>gnl|hbvpro|JN604252_MHBs_P-A Product feature CHAIN JN604252_MHBs_P-A of FT:mat_peptide JN604252_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-5037-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604257_MHBs_P-A Product feature CHAIN JN604257_MHBs_P-A of FT:mat_peptide JN604257_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-7365-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604260_MHBs_P-A Product feature CHAIN JN604260_MHBs_P-A of FT:mat_peptide JN604260_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2324-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPXPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604261_MHBs_P-A Product feature CHAIN JN604261_MHBs_P-A of FT:mat_peptide JN604261_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2798-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604262_MHBs_P-A Product feature CHAIN JN604262_MHBs_P-A of FT:mat_peptide JN604262_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-5384-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604266_MHBs_P-A Product feature CHAIN JN604266_MHBs_P-A of FT:mat_peptide JN604266_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6438-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604268_MHBs_P-A Product feature CHAIN JN604268_MHBs_P-A of FT:mat_peptide JN604268_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6705-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604269_MHBs_P-A Product feature CHAIN JN604269_MHBs_P-A of FT:mat_peptide JN604269_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6804-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPXLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604270_MHBs_P-A Product feature CHAIN JN604270_MHBs_P-A of FT:mat_peptide JN604270_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6948-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604273_MHBs_P-A Product feature CHAIN JN604273_MHBs_P-A of FT:mat_peptide JN604273_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0248-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604274_MHBs_P-A Product feature CHAIN JN604274_MHBs_P-A of FT:mat_peptide JN604274_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0692-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604276_MHBs_P-A Product feature CHAIN JN604276_MHBs_P-A of FT:mat_peptide JN604276_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2270-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604277_MHBs_P-A Product feature CHAIN JN604277_MHBs_P-A of FT:mat_peptide JN604277_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2543-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604279_MHBs_P-A Product feature CHAIN JN604279_MHBs_P-A of FT:mat_peptide JN604279_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-3206-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604282_MHBs_P-A Product feature CHAIN JN604282_MHBs_P-A of FT:mat_peptide JN604282_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-7112-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604283_MHBs_P-A Product feature CHAIN JN604283_MHBs_P-A of FT:mat_peptide JN604283_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-7136-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604285_MHBs_P-A Product feature CHAIN JN604285_MHBs_P-A of FT:mat_peptide JN604285_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9002-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPXVXGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLGSLAGFXLLTRI
LTIPQSLDSWWTSLSFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVXLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVRPXTPLXPIFFCLWVYI
>gnl|hbvpro|JN604288_MHBs_P-A Product feature CHAIN JN604288_MHBs_P-A of FT:mat_peptide JN604288_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0727-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTVFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHXSSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604290_MHBs_P-A Product feature CHAIN JN604290_MHBs_P-A of FT:mat_peptide JN604290_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-2581-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFHFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
PSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLSIFFCLWVYI
>gnl|hbvpro|JN604291_MHBs_P-A Product feature CHAIN JN604291_MHBs_P-A of FT:mat_peptide JN604291_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-2956-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604292_MHBs_P-A Product feature CHAIN JN604292_MHBs_P-A of FT:mat_peptide JN604292_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-3070-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604293_MHBs_P-A Product feature CHAIN JN604293_MHBs_P-A of FT:mat_peptide JN604293_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-3721-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604294_MHBs_P-A Product feature CHAIN JN604294_MHBs_P-A of FT:mat_peptide JN604294_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-4030-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604297_MHBs_P-A Product feature CHAIN JN604297_MHBs_P-A of FT:mat_peptide JN604297_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-5893-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604298_MHBs_P-A Product feature CHAIN JN604298_MHBs_P-A of FT:mat_peptide JN604298_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7366-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604299_MHBs_P-A Product feature CHAIN JN604299_MHBs_P-A of FT:mat_peptide JN604299_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7384-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604300_MHBs_P-A Product feature CHAIN JN604300_MHBs_P-A of FT:mat_peptide JN604300_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7825-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPTIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604302_MHBs_P-A Product feature CHAIN JN604302_MHBs_P-A of FT:mat_peptide JN604302_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8782-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLGLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWFSAIWMMWYWGPSLRTIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604303_MHBs_P-A Product feature CHAIN JN604303_MHBs_P-A of FT:mat_peptide JN604303_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9523-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604304_MHBs_P-A Product feature CHAIN JN604304_MHBs_P-A of FT:mat_peptide JN604304_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9526-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604305_MHBs_P-A Product feature CHAIN JN604305_MHBs_P-A of FT:mat_peptide JN604305_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-0870-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISLISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSTXKPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604306_MHBs_P-A Product feature CHAIN JN604306_MHBs_P-A of FT:mat_peptide JN604306_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-3894-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604307_MHBs_P-A Product feature CHAIN JN604307_MHBs_P-A of FT:mat_peptide JN604307_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-4233-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604308_MHBs_P-A Product feature CHAIN JN604308_MHBs_P-A of FT:mat_peptide JN604308_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-4794-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKNPKVRGLYFPAGGSSSGTGNPAPNIASHISSISGRTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLCILLLCLICLLALLDYRGMLP
VCPLIPASTTTSTGPCKTCTTPAQGNSMFXSCCCTKPTDGNCTCTPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPXLXSIVSPFIPLLXIFFCLWVYI
>gnl|hbvpro|JN604309_MHBs_P-A Product feature CHAIN JN604309_MHBs_P-A of FT:mat_peptide JN604309_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-5013-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGSFLLTRI
LTIPQSLDLWWTSLNFPGGVPVCLGQNSQSPTSNHSPTSCPPTCPGYPWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604314_MHBs_P-A Product feature CHAIN JN604314_MHBs_P-A of FT:mat_peptide JN604314_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-8511-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTXI
LTIPQSLDSWWTSLXFLGGSXVCLGQNSQXPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWXMWXWGPXLXXIXXPFXPLLPIFFCLWVYI
>gnl|hbvpro|JN604315_MHBs_P-A Product feature CHAIN JN604315_MHBs_P-A of FT:mat_peptide JN604315_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-9174-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604317_MHBs_P-A Product feature CHAIN JN604317_MHBs_P-A of FT:mat_peptide JN604317_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 480-0314-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLXFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604319_MHBs_P-A Product feature CHAIN JN604319_MHBs_P-A of FT:mat_peptide JN604319_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 480-1418-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023660_MHBs_P-A Product feature CHAIN JQ023660_MHBs_P-A of FT:mat_peptide JQ023660_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGGPATNMENITSGFLGPLLVLQAGCFLLTKI
LTIPQSLDSWWTSLNFLGGPPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023661_MHBs_P-A Product feature CHAIN JQ023661_MHBs_P-A of FT:mat_peptide JQ023661_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIVSHISSISSRTGDPAPNMENITSGFLGPLLVLQAGCFLLTKI
LTIPQSLDSWWTSLNFLGGAPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LTPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023662_MHBs_P-A Product feature CHAIN JQ023662_MHBs_P-A of FT:mat_peptide JQ023662_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1164). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASLISSISSRTGGPATNMENITSGFLGPLLVLQAGCFLLTKI
LTIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLXLLDYQGMLP
VCPLIPGSTTTSTGPLQTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023663_MHBs_P-A Product feature CHAIN JQ023663_MHBs_P-A of FT:mat_peptide JQ023663_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1159). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ687529_MHBs_P-A Product feature CHAIN JQ687529_MHBs_P-A of FT:mat_peptide JQ687529_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ687533_MHBs_P-A Product feature CHAIN JQ687533_MHBs_P-A of FT:mat_peptide JQ687533_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707299_MHBs_P-A Product feature CHAIN JQ707299_MHBs_P-A of FT:mat_peptide JQ707299_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707300_MHBs_P-A Product feature CHAIN JQ707300_MHBs_P-A of FT:mat_peptide JQ707300_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISLISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707301_MHBs_P-A Product feature CHAIN JQ707301_MHBs_P-A of FT:mat_peptide JQ707301_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707302_MHBs_P-A Product feature CHAIN JQ707302_MHBs_P-A of FT:mat_peptide JQ707302_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707303_MHBs_P-A Product feature CHAIN JQ707303_MHBs_P-A of FT:mat_peptide JQ707303_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707304_MHBs_P-A Product feature CHAIN JQ707304_MHBs_P-A of FT:mat_peptide JQ707304_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707305_MHBs_P-A Product feature CHAIN JQ707305_MHBs_P-A of FT:mat_peptide JQ707305_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MKWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVPFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707307_MHBs_P-A Product feature CHAIN JQ707307_MHBs_P-A of FT:mat_peptide JQ707307_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707308_MHBs_P-A Product feature CHAIN JQ707308_MHBs_P-A of FT:mat_peptide JQ707308_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707309_MHBs_P-A Product feature CHAIN JQ707309_MHBs_P-A of FT:mat_peptide JQ707309_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707310_MHBs_P-A Product feature CHAIN JQ707310_MHBs_P-A of FT:mat_peptide JQ707310_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707311_MHBs_P-A Product feature CHAIN JQ707311_MHBs_P-A of FT:mat_peptide JQ707311_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707312_MHBs_P-A Product feature CHAIN JQ707312_MHBs_P-A of FT:mat_peptide JQ707312_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707313_MHBs_P-A Product feature CHAIN JQ707313_MHBs_P-A of FT:mat_peptide JQ707313_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707314_MHBs_P-A Product feature CHAIN JQ707314_MHBs_P-A of FT:mat_peptide JQ707314_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISLISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707315_MHBs_P-A Product feature CHAIN JQ707315_MHBs_P-A of FT:mat_peptide JQ707315_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707316_MHBs_P-A Product feature CHAIN JQ707316_MHBs_P-A of FT:mat_peptide JQ707316_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707317_MHBs_P-A Product feature CHAIN JQ707317_MHBs_P-A of FT:mat_peptide JQ707317_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707318_MHBs_P-A Product feature CHAIN JQ707318_MHBs_P-A of FT:mat_peptide JQ707318_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSAVFHQALQDPRVRGLYFPGGGSSSGTVNRAPNIASHISSISPRTGDPVRNVDNVTSVFKGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707319_MHBs_P-A Product feature CHAIN JQ707319_MHBs_P-A of FT:mat_peptide JQ707319_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDLRVRGLYFPAGGSSSGTVNPATNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707320_MHBs_P-A Product feature CHAIN JQ707320_MHBs_P-A of FT:mat_peptide JQ707320_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707321_MHBs_P-A Product feature CHAIN JQ707321_MHBs_P-A of FT:mat_peptide JQ707321_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707322_MHBs_P-A Product feature CHAIN JQ707322_MHBs_P-A of FT:mat_peptide JQ707322_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707323_MHBs_P-A Product feature CHAIN JQ707323_MHBs_P-A of FT:mat_peptide JQ707323_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707324_MHBs_P-A Product feature CHAIN JQ707324_MHBs_P-A of FT:mat_peptide JQ707324_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707325_MHBs_P-A Product feature CHAIN JQ707325_MHBs_P-A of FT:mat_peptide JQ707325_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTHAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707326_MHBs_P-A Product feature CHAIN JQ707326_MHBs_P-A of FT:mat_peptide JQ707326_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707328_MHBs_P-A Product feature CHAIN JQ707328_MHBs_P-A of FT:mat_peptide JQ707328_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707330_MHBs_P-A Product feature CHAIN JQ707330_MHBs_P-A of FT:mat_peptide JQ707330_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707331_MHBs_P-A Product feature CHAIN JQ707331_MHBs_P-A of FT:mat_peptide JQ707331_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707332_MHBs_P-A Product feature CHAIN JQ707332_MHBs_P-A of FT:mat_peptide JQ707332_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707333_MHBs_P-A Product feature CHAIN JQ707333_MHBs_P-A of FT:mat_peptide JQ707333_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707336_MHBs_P-A Product feature CHAIN JQ707336_MHBs_P-A of FT:mat_peptide JQ707336_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707337_MHBs_P-A Product feature CHAIN JQ707337_MHBs_P-A of FT:mat_peptide JQ707337_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707338_MHBs_P-A Product feature CHAIN JQ707338_MHBs_P-A of FT:mat_peptide JQ707338_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707339_MHBs_P-A Product feature CHAIN JQ707339_MHBs_P-A of FT:mat_peptide JQ707339_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGTCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707341_MHBs_P-A Product feature CHAIN JQ707341_MHBs_P-A of FT:mat_peptide JQ707341_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707342_MHBs_P-A Product feature CHAIN JQ707342_MHBs_P-A of FT:mat_peptide JQ707342_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707343_MHBs_P-A Product feature CHAIN JQ707343_MHBs_P-A of FT:mat_peptide JQ707343_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707344_MHBs_P-A Product feature CHAIN JQ707344_MHBs_P-A of FT:mat_peptide JQ707344_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707345_MHBs_P-A Product feature CHAIN JQ707345_MHBs_P-A of FT:mat_peptide JQ707345_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARIGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707346_MHBs_P-A Product feature CHAIN JQ707346_MHBs_P-A of FT:mat_peptide JQ707346_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707347_MHBs_P-A Product feature CHAIN JQ707347_MHBs_P-A of FT:mat_peptide JQ707347_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707348_MHBs_P-A Product feature CHAIN JQ707348_MHBs_P-A of FT:mat_peptide JQ707348_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707349_MHBs_P-A Product feature CHAIN JQ707349_MHBs_P-A of FT:mat_peptide JQ707349_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707350_MHBs_P-A Product feature CHAIN JQ707350_MHBs_P-A of FT:mat_peptide JQ707350_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707351_MHBs_P-A Product feature CHAIN JQ707351_MHBs_P-A of FT:mat_peptide JQ707351_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALKDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707352_MHBs_P-A Product feature CHAIN JQ707352_MHBs_P-A of FT:mat_peptide JQ707352_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707353_MHBs_P-A Product feature CHAIN JQ707353_MHBs_P-A of FT:mat_peptide JQ707353_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707354_MHBs_P-A Product feature CHAIN JQ707354_MHBs_P-A of FT:mat_peptide JQ707354_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707355_MHBs_P-A Product feature CHAIN JQ707355_MHBs_P-A of FT:mat_peptide JQ707355_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707356_MHBs_P-A Product feature CHAIN JQ707356_MHBs_P-A of FT:mat_peptide JQ707356_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707357_MHBs_P-A Product feature CHAIN JQ707357_MHBs_P-A of FT:mat_peptide JQ707357_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707358_MHBs_P-A Product feature CHAIN JQ707358_MHBs_P-A of FT:mat_peptide JQ707358_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFLCLWVYI
>gnl|hbvpro|JQ707359_MHBs_P-A Product feature CHAIN JQ707359_MHBs_P-A of FT:mat_peptide JQ707359_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707360_MHBs_P-A Product feature CHAIN JQ707360_MHBs_P-A of FT:mat_peptide JQ707360_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707361_MHBs_P-A Product feature CHAIN JQ707361_MHBs_P-A of FT:mat_peptide JQ707361_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707362_MHBs_P-A Product feature CHAIN JQ707362_MHBs_P-A of FT:mat_peptide JQ707362_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707363_MHBs_P-A Product feature CHAIN JQ707363_MHBs_P-A of FT:mat_peptide JQ707363_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707364_MHBs_P-A Product feature CHAIN JQ707364_MHBs_P-A of FT:mat_peptide JQ707364_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707365_MHBs_P-A Product feature CHAIN JQ707365_MHBs_P-A of FT:mat_peptide JQ707365_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707366_MHBs_P-A Product feature CHAIN JQ707366_MHBs_P-A of FT:mat_peptide JQ707366_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707367_MHBs_P-A Product feature CHAIN JQ707367_MHBs_P-A of FT:mat_peptide JQ707367_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707368_MHBs_P-A Product feature CHAIN JQ707368_MHBs_P-A of FT:mat_peptide JQ707368_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707369_MHBs_P-A Product feature CHAIN JQ707369_MHBs_P-A of FT:mat_peptide JQ707369_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707370_MHBs_P-A Product feature CHAIN JQ707370_MHBs_P-A of FT:mat_peptide JQ707370_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707371_MHBs_P-A Product feature CHAIN JQ707371_MHBs_P-A of FT:mat_peptide JQ707371_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707372_MHBs_P-A Product feature CHAIN JQ707372_MHBs_P-A of FT:mat_peptide JQ707372_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTATSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCVPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707373_MHBs_P-A Product feature CHAIN JQ707373_MHBs_P-A of FT:mat_peptide JQ707373_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707374_MHBs_P-A Product feature CHAIN JQ707374_MHBs_P-A of FT:mat_peptide JQ707374_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNVENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707375_MHBs_P-A Product feature CHAIN JQ707375_MHBs_P-A of FT:mat_peptide JQ707375_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707376_MHBs_P-A Product feature CHAIN JQ707376_MHBs_P-A of FT:mat_peptide JQ707376_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707377_MHBs_P-A Product feature CHAIN JQ707377_MHBs_P-A of FT:mat_peptide JQ707377_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707378_MHBs_P-A Product feature CHAIN JQ707378_MHBs_P-A of FT:mat_peptide JQ707378_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707379_MHBs_P-A Product feature CHAIN JQ707379_MHBs_P-A of FT:mat_peptide JQ707379_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707380_MHBs_P-A Product feature CHAIN JQ707380_MHBs_P-A of FT:mat_peptide JQ707380_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707381_MHBs_P-A Product feature CHAIN JQ707381_MHBs_P-A of FT:mat_peptide JQ707381_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707382_MHBs_P-A Product feature CHAIN JQ707382_MHBs_P-A of FT:mat_peptide JQ707382_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707383_MHBs_P-A Product feature CHAIN JQ707383_MHBs_P-A of FT:mat_peptide JQ707383_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707385_MHBs_P-A Product feature CHAIN JQ707385_MHBs_P-A of FT:mat_peptide JQ707385_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707386_MHBs_P-A Product feature CHAIN JQ707386_MHBs_P-A of FT:mat_peptide JQ707386_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707387_MHBs_P-A Product feature CHAIN JQ707387_MHBs_P-A of FT:mat_peptide JQ707387_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707388_MHBs_P-A Product feature CHAIN JQ707388_MHBs_P-A of FT:mat_peptide JQ707388_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNATAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707389_MHBs_P-A Product feature CHAIN JQ707389_MHBs_P-A of FT:mat_peptide JQ707389_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707390_MHBs_P-A Product feature CHAIN JQ707390_MHBs_P-A of FT:mat_peptide JQ707390_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707391_MHBs_P-A Product feature CHAIN JQ707391_MHBs_P-A of FT:mat_peptide JQ707391_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLSPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707392_MHBs_P-A Product feature CHAIN JQ707392_MHBs_P-A of FT:mat_peptide JQ707392_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707393_MHBs_P-A Product feature CHAIN JQ707393_MHBs_P-A of FT:mat_peptide JQ707393_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707394_MHBs_P-A Product feature CHAIN JQ707394_MHBs_P-A of FT:mat_peptide JQ707394_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707395_MHBs_P-A Product feature CHAIN JQ707395_MHBs_P-A of FT:mat_peptide JQ707395_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707396_MHBs_P-A Product feature CHAIN JQ707396_MHBs_P-A of FT:mat_peptide JQ707396_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707397_MHBs_P-A Product feature CHAIN JQ707397_MHBs_P-A of FT:mat_peptide JQ707397_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707398_MHBs_P-A Product feature CHAIN JQ707398_MHBs_P-A of FT:mat_peptide JQ707398_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNTASHISSISARTGDPVTNMVNITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707399_MHBs_P-A Product feature CHAIN JQ707399_MHBs_P-A of FT:mat_peptide JQ707399_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707400_MHBs_P-A Product feature CHAIN JQ707400_MHBs_P-A of FT:mat_peptide JQ707400_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707402_MHBs_P-A Product feature CHAIN JQ707402_MHBs_P-A of FT:mat_peptide JQ707402_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707403_MHBs_P-A Product feature CHAIN JQ707403_MHBs_P-A of FT:mat_peptide JQ707403_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707404_MHBs_P-A Product feature CHAIN JQ707404_MHBs_P-A of FT:mat_peptide JQ707404_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707405_MHBs_P-A Product feature CHAIN JQ707405_MHBs_P-A of FT:mat_peptide JQ707405_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707406_MHBs_P-A Product feature CHAIN JQ707406_MHBs_P-A of FT:mat_peptide JQ707406_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHLALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707407_MHBs_P-A Product feature CHAIN JQ707407_MHBs_P-A of FT:mat_peptide JQ707407_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707408_MHBs_P-A Product feature CHAIN JQ707408_MHBs_P-A of FT:mat_peptide JQ707408_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707409_MHBs_P-A Product feature CHAIN JQ707409_MHBs_P-A of FT:mat_peptide JQ707409_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707410_MHBs_P-A Product feature CHAIN JQ707410_MHBs_P-A of FT:mat_peptide JQ707410_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707411_MHBs_P-A Product feature CHAIN JQ707411_MHBs_P-A of FT:mat_peptide JQ707411_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707412_MHBs_P-A Product feature CHAIN JQ707412_MHBs_P-A of FT:mat_peptide JQ707412_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707413_MHBs_P-A Product feature CHAIN JQ707413_MHBs_P-A of FT:mat_peptide JQ707413_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707414_MHBs_P-A Product feature CHAIN JQ707414_MHBs_P-A of FT:mat_peptide JQ707414_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707415_MHBs_P-A Product feature CHAIN JQ707415_MHBs_P-A of FT:mat_peptide JQ707415_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707416_MHBs_P-A Product feature CHAIN JQ707416_MHBs_P-A of FT:mat_peptide JQ707416_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707417_MHBs_P-A Product feature CHAIN JQ707417_MHBs_P-A of FT:mat_peptide JQ707417_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707418_MHBs_P-A Product feature CHAIN JQ707418_MHBs_P-A of FT:mat_peptide JQ707418_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707419_MHBs_P-A Product feature CHAIN JQ707419_MHBs_P-A of FT:mat_peptide JQ707419_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707420_MHBs_P-A Product feature CHAIN JQ707420_MHBs_P-A of FT:mat_peptide JQ707420_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707531_MHBs_P-A Product feature CHAIN JQ707531_MHBs_P-A of FT:mat_peptide JQ707531_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707532_MHBs_P-A Product feature CHAIN JQ707532_MHBs_P-A of FT:mat_peptide JQ707532_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSKTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFYLWVYI
>gnl|hbvpro|JQ707533_MHBs_P-A Product feature CHAIN JQ707533_MHBs_P-A of FT:mat_peptide JQ707533_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707534_MHBs_P-A Product feature CHAIN JQ707534_MHBs_P-A of FT:mat_peptide JQ707534_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707535_MHBs_P-A Product feature CHAIN JQ707535_MHBs_P-A of FT:mat_peptide JQ707535_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707536_MHBs_P-A Product feature CHAIN JQ707536_MHBs_P-A of FT:mat_peptide JQ707536_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSKTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707537_MHBs_P-A Product feature CHAIN JQ707537_MHBs_P-A of FT:mat_peptide JQ707537_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707538_MHBs_P-A Product feature CHAIN JQ707538_MHBs_P-A of FT:mat_peptide JQ707538_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707539_MHBs_P-A Product feature CHAIN JQ707539_MHBs_P-A of FT:mat_peptide JQ707539_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707540_MHBs_P-A Product feature CHAIN JQ707540_MHBs_P-A of FT:mat_peptide JQ707540_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707541_MHBs_P-A Product feature CHAIN JQ707541_MHBs_P-A of FT:mat_peptide JQ707541_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPQIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707542_MHBs_P-A Product feature CHAIN JQ707542_MHBs_P-A of FT:mat_peptide JQ707542_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707543_MHBs_P-A Product feature CHAIN JQ707543_MHBs_P-A of FT:mat_peptide JQ707543_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707544_MHBs_P-A Product feature CHAIN JQ707544_MHBs_P-A of FT:mat_peptide JQ707544_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707545_MHBs_P-A Product feature CHAIN JQ707545_MHBs_P-A of FT:mat_peptide JQ707545_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707546_MHBs_P-A Product feature CHAIN JQ707546_MHBs_P-A of FT:mat_peptide JQ707546_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707547_MHBs_P-A Product feature CHAIN JQ707547_MHBs_P-A of FT:mat_peptide JQ707547_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSLWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPVIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707548_MHBs_P-A Product feature CHAIN JQ707548_MHBs_P-A of FT:mat_peptide JQ707548_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707549_MHBs_P-A Product feature CHAIN JQ707549_MHBs_P-A of FT:mat_peptide JQ707549_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707550_MHBs_P-A Product feature CHAIN JQ707550_MHBs_P-A of FT:mat_peptide JQ707550_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFAQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707551_MHBs_P-A Product feature CHAIN JQ707551_MHBs_P-A of FT:mat_peptide JQ707551_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707552_MHBs_P-A Product feature CHAIN JQ707552_MHBs_P-A of FT:mat_peptide JQ707552_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707553_MHBs_P-A Product feature CHAIN JQ707553_MHBs_P-A of FT:mat_peptide JQ707553_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707554_MHBs_P-A Product feature CHAIN JQ707554_MHBs_P-A of FT:mat_peptide JQ707554_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707555_MHBs_P-A Product feature CHAIN JQ707555_MHBs_P-A of FT:mat_peptide JQ707555_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707556_MHBs_P-A Product feature CHAIN JQ707556_MHBs_P-A of FT:mat_peptide JQ707556_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707557_MHBs_P-A Product feature CHAIN JQ707557_MHBs_P-A of FT:mat_peptide JQ707557_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707558_MHBs_P-A Product feature CHAIN JQ707558_MHBs_P-A of FT:mat_peptide JQ707558_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707559_MHBs_P-A Product feature CHAIN JQ707559_MHBs_P-A of FT:mat_peptide JQ707559_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707560_MHBs_P-A Product feature CHAIN JQ707560_MHBs_P-A of FT:mat_peptide JQ707560_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707561_MHBs_P-A Product feature CHAIN JQ707561_MHBs_P-A of FT:mat_peptide JQ707561_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDLVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707562_MHBs_P-A Product feature CHAIN JQ707562_MHBs_P-A of FT:mat_peptide JQ707562_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707563_MHBs_P-A Product feature CHAIN JQ707563_MHBs_P-A of FT:mat_peptide JQ707563_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707564_MHBs_P-A Product feature CHAIN JQ707564_MHBs_P-A of FT:mat_peptide JQ707564_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707565_MHBs_P-A Product feature CHAIN JQ707565_MHBs_P-A of FT:mat_peptide JQ707565_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707566_MHBs_P-A Product feature CHAIN JQ707566_MHBs_P-A of FT:mat_peptide JQ707566_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707567_MHBs_P-A Product feature CHAIN JQ707567_MHBs_P-A of FT:mat_peptide JQ707567_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707568_MHBs_P-A Product feature CHAIN JQ707568_MHBs_P-A of FT:mat_peptide JQ707568_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707569_MHBs_P-A Product feature CHAIN JQ707569_MHBs_P-A of FT:mat_peptide JQ707569_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707570_MHBs_P-A Product feature CHAIN JQ707570_MHBs_P-A of FT:mat_peptide JQ707570_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707571_MHBs_P-A Product feature CHAIN JQ707571_MHBs_P-A of FT:mat_peptide JQ707571_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707572_MHBs_P-A Product feature CHAIN JQ707572_MHBs_P-A of FT:mat_peptide JQ707572_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707573_MHBs_P-A Product feature CHAIN JQ707573_MHBs_P-A of FT:mat_peptide JQ707573_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLR
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707575_MHBs_P-A Product feature CHAIN JQ707575_MHBs_P-A of FT:mat_peptide JQ707575_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707576_MHBs_P-A Product feature CHAIN JQ707576_MHBs_P-A of FT:mat_peptide JQ707576_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLNFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707577_MHBs_P-A Product feature CHAIN JQ707577_MHBs_P-A of FT:mat_peptide JQ707577_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLPAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707578_MHBs_P-A Product feature CHAIN JQ707578_MHBs_P-A of FT:mat_peptide JQ707578_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMIPYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707579_MHBs_P-A Product feature CHAIN JQ707579_MHBs_P-A of FT:mat_peptide JQ707579_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707580_MHBs_P-A Product feature CHAIN JQ707580_MHBs_P-A of FT:mat_peptide JQ707580_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFGLWVYI
>gnl|hbvpro|JQ707581_MHBs_P-A Product feature CHAIN JQ707581_MHBs_P-A of FT:mat_peptide JQ707581_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTEPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707583_MHBs_P-A Product feature CHAIN JQ707583_MHBs_P-A of FT:mat_peptide JQ707583_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMISYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707585_MHBs_P-A Product feature CHAIN JQ707585_MHBs_P-A of FT:mat_peptide JQ707585_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707586_MHBs_P-A Product feature CHAIN JQ707586_MHBs_P-A of FT:mat_peptide JQ707586_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707587_MHBs_P-A Product feature CHAIN JQ707587_MHBs_P-A of FT:mat_peptide JQ707587_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707589_MHBs_P-A Product feature CHAIN JQ707589_MHBs_P-A of FT:mat_peptide JQ707589_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPIVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707590_MHBs_P-A Product feature CHAIN JQ707590_MHBs_P-A of FT:mat_peptide JQ707590_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAMWMMWYWAPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707592_MHBs_P-A Product feature CHAIN JQ707592_MHBs_P-A of FT:mat_peptide JQ707592_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707594_MHBs_P-A Product feature CHAIN JQ707594_MHBs_P-A of FT:mat_peptide JQ707594_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707595_MHBs_P-A Product feature CHAIN JQ707595_MHBs_P-A of FT:mat_peptide JQ707595_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLNFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCPWVYI
>gnl|hbvpro|JQ707596_MHBs_P-A Product feature CHAIN JQ707596_MHBs_P-A of FT:mat_peptide JQ707596_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYPWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707599_MHBs_P-A Product feature CHAIN JQ707599_MHBs_P-A of FT:mat_peptide JQ707599_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707601_MHBs_P-A Product feature CHAIN JQ707601_MHBs_P-A of FT:mat_peptide JQ707601_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYT
>gnl|hbvpro|JQ707603_MHBs_P-A Product feature CHAIN JQ707603_MHBs_P-A of FT:mat_peptide JQ707603_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPHVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707604_MHBs_P-A Product feature CHAIN JQ707604_MHBs_P-A of FT:mat_peptide JQ707604_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDHVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWPSAIWMISYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707605_MHBs_P-A Product feature CHAIN JQ707605_MHBs_P-A of FT:mat_peptide JQ707605_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARSGDPVTNMENITSGGLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707606_MHBs_P-A Product feature CHAIN JQ707606_MHBs_P-A of FT:mat_peptide JQ707606_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707607_MHBs_P-A Product feature CHAIN JQ707607_MHBs_P-A of FT:mat_peptide JQ707607_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707608_MHBs_P-A Product feature CHAIN JQ707608_MHBs_P-A of FT:mat_peptide JQ707608_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707609_MHBs_P-A Product feature CHAIN JQ707609_MHBs_P-A of FT:mat_peptide JQ707609_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707610_MHBs_P-A Product feature CHAIN JQ707610_MHBs_P-A of FT:mat_peptide JQ707610_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707611_MHBs_P-A Product feature CHAIN JQ707611_MHBs_P-A of FT:mat_peptide JQ707611_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707612_MHBs_P-A Product feature CHAIN JQ707612_MHBs_P-A of FT:mat_peptide JQ707612_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707613_MHBs_P-A Product feature CHAIN JQ707613_MHBs_P-A of FT:mat_peptide JQ707613_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707614_MHBs_P-A Product feature CHAIN JQ707614_MHBs_P-A of FT:mat_peptide JQ707614_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707615_MHBs_P-A Product feature CHAIN JQ707615_MHBs_P-A of FT:mat_peptide JQ707615_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707616_MHBs_P-A Product feature CHAIN JQ707616_MHBs_P-A of FT:mat_peptide JQ707616_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707617_MHBs_P-A Product feature CHAIN JQ707617_MHBs_P-A of FT:mat_peptide JQ707617_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707618_MHBs_P-A Product feature CHAIN JQ707618_MHBs_P-A of FT:mat_peptide JQ707618_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707619_MHBs_P-A Product feature CHAIN JQ707619_MHBs_P-A of FT:mat_peptide JQ707619_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707620_MHBs_P-A Product feature CHAIN JQ707620_MHBs_P-A of FT:mat_peptide JQ707620_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707621_MHBs_P-A Product feature CHAIN JQ707621_MHBs_P-A of FT:mat_peptide JQ707621_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707622_MHBs_P-A Product feature CHAIN JQ707622_MHBs_P-A of FT:mat_peptide JQ707622_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707623_MHBs_P-A Product feature CHAIN JQ707623_MHBs_P-A of FT:mat_peptide JQ707623_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707624_MHBs_P-A Product feature CHAIN JQ707624_MHBs_P-A of FT:mat_peptide JQ707624_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707625_MHBs_P-A Product feature CHAIN JQ707625_MHBs_P-A of FT:mat_peptide JQ707625_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707626_MHBs_P-A Product feature CHAIN JQ707626_MHBs_P-A of FT:mat_peptide JQ707626_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707627_MHBs_P-A Product feature CHAIN JQ707627_MHBs_P-A of FT:mat_peptide JQ707627_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707629_MHBs_P-A Product feature CHAIN JQ707629_MHBs_P-A of FT:mat_peptide JQ707629_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707630_MHBs_P-A Product feature CHAIN JQ707630_MHBs_P-A of FT:mat_peptide JQ707630_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707631_MHBs_P-A Product feature CHAIN JQ707631_MHBs_P-A of FT:mat_peptide JQ707631_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707632_MHBs_P-A Product feature CHAIN JQ707632_MHBs_P-A of FT:mat_peptide JQ707632_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707633_MHBs_P-A Product feature CHAIN JQ707633_MHBs_P-A of FT:mat_peptide JQ707633_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707634_MHBs_P-A Product feature CHAIN JQ707634_MHBs_P-A of FT:mat_peptide JQ707634_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707635_MHBs_P-A Product feature CHAIN JQ707635_MHBs_P-A of FT:mat_peptide JQ707635_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707636_MHBs_P-A Product feature CHAIN JQ707636_MHBs_P-A of FT:mat_peptide JQ707636_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707637_MHBs_P-A Product feature CHAIN JQ707637_MHBs_P-A of FT:mat_peptide JQ707637_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707638_MHBs_P-A Product feature CHAIN JQ707638_MHBs_P-A of FT:mat_peptide JQ707638_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707639_MHBs_P-A Product feature CHAIN JQ707639_MHBs_P-A of FT:mat_peptide JQ707639_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707640_MHBs_P-A Product feature CHAIN JQ707640_MHBs_P-A of FT:mat_peptide JQ707640_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHTSSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707641_MHBs_P-A Product feature CHAIN JQ707641_MHBs_P-A of FT:mat_peptide JQ707641_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707642_MHBs_P-A Product feature CHAIN JQ707642_MHBs_P-A of FT:mat_peptide JQ707642_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707643_MHBs_P-A Product feature CHAIN JQ707643_MHBs_P-A of FT:mat_peptide JQ707643_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707644_MHBs_P-A Product feature CHAIN JQ707644_MHBs_P-A of FT:mat_peptide JQ707644_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707645_MHBs_P-A Product feature CHAIN JQ707645_MHBs_P-A of FT:mat_peptide JQ707645_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707646_MHBs_P-A Product feature CHAIN JQ707646_MHBs_P-A of FT:mat_peptide JQ707646_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707647_MHBs_P-A Product feature CHAIN JQ707647_MHBs_P-A of FT:mat_peptide JQ707647_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707648_MHBs_P-A Product feature CHAIN JQ707648_MHBs_P-A of FT:mat_peptide JQ707648_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707649_MHBs_P-A Product feature CHAIN JQ707649_MHBs_P-A of FT:mat_peptide JQ707649_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707650_MHBs_P-A Product feature CHAIN JQ707650_MHBs_P-A of FT:mat_peptide JQ707650_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707651_MHBs_P-A Product feature CHAIN JQ707651_MHBs_P-A of FT:mat_peptide JQ707651_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707652_MHBs_P-A Product feature CHAIN JQ707652_MHBs_P-A of FT:mat_peptide JQ707652_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707653_MHBs_P-A Product feature CHAIN JQ707653_MHBs_P-A of FT:mat_peptide JQ707653_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707654_MHBs_P-A Product feature CHAIN JQ707654_MHBs_P-A of FT:mat_peptide JQ707654_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707655_MHBs_P-A Product feature CHAIN JQ707655_MHBs_P-A of FT:mat_peptide JQ707655_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707656_MHBs_P-A Product feature CHAIN JQ707656_MHBs_P-A of FT:mat_peptide JQ707656_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707658_MHBs_P-A Product feature CHAIN JQ707658_MHBs_P-A of FT:mat_peptide JQ707658_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707659_MHBs_P-A Product feature CHAIN JQ707659_MHBs_P-A of FT:mat_peptide JQ707659_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707661_MHBs_P-A Product feature CHAIN JQ707661_MHBs_P-A of FT:mat_peptide JQ707661_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707662_MHBs_P-A Product feature CHAIN JQ707662_MHBs_P-A of FT:mat_peptide JQ707662_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707663_MHBs_P-A Product feature CHAIN JQ707663_MHBs_P-A of FT:mat_peptide JQ707663_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VYPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707664_MHBs_P-A Product feature CHAIN JQ707664_MHBs_P-A of FT:mat_peptide JQ707664_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707665_MHBs_P-A Product feature CHAIN JQ707665_MHBs_P-A of FT:mat_peptide JQ707665_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707667_MHBs_P-A Product feature CHAIN JQ707667_MHBs_P-A of FT:mat_peptide JQ707667_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707669_MHBs_P-A Product feature CHAIN JQ707669_MHBs_P-A of FT:mat_peptide JQ707669_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707670_MHBs_P-A Product feature CHAIN JQ707670_MHBs_P-A of FT:mat_peptide JQ707670_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707672_MHBs_P-A Product feature CHAIN JQ707672_MHBs_P-A of FT:mat_peptide JQ707672_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707674_MHBs_P-A Product feature CHAIN JQ707674_MHBs_P-A of FT:mat_peptide JQ707674_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707675_MHBs_P-A Product feature CHAIN JQ707675_MHBs_P-A of FT:mat_peptide JQ707675_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707676_MHBs_P-A Product feature CHAIN JQ707676_MHBs_P-A of FT:mat_peptide JQ707676_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIAFHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707681_MHBs_P-A Product feature CHAIN JQ707681_MHBs_P-A of FT:mat_peptide JQ707681_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX096952_MHBs_P-A Product feature CHAIN JX096952_MHBs_P-A of FT:mat_peptide JX096952_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX096953_MHBs_P-A Product feature CHAIN JX096953_MHBs_P-A of FT:mat_peptide JX096953_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX125364_MHBs_P-A Product feature CHAIN JX125364_MHBs_P-A of FT:mat_peptide JX125364_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I-NUK622). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPAPTTVSHISSIFSRIGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX125367_MHBs_P-A Product feature CHAIN JX125367_MHBs_P-A of FT:mat_peptide JX125367_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Y-PUR1550). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSVTTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX125368_MHBs_P-A Product feature CHAIN JX125368_MHBs_P-A of FT:mat_peptide JX125368_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Y-PUR333). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALHDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGESTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154579_MHBs_P-A Product feature CHAIN JX154579_MHBs_P-A of FT:mat_peptide JX154579_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLNFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154580_MHBs_P-A Product feature CHAIN JX154580_MHBs_P-A of FT:mat_peptide JX154580_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154581_MHBs_P-A Product feature CHAIN JX154581_MHBs_P-A of FT:mat_peptide JX154581_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154582_MHBs_P-A Product feature CHAIN JX154582_MHBs_P-A of FT:mat_peptide JX154582_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310721_MHBs_P-A Product feature CHAIN JX310721_MHBs_P-A of FT:mat_peptide JX310721_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310722_MHBs_P-A Product feature CHAIN JX310722_MHBs_P-A of FT:mat_peptide JX310722_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVSFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310723_MHBs_P-A Product feature CHAIN JX310723_MHBs_P-A of FT:mat_peptide JX310723_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSALLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310724_MHBs_P-A Product feature CHAIN JX310724_MHBs_P-A of FT:mat_peptide JX310724_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310725_MHBs_P-A Product feature CHAIN JX310725_MHBs_P-A of FT:mat_peptide JX310725_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310730_MHBs_P-A Product feature CHAIN JX310730_MHBs_P-A of FT:mat_peptide JX310730_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTAWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310731_MHBs_P-A Product feature CHAIN JX310731_MHBs_P-A of FT:mat_peptide JX310731_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310732_MHBs_P-A Product feature CHAIN JX310732_MHBs_P-A of FT:mat_peptide JX310732_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875260_MHBs_P-A Product feature CHAIN KC875260_MHBs_P-A of FT:mat_peptide KC875260_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170754_MHBs_P-A Product feature CHAIN KF170754_MHBs_P-A of FT:mat_peptide KF170754_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SDAC_113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
TQWNSTDFHQALQDPRVRGLYFPVGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF214657_MHBs_P-A Product feature CHAIN KF214657_MHBs_P-A of FT:mat_peptide KF214657_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQEGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF214659_MHBs_P-A Product feature CHAIN KF214659_MHBs_P-A of FT:mat_peptide KF214659_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGLLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF214660_MHBs_P-A Product feature CHAIN KF214660_MHBs_P-A of FT:mat_peptide KF214660_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTHNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF214661_MHBs_P-A Product feature CHAIN KF214661_MHBs_P-A of FT:mat_peptide KF214661_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KF214662_MHBs_P-A Product feature CHAIN KF214662_MHBs_P-A of FT:mat_peptide KF214662_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=281 residues).
AQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSKIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPYVQWFVG
LSPTVWLSAIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF214663_MHBs_P-A Product feature CHAIN KF214663_MHBs_P-A of FT:mat_peptide KF214663_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF214665_MHBs_P-A Product feature CHAIN KF214665_MHBs_P-A of FT:mat_peptide KF214665_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPAFHQALQDPRVRGLYVPAGGSSSKTLNPVPTIASHISSISSRIGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF214666_MHBs_P-A Product feature CHAIN KF214666_MHBs_P-A of FT:mat_peptide KF214666_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSHFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475982_MHBs_P-A Product feature CHAIN KF475982_MHBs_P-A of FT:mat_peptide KF475982_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A223.6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWVCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475983_MHBs_P-A Product feature CHAIN KF475983_MHBs_P-A of FT:mat_peptide KF475983_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A300.15). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475984_MHBs_P-A Product feature CHAIN KF475984_MHBs_P-A of FT:mat_peptide KF475984_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1726296.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTASTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWALARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475985_MHBs_P-A Product feature CHAIN KF475985_MHBs_P-A of FT:mat_peptide KF475985_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B476.8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALRDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475986_MHBs_P-A Product feature CHAIN KF475986_MHBs_P-A of FT:mat_peptide KF475986_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A3110.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475987_MHBs_P-A Product feature CHAIN KF475987_MHBs_P-A of FT:mat_peptide KF475987_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A38.30). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475988_MHBs_P-A Product feature CHAIN KF475988_MHBs_P-A of FT:mat_peptide KF475988_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A104.31). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475989_MHBs_P-A Product feature CHAIN KF475989_MHBs_P-A of FT:mat_peptide KF475989_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A461.5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475990_MHBs_P-A Product feature CHAIN KF475990_MHBs_P-A of FT:mat_peptide KF475990_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1422.34). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475991_MHBs_P-A Product feature CHAIN KF475991_MHBs_P-A of FT:mat_peptide KF475991_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A131.37). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWASLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475992_MHBs_P-A Product feature CHAIN KF475992_MHBs_P-A of FT:mat_peptide KF475992_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A37575.2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475993_MHBs_P-A Product feature CHAIN KF475993_MHBs_P-A of FT:mat_peptide KF475993_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A234.18). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLARI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475994_MHBs_P-A Product feature CHAIN KF475994_MHBs_P-A of FT:mat_peptide KF475994_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A74.23). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWRTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCYCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475995_MHBs_P-A Product feature CHAIN KF475995_MHBs_P-A of FT:mat_peptide KF475995_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A456.6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475996_MHBs_P-A Product feature CHAIN KF475996_MHBs_P-A of FT:mat_peptide KF475996_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A398.5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIMFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475997_MHBs_P-A Product feature CHAIN KF475997_MHBs_P-A of FT:mat_peptide KF475997_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A24N.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENVTSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475998_MHBs_P-A Product feature CHAIN KF475998_MHBs_P-A of FT:mat_peptide KF475998_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A129.32). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF475999_MHBs_P-A Product feature CHAIN KF475999_MHBs_P-A of FT:mat_peptide KF475999_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A281.5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476000_MHBs_P-A Product feature CHAIN KF476000_MHBs_P-A of FT:mat_peptide KF476000_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A764.10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISAGTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476001_MHBs_P-A Product feature CHAIN KF476001_MHBs_P-A of FT:mat_peptide KF476001_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A227.21). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476002_MHBs_P-A Product feature CHAIN KF476002_MHBs_P-A of FT:mat_peptide KF476002_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A767.43). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGPVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDPWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQDNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476003_MHBs_P-A Product feature CHAIN KF476003_MHBs_P-A of FT:mat_peptide KF476003_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A324.4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476004_MHBs_P-A Product feature CHAIN KF476004_MHBs_P-A of FT:mat_peptide KF476004_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B313.4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476005_MHBs_P-A Product feature CHAIN KF476005_MHBs_P-A of FT:mat_peptide KF476005_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A648.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTIWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476006_MHBs_P-A Product feature CHAIN KF476006_MHBs_P-A of FT:mat_peptide KF476006_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A274.8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPIRPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLPVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476007_MHBs_P-A Product feature CHAIN KF476007_MHBs_P-A of FT:mat_peptide KF476007_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1061.8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMVWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476008_MHBs_P-A Product feature CHAIN KF476008_MHBs_P-A of FT:mat_peptide KF476008_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A53.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPSIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTPNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476009_MHBs_P-A Product feature CHAIN KF476009_MHBs_P-A of FT:mat_peptide KF476009_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1074.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476010_MHBs_P-A Product feature CHAIN KF476010_MHBs_P-A of FT:mat_peptide KF476010_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A106.5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476011_MHBs_P-A Product feature CHAIN KF476011_MHBs_P-A of FT:mat_peptide KF476011_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A757.4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476012_MHBs_P-A Product feature CHAIN KF476012_MHBs_P-A of FT:mat_peptide KF476012_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A393.4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGGPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGLPVCLGQNSQSPTSNRSPTSCPPICPGYRWMCLRRFTIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476013_MHBs_P-A Product feature CHAIN KF476013_MHBs_P-A of FT:mat_peptide KF476013_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A7270.1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISPISARTGDPVTNVENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGSCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476014_MHBs_P-A Product feature CHAIN KF476014_MHBs_P-A of FT:mat_peptide KF476014_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1811995.6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNNASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVGPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476015_MHBs_P-A Product feature CHAIN KF476015_MHBs_P-A of FT:mat_peptide KF476015_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B18661137.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTCTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476016_MHBs_P-A Product feature CHAIN KF476016_MHBs_P-A of FT:mat_peptide KF476016_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A831.2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISARTGDPALNMENVTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMWLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476017_MHBs_P-A Product feature CHAIN KF476017_MHBs_P-A of FT:mat_peptide KF476017_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 660.2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|KF476018_MHBs_P-A Product feature CHAIN KF476018_MHBs_P-A of FT:mat_peptide KF476018_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B203.7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPAPNTASHISSISSKTGDPALNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCHGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476020_MHBs_P-A Product feature CHAIN KF476020_MHBs_P-A of FT:mat_peptide KF476020_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B53MX.15). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMSPSCCCTKPTGGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476021_MHBs_P-A Product feature CHAIN KF476021_MHBs_P-A of FT:mat_peptide KF476021_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B1016.13). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476022_MHBs_P-A Product feature CHAIN KF476022_MHBs_P-A of FT:mat_peptide KF476022_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B249.1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYRGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476023_MHBs_P-A Product feature CHAIN KF476023_MHBs_P-A of FT:mat_peptide KF476023_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B448.3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFRRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTPCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476024_MHBs_P-A Product feature CHAIN KF476024_MHBs_P-A of FT:mat_peptide KF476024_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 280.7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTRIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476025_MHBs_P-A Product feature CHAIN KF476025_MHBs_P-A of FT:mat_peptide KF476025_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B474.6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476026_MHBs_P-A Product feature CHAIN KF476026_MHBs_P-A of FT:mat_peptide KF476026_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B781.6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSSPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF476027_MHBs_P-A Product feature CHAIN KF476027_MHBs_P-A of FT:mat_peptide KF476027_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B865.4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779210_MHBs_P-A Product feature CHAIN KF779210_MHBs_P-A of FT:mat_peptide KF779210_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5547). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQPLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779211_MHBs_P-A Product feature CHAIN KF779211_MHBs_P-A of FT:mat_peptide KF779211_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5691). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQPLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAILMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779213_MHBs_P-A Product feature CHAIN KF779213_MHBs_P-A of FT:mat_peptide KF779213_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5744). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LPPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779215_MHBs_P-A Product feature CHAIN KF779215_MHBs_P-A of FT:mat_peptide KF779215_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LPPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779221_MHBs_P-A Product feature CHAIN KF779221_MHBs_P-A of FT:mat_peptide KF779221_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5934). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779227_MHBs_P-A Product feature CHAIN KF779227_MHBs_P-A of FT:mat_peptide KF779227_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779231_MHBs_P-A Product feature CHAIN KF779231_MHBs_P-A of FT:mat_peptide KF779231_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779232_MHBs_P-A Product feature CHAIN KF779232_MHBs_P-A of FT:mat_peptide KF779232_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779234_MHBs_P-A Product feature CHAIN KF779234_MHBs_P-A of FT:mat_peptide KF779234_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779238_MHBs_P-A Product feature CHAIN KF779238_MHBs_P-A of FT:mat_peptide KF779238_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779239_MHBs_P-A Product feature CHAIN KF779239_MHBs_P-A of FT:mat_peptide KF779239_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6120). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779240_MHBs_P-A Product feature CHAIN KF779240_MHBs_P-A of FT:mat_peptide KF779240_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779243_MHBs_P-A Product feature CHAIN KF779243_MHBs_P-A of FT:mat_peptide KF779243_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779244_MHBs_P-A Product feature CHAIN KF779244_MHBs_P-A of FT:mat_peptide KF779244_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779245_MHBs_P-A Product feature CHAIN KF779245_MHBs_P-A of FT:mat_peptide KF779245_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779246_MHBs_P-A Product feature CHAIN KF779246_MHBs_P-A of FT:mat_peptide KF779246_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6163). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779247_MHBs_P-A Product feature CHAIN KF779247_MHBs_P-A of FT:mat_peptide KF779247_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779248_MHBs_P-A Product feature CHAIN KF779248_MHBs_P-A of FT:mat_peptide KF779248_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779249_MHBs_P-A Product feature CHAIN KF779249_MHBs_P-A of FT:mat_peptide KF779249_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779251_MHBs_P-A Product feature CHAIN KF779251_MHBs_P-A of FT:mat_peptide KF779251_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779252_MHBs_P-A Product feature CHAIN KF779252_MHBs_P-A of FT:mat_peptide KF779252_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLKLLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779253_MHBs_P-A Product feature CHAIN KF779253_MHBs_P-A of FT:mat_peptide KF779253_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3817). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779254_MHBs_P-A Product feature CHAIN KF779254_MHBs_P-A of FT:mat_peptide KF779254_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3820). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSLTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779255_MHBs_P-A Product feature CHAIN KF779255_MHBs_P-A of FT:mat_peptide KF779255_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3825). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISTRTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779256_MHBs_P-A Product feature CHAIN KF779256_MHBs_P-A of FT:mat_peptide KF779256_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3829). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779257_MHBs_P-A Product feature CHAIN KF779257_MHBs_P-A of FT:mat_peptide KF779257_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3857). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LLPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779258_MHBs_P-A Product feature CHAIN KF779258_MHBs_P-A of FT:mat_peptide KF779258_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779259_MHBs_P-A Product feature CHAIN KF779259_MHBs_P-A of FT:mat_peptide KF779259_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779260_MHBs_P-A Product feature CHAIN KF779260_MHBs_P-A of FT:mat_peptide KF779260_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3894). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLNFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPSESHSAIWMMGYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779261_MHBs_P-A Product feature CHAIN KF779261_MHBs_P-A of FT:mat_peptide KF779261_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3896). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIRMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779262_MHBs_P-A Product feature CHAIN KF779262_MHBs_P-A of FT:mat_peptide KF779262_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3898). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779263_MHBs_P-A Product feature CHAIN KF779263_MHBs_P-A of FT:mat_peptide KF779263_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3903). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNLLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPSVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779264_MHBs_P-A Product feature CHAIN KF779264_MHBs_P-A of FT:mat_peptide KF779264_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3945). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTIPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779265_MHBs_P-A Product feature CHAIN KF779265_MHBs_P-A of FT:mat_peptide KF779265_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3946). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALRDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMGYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779266_MHBs_P-A Product feature CHAIN KF779266_MHBs_P-A of FT:mat_peptide KF779266_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3949). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779268_MHBs_P-A Product feature CHAIN KF779268_MHBs_P-A of FT:mat_peptide KF779268_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3966). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMGYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779269_MHBs_P-A Product feature CHAIN KF779269_MHBs_P-A of FT:mat_peptide KF779269_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779270_MHBs_P-A Product feature CHAIN KF779270_MHBs_P-A of FT:mat_peptide KF779270_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779271_MHBs_P-A Product feature CHAIN KF779271_MHBs_P-A of FT:mat_peptide KF779271_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779272_MHBs_P-A Product feature CHAIN KF779272_MHBs_P-A of FT:mat_peptide KF779272_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIHIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779273_MHBs_P-A Product feature CHAIN KF779273_MHBs_P-A of FT:mat_peptide KF779273_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779274_MHBs_P-A Product feature CHAIN KF779274_MHBs_P-A of FT:mat_peptide KF779274_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGCFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779275_MHBs_P-A Product feature CHAIN KF779275_MHBs_P-A of FT:mat_peptide KF779275_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779276_MHBs_P-A Product feature CHAIN KF779276_MHBs_P-A of FT:mat_peptide KF779276_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779277_MHBs_P-A Product feature CHAIN KF779277_MHBs_P-A of FT:mat_peptide KF779277_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779279_MHBs_P-A Product feature CHAIN KF779279_MHBs_P-A of FT:mat_peptide KF779279_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779280_MHBs_P-A Product feature CHAIN KF779280_MHBs_P-A of FT:mat_peptide KF779280_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4364). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779281_MHBs_P-A Product feature CHAIN KF779281_MHBs_P-A of FT:mat_peptide KF779281_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4390). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779282_MHBs_P-A Product feature CHAIN KF779282_MHBs_P-A of FT:mat_peptide KF779282_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVKNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779283_MHBs_P-A Product feature CHAIN KF779283_MHBs_P-A of FT:mat_peptide KF779283_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779286_MHBs_P-A Product feature CHAIN KF779286_MHBs_P-A of FT:mat_peptide KF779286_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0606). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
FSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779287_MHBs_P-A Product feature CHAIN KF779287_MHBs_P-A of FT:mat_peptide KF779287_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0613). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
FSPTVWLSAIWMMGYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779290_MHBs_P-A Product feature CHAIN KF779290_MHBs_P-A of FT:mat_peptide KF779290_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
FSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779291_MHBs_P-A Product feature CHAIN KF779291_MHBs_P-A of FT:mat_peptide KF779291_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0765). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
FSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779293_MHBs_P-A Product feature CHAIN KF779293_MHBs_P-A of FT:mat_peptide KF779293_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNLAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCTPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779294_MHBs_P-A Product feature CHAIN KF779294_MHBs_P-A of FT:mat_peptide KF779294_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0796). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
FSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779295_MHBs_P-A Product feature CHAIN KF779295_MHBs_P-A of FT:mat_peptide KF779295_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779297_MHBs_P-A Product feature CHAIN KF779297_MHBs_P-A of FT:mat_peptide KF779297_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0874). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779298_MHBs_P-A Product feature CHAIN KF779298_MHBs_P-A of FT:mat_peptide KF779298_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0908). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNLLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFLA
FSPIVWLSSIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779299_MHBs_P-A Product feature CHAIN KF779299_MHBs_P-A of FT:mat_peptide KF779299_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0943). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779304_MHBs_P-A Product feature CHAIN KF779304_MHBs_P-A of FT:mat_peptide KF779304_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779305_MHBs_P-A Product feature CHAIN KF779305_MHBs_P-A of FT:mat_peptide KF779305_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779306_MHBs_P-A Product feature CHAIN KF779306_MHBs_P-A of FT:mat_peptide KF779306_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779307_MHBs_P-A Product feature CHAIN KF779307_MHBs_P-A of FT:mat_peptide KF779307_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779308_MHBs_P-A Product feature CHAIN KF779308_MHBs_P-A of FT:mat_peptide KF779308_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779309_MHBs_P-A Product feature CHAIN KF779309_MHBs_P-A of FT:mat_peptide KF779309_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779310_MHBs_P-A Product feature CHAIN KF779310_MHBs_P-A of FT:mat_peptide KF779310_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3845). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779311_MHBs_P-A Product feature CHAIN KF779311_MHBs_P-A of FT:mat_peptide KF779311_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSIDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779312_MHBs_P-A Product feature CHAIN KF779312_MHBs_P-A of FT:mat_peptide KF779312_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3907). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779313_MHBs_P-A Product feature CHAIN KF779313_MHBs_P-A of FT:mat_peptide KF779313_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3958). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTVFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779314_MHBs_P-A Product feature CHAIN KF779314_MHBs_P-A of FT:mat_peptide KF779314_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3985). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779315_MHBs_P-A Product feature CHAIN KF779315_MHBs_P-A of FT:mat_peptide KF779315_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLKFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779316_MHBs_P-A Product feature CHAIN KF779316_MHBs_P-A of FT:mat_peptide KF779316_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779317_MHBs_P-A Product feature CHAIN KF779317_MHBs_P-A of FT:mat_peptide KF779317_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LLPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779319_MHBs_P-A Product feature CHAIN KF779319_MHBs_P-A of FT:mat_peptide KF779319_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSLTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779320_MHBs_P-A Product feature CHAIN KF779320_MHBs_P-A of FT:mat_peptide KF779320_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFLQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
LSLTIWLSAIWMMCYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779321_MHBs_P-A Product feature CHAIN KF779321_MHBs_P-A of FT:mat_peptide KF779321_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4362). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
LSLTVWLSAIWMMCYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779322_MHBs_P-A Product feature CHAIN KF779322_MHBs_P-A of FT:mat_peptide KF779322_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTITQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779323_MHBs_P-A Product feature CHAIN KF779323_MHBs_P-A of FT:mat_peptide KF779323_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQAPQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTITQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779324_MHBs_P-A Product feature CHAIN KF779324_MHBs_P-A of FT:mat_peptide KF779324_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHKALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTITQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779325_MHBs_P-A Product feature CHAIN KF779325_MHBs_P-A of FT:mat_peptide KF779325_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHKALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779326_MHBs_P-A Product feature CHAIN KF779326_MHBs_P-A of FT:mat_peptide KF779326_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779328_MHBs_P-A Product feature CHAIN KF779328_MHBs_P-A of FT:mat_peptide KF779328_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4532). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779329_MHBs_P-A Product feature CHAIN KF779329_MHBs_P-A of FT:mat_peptide KF779329_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779330_MHBs_P-A Product feature CHAIN KF779330_MHBs_P-A of FT:mat_peptide KF779330_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4541). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779331_MHBs_P-A Product feature CHAIN KF779331_MHBs_P-A of FT:mat_peptide KF779331_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4543). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779332_MHBs_P-A Product feature CHAIN KF779332_MHBs_P-A of FT:mat_peptide KF779332_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4549). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISSRTGDPAKNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFGKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLTAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779333_MHBs_P-A Product feature CHAIN KF779333_MHBs_P-A of FT:mat_peptide KF779333_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4661). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779334_MHBs_P-A Product feature CHAIN KF779334_MHBs_P-A of FT:mat_peptide KF779334_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4673). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779335_MHBs_P-A Product feature CHAIN KF779335_MHBs_P-A of FT:mat_peptide KF779335_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4687). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSLGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779336_MHBs_P-A Product feature CHAIN KF779336_MHBs_P-A of FT:mat_peptide KF779336_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNLLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779337_MHBs_P-A Product feature CHAIN KF779337_MHBs_P-A of FT:mat_peptide KF779337_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4733). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779338_MHBs_P-A Product feature CHAIN KF779338_MHBs_P-A of FT:mat_peptide KF779338_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779339_MHBs_P-A Product feature CHAIN KF779339_MHBs_P-A of FT:mat_peptide KF779339_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4804). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779342_MHBs_P-A Product feature CHAIN KF779342_MHBs_P-A of FT:mat_peptide KF779342_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4865). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779344_MHBs_P-A Product feature CHAIN KF779344_MHBs_P-A of FT:mat_peptide KF779344_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4928). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779345_MHBs_P-A Product feature CHAIN KF779345_MHBs_P-A of FT:mat_peptide KF779345_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4936). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779346_MHBs_P-A Product feature CHAIN KF779346_MHBs_P-A of FT:mat_peptide KF779346_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4938). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779347_MHBs_P-A Product feature CHAIN KF779347_MHBs_P-A of FT:mat_peptide KF779347_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4950). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779348_MHBs_P-A Product feature CHAIN KF779348_MHBs_P-A of FT:mat_peptide KF779348_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4951). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779349_MHBs_P-A Product feature CHAIN KF779349_MHBs_P-A of FT:mat_peptide KF779349_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4999). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779350_MHBs_P-A Product feature CHAIN KF779350_MHBs_P-A of FT:mat_peptide KF779350_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779351_MHBs_P-A Product feature CHAIN KF779351_MHBs_P-A of FT:mat_peptide KF779351_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779352_MHBs_P-A Product feature CHAIN KF779352_MHBs_P-A of FT:mat_peptide KF779352_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779354_MHBs_P-A Product feature CHAIN KF779354_MHBs_P-A of FT:mat_peptide KF779354_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779355_MHBs_P-A Product feature CHAIN KF779355_MHBs_P-A of FT:mat_peptide KF779355_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779356_MHBs_P-A Product feature CHAIN KF779356_MHBs_P-A of FT:mat_peptide KF779356_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779358_MHBs_P-A Product feature CHAIN KF779358_MHBs_P-A of FT:mat_peptide KF779358_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGYFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779359_MHBs_P-A Product feature CHAIN KF779359_MHBs_P-A of FT:mat_peptide KF779359_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779360_MHBs_P-A Product feature CHAIN KF779360_MHBs_P-A of FT:mat_peptide KF779360_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5279). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779361_MHBs_P-A Product feature CHAIN KF779361_MHBs_P-A of FT:mat_peptide KF779361_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779362_MHBs_P-A Product feature CHAIN KF779362_MHBs_P-A of FT:mat_peptide KF779362_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779363_MHBs_P-A Product feature CHAIN KF779363_MHBs_P-A of FT:mat_peptide KF779363_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779364_MHBs_P-A Product feature CHAIN KF779364_MHBs_P-A of FT:mat_peptide KF779364_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779365_MHBs_P-A Product feature CHAIN KF779365_MHBs_P-A of FT:mat_peptide KF779365_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPIIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779366_MHBs_P-A Product feature CHAIN KF779366_MHBs_P-A of FT:mat_peptide KF779366_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5383). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779367_MHBs_P-A Product feature CHAIN KF779367_MHBs_P-A of FT:mat_peptide KF779367_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5403). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779368_MHBs_P-A Product feature CHAIN KF779368_MHBs_P-A of FT:mat_peptide KF779368_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779369_MHBs_P-A Product feature CHAIN KF779369_MHBs_P-A of FT:mat_peptide KF779369_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5521). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779370_MHBs_P-A Product feature CHAIN KF779370_MHBs_P-A of FT:mat_peptide KF779370_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5594). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVSFSRLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779371_MHBs_P-A Product feature CHAIN KF779371_MHBs_P-A of FT:mat_peptide KF779371_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5608). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779372_MHBs_P-A Product feature CHAIN KF779372_MHBs_P-A of FT:mat_peptide KF779372_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5654). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779373_MHBs_P-A Product feature CHAIN KF779373_MHBs_P-A of FT:mat_peptide KF779373_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5680). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779374_MHBs_P-A Product feature CHAIN KF779374_MHBs_P-A of FT:mat_peptide KF779374_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5743). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779375_MHBs_P-A Product feature CHAIN KF779375_MHBs_P-A of FT:mat_peptide KF779375_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5760). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779378_MHBs_P-A Product feature CHAIN KF779378_MHBs_P-A of FT:mat_peptide KF779378_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779379_MHBs_P-A Product feature CHAIN KF779379_MHBs_P-A of FT:mat_peptide KF779379_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779381_MHBs_P-A Product feature CHAIN KF779381_MHBs_P-A of FT:mat_peptide KF779381_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6268). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779383_MHBs_P-A Product feature CHAIN KF779383_MHBs_P-A of FT:mat_peptide KF779383_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSIYARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779384_MHBs_P-A Product feature CHAIN KF779384_MHBs_P-A of FT:mat_peptide KF779384_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISWRTGDPATNMENITSGFLGPLLVLQERFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARLPWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779385_MHBs_P-A Product feature CHAIN KF779385_MHBs_P-A of FT:mat_peptide KF779385_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779386_MHBs_P-A Product feature CHAIN KF779386_MHBs_P-A of FT:mat_peptide KF779386_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVA
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922406_MHBs_P-A Product feature CHAIN KF922406_MHBs_P-A of FT:mat_peptide KF922406_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922407_MHBs_P-A Product feature CHAIN KF922407_MHBs_P-A of FT:mat_peptide KF922407_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLRAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922408_MHBs_P-A Product feature CHAIN KF922408_MHBs_P-A of FT:mat_peptide KF922408_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLPVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922409_MHBs_P-A Product feature CHAIN KF922409_MHBs_P-A of FT:mat_peptide KF922409_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLARI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922414_MHBs_P-A Product feature CHAIN KF922414_MHBs_P-A of FT:mat_peptide KF922414_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922415_MHBs_P-A Product feature CHAIN KF922415_MHBs_P-A of FT:mat_peptide KF922415_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922416_MHBs_P-A Product feature CHAIN KF922416_MHBs_P-A of FT:mat_peptide KF922416_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922417_MHBs_P-A Product feature CHAIN KF922417_MHBs_P-A of FT:mat_peptide KF922417_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v4). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922418_MHBs_P-A Product feature CHAIN KF922418_MHBs_P-A of FT:mat_peptide KF922418_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922419_MHBs_P-A Product feature CHAIN KF922419_MHBs_P-A of FT:mat_peptide KF922419_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922420_MHBs_P-A Product feature CHAIN KF922420_MHBs_P-A of FT:mat_peptide KF922420_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922421_MHBs_P-A Product feature CHAIN KF922421_MHBs_P-A of FT:mat_peptide KF922421_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922426_MHBs_P-A Product feature CHAIN KF922426_MHBs_P-A of FT:mat_peptide KF922426_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922427_MHBs_P-A Product feature CHAIN KF922427_MHBs_P-A of FT:mat_peptide KF922427_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922428_MHBs_P-A Product feature CHAIN KF922428_MHBs_P-A of FT:mat_peptide KF922428_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922429_MHBs_P-A Product feature CHAIN KF922429_MHBs_P-A of FT:mat_peptide KF922429_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922430_MHBs_P-A Product feature CHAIN KF922430_MHBs_P-A of FT:mat_peptide KF922430_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922433_MHBs_P-A Product feature CHAIN KF922433_MHBs_P-A of FT:mat_peptide KF922433_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYRPAGGSSSGTHNPVPNIASHISSISSKTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQNNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSLTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922434_MHBs_P-A Product feature CHAIN KF922434_MHBs_P-A of FT:mat_peptide KF922434_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTHNPVPNIASHISSISSKTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWPLVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922435_MHBs_P-A Product feature CHAIN KF922435_MHBs_P-A of FT:mat_peptide KF922435_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922436_MHBs_P-A Product feature CHAIN KF922436_MHBs_P-A of FT:mat_peptide KF922436_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922437_MHBs_P-A Product feature CHAIN KF922437_MHBs_P-A of FT:mat_peptide KF922437_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ010776_MHBs_P-A Product feature CHAIN KJ010776_MHBs_P-A of FT:mat_peptide KJ010776_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIVSHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ010777_MHBs_P-A Product feature CHAIN KJ010777_MHBs_P-A of FT:mat_peptide KJ010777_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIVSHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ010778_MHBs_P-A Product feature CHAIN KJ010778_MHBs_P-A of FT:mat_peptide KJ010778_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIVSHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ194506_MHBs_P-A Product feature CHAIN KJ194506_MHBs_P-A of FT:mat_peptide KJ194506_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV_Amsterdam_1_1994). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ586809_MHBs_P-A Product feature CHAIN KJ586809_MHBs_P-A of FT:mat_peptide KJ586809_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSRSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843166_MHBs_P-A Product feature CHAIN KJ843166_MHBs_P-A of FT:mat_peptide KJ843166_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843172_MHBs_P-A Product feature CHAIN KJ843172_MHBs_P-A of FT:mat_peptide KJ843172_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKSTAGNCTCIPIPSSWAFAKYLWEWVSVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843173_MHBs_P-A Product feature CHAIN KJ843173_MHBs_P-A of FT:mat_peptide KJ843173_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843182_MHBs_P-A Product feature CHAIN KJ843182_MHBs_P-A of FT:mat_peptide KJ843182_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843183_MHBs_P-A Product feature CHAIN KJ843183_MHBs_P-A of FT:mat_peptide KJ843183_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843184_MHBs_P-A Product feature CHAIN KJ843184_MHBs_P-A of FT:mat_peptide KJ843184_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843186_MHBs_P-A Product feature CHAIN KJ843186_MHBs_P-A of FT:mat_peptide KJ843186_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843188_MHBs_P-A Product feature CHAIN KJ843188_MHBs_P-A of FT:mat_peptide KJ843188_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843192_MHBs_P-A Product feature CHAIN KJ843192_MHBs_P-A of FT:mat_peptide KJ843192_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843214_MHBs_P-A Product feature CHAIN KJ843214_MHBs_P-A of FT:mat_peptide KJ843214_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843215_MHBs_P-A Product feature CHAIN KJ843215_MHBs_P-A of FT:mat_peptide KJ843215_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843216_MHBs_P-A Product feature CHAIN KJ843216_MHBs_P-A of FT:mat_peptide KJ843216_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTNTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843217_MHBs_P-A Product feature CHAIN KJ843217_MHBs_P-A of FT:mat_peptide KJ843217_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ843218_MHBs_P-A Product feature CHAIN KJ843218_MHBs_P-A of FT:mat_peptide KJ843218_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854685_MHBs_P-A Product feature CHAIN KJ854685_MHBs_P-A of FT:mat_peptide KJ854685_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854686_MHBs_P-A Product feature CHAIN KJ854686_MHBs_P-A of FT:mat_peptide KJ854686_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPVIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854687_MHBs_P-A Product feature CHAIN KJ854687_MHBs_P-A of FT:mat_peptide KJ854687_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAQNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854688_MHBs_P-A Product feature CHAIN KJ854688_MHBs_P-A of FT:mat_peptide KJ854688_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854689_MHBs_P-A Product feature CHAIN KJ854689_MHBs_P-A of FT:mat_peptide KJ854689_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGILP
VCPLIPGSPTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLNLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854690_MHBs_P-A Product feature CHAIN KJ854690_MHBs_P-A of FT:mat_peptide KJ854690_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854691_MHBs_P-A Product feature CHAIN KJ854691_MHBs_P-A of FT:mat_peptide KJ854691_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854692_MHBs_P-A Product feature CHAIN KJ854692_MHBs_P-A of FT:mat_peptide KJ854692_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854693_MHBs_P-A Product feature CHAIN KJ854693_MHBs_P-A of FT:mat_peptide KJ854693_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17545-NE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854694_MHBs_P-A Product feature CHAIN KJ854694_MHBs_P-A of FT:mat_peptide KJ854694_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854695_MHBs_P-A Product feature CHAIN KJ854695_MHBs_P-A of FT:mat_peptide KJ854695_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1814-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854696_MHBs_P-A Product feature CHAIN KJ854696_MHBs_P-A of FT:mat_peptide KJ854696_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTASHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854697_MHBs_P-A Product feature CHAIN KJ854697_MHBs_P-A of FT:mat_peptide KJ854697_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854698_MHBs_P-A Product feature CHAIN KJ854698_MHBs_P-A of FT:mat_peptide KJ854698_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1993-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQXFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854699_MHBs_P-A Product feature CHAIN KJ854699_MHBs_P-A of FT:mat_peptide KJ854699_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQAXKDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLLLQAGFFLLTRI
LTIPQSLDSWWTSLNFXGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854700_MHBs_P-A Product feature CHAIN KJ854700_MHBs_P-A of FT:mat_peptide KJ854700_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854701_MHBs_P-A Product feature CHAIN KJ854701_MHBs_P-A of FT:mat_peptide KJ854701_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854702_MHBs_P-A Product feature CHAIN KJ854702_MHBs_P-A of FT:mat_peptide KJ854702_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854703_MHBs_P-A Product feature CHAIN KJ854703_MHBs_P-A of FT:mat_peptide KJ854703_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854704_MHBs_P-A Product feature CHAIN KJ854704_MHBs_P-A of FT:mat_peptide KJ854704_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854705_MHBs_P-A Product feature CHAIN KJ854705_MHBs_P-A of FT:mat_peptide KJ854705_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854706_MHBs_P-A Product feature CHAIN KJ854706_MHBs_P-A of FT:mat_peptide KJ854706_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854707_MHBs_P-A Product feature CHAIN KJ854707_MHBs_P-A of FT:mat_peptide KJ854707_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854708_MHBs_P-A Product feature CHAIN KJ854708_MHBs_P-A of FT:mat_peptide KJ854708_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854709_MHBs_P-A Product feature CHAIN KJ854709_MHBs_P-A of FT:mat_peptide KJ854709_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ854710_MHBs_P-A Product feature CHAIN KJ854710_MHBs_P-A of FT:mat_peptide KJ854710_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM519452_MHBs_P-A Product feature CHAIN KM519452_MHBs_P-A of FT:mat_peptide KM519452_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQPPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM519453_MHBs_P-A Product feature CHAIN KM519453_MHBs_P-A of FT:mat_peptide KM519453_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQPPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM519454_MHBs_P-A Product feature CHAIN KM519454_MHBs_P-A of FT:mat_peptide KM519454_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTVNPAPNIPSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM606737_MHBs_P-A Product feature CHAIN KM606737_MHBs_P-A of FT:mat_peptide KM606737_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVSPVPNTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM606742_MHBs_P-A Product feature CHAIN KM606742_MHBs_P-A of FT:mat_peptide KM606742_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM606746_MHBs_P-A Product feature CHAIN KM606746_MHBs_P-A of FT:mat_peptide KM606746_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSICARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM606748_MHBs_P-A Product feature CHAIN KM606748_MHBs_P-A of FT:mat_peptide KM606748_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba51). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM606749_MHBs_P-A Product feature CHAIN KM606749_MHBs_P-A of FT:mat_peptide KM606749_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168422_MHBs_P-A Product feature CHAIN KP168422_MHBs_P-A of FT:mat_peptide KP168422_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN136). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168423_MHBs_P-A Product feature CHAIN KP168423_MHBs_P-A of FT:mat_peptide KP168423_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168424_MHBs_P-A Product feature CHAIN KP168424_MHBs_P-A of FT:mat_peptide KP168424_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSXLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168425_MHBs_P-A Product feature CHAIN KP168425_MHBs_P-A of FT:mat_peptide KP168425_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168426_MHBs_P-A Product feature CHAIN KP168426_MHBs_P-A of FT:mat_peptide KP168426_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFYQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KP168427_MHBs_P-A Product feature CHAIN KP168427_MHBs_P-A of FT:mat_peptide KP168427_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAGNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168428_MHBs_P-A Product feature CHAIN KP168428_MHBs_P-A of FT:mat_peptide KP168428_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPXLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168429_MHBs_P-A Product feature CHAIN KP168429_MHBs_P-A of FT:mat_peptide KP168429_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDLAPNMENITSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168430_MHBs_P-A Product feature CHAIN KP168430_MHBs_P-A of FT:mat_peptide KP168430_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KP168431_MHBs_P-A Product feature CHAIN KP168431_MHBs_P-A of FT:mat_peptide KP168431_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM03). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNIXSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KP168432_MHBs_P-A Product feature CHAIN KP168432_MHBs_P-A of FT:mat_peptide KP168432_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168433_MHBs_P-A Product feature CHAIN KP168433_MHBs_P-A of FT:mat_peptide KP168433_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168434_MHBs_P-A Product feature CHAIN KP168434_MHBs_P-A of FT:mat_peptide KP168434_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP168435_MHBs_P-A Product feature CHAIN KP168435_MHBs_P-A of FT:mat_peptide KP168435_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTXNPVQNIASHISSTSSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMXLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSXIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP274925_MHBs_P-A Product feature CHAIN KP274925_MHBs_P-A of FT:mat_peptide KP274925_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP274927_MHBs_P-A Product feature CHAIN KP274927_MHBs_P-A of FT:mat_peptide KP274927_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP274928_MHBs_P-A Product feature CHAIN KP274928_MHBs_P-A of FT:mat_peptide KP274928_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718085_MHBs_P-A Product feature CHAIN KP718085_MHBs_P-A of FT:mat_peptide KP718085_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718086_MHBs_P-A Product feature CHAIN KP718086_MHBs_P-A of FT:mat_peptide KP718086_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVX
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718087_MHBs_P-A Product feature CHAIN KP718087_MHBs_P-A of FT:mat_peptide KP718087_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVXNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718088_MHBs_P-A Product feature CHAIN KP718088_MHBs_P-A of FT:mat_peptide KP718088_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718089_MHBs_P-A Product feature CHAIN KP718089_MHBs_P-A of FT:mat_peptide KP718089_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVX
LSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718090_MHBs_P-A Product feature CHAIN KP718090_MHBs_P-A of FT:mat_peptide KP718090_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718091_MHBs_P-A Product feature CHAIN KP718091_MHBs_P-A of FT:mat_peptide KP718091_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718092_MHBs_P-A Product feature CHAIN KP718092_MHBs_P-A of FT:mat_peptide KP718092_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718093_MHBs_P-A Product feature CHAIN KP718093_MHBs_P-A of FT:mat_peptide KP718093_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718094_MHBs_P-A Product feature CHAIN KP718094_MHBs_P-A of FT:mat_peptide KP718094_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718095_MHBs_P-A Product feature CHAIN KP718095_MHBs_P-A of FT:mat_peptide KP718095_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718096_MHBs_P-A Product feature CHAIN KP718096_MHBs_P-A of FT:mat_peptide KP718096_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718097_MHBs_P-A Product feature CHAIN KP718097_MHBs_P-A of FT:mat_peptide KP718097_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718098_MHBs_P-A Product feature CHAIN KP718098_MHBs_P-A of FT:mat_peptide KP718098_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718099_MHBs_P-A Product feature CHAIN KP718099_MHBs_P-A of FT:mat_peptide KP718099_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718100_MHBs_P-A Product feature CHAIN KP718100_MHBs_P-A of FT:mat_peptide KP718100_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718101_MHBs_P-A Product feature CHAIN KP718101_MHBs_P-A of FT:mat_peptide KP718101_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP718102_MHBs_P-A Product feature CHAIN KP718102_MHBs_P-A of FT:mat_peptide KP718102_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP12-1400). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPQIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KP995108_MHBs_P-A Product feature CHAIN KP995108_MHBs_P-A of FT:mat_peptide KP995108_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR139742_MHBs_P-A Product feature CHAIN KR139742_MHBs_P-A of FT:mat_peptide KR139742_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA60). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNRENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLIAGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWPSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCHWVYI
>gnl|hbvpro|KR139743_MHBs_P-A Product feature CHAIN KR139743_MHBs_P-A of FT:mat_peptide KR139743_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA62). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR139744_MHBs_P-A Product feature CHAIN KR139744_MHBs_P-A of FT:mat_peptide KR139744_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA65). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQGGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR905425_MHBs_P-A Product feature CHAIN KR905425_MHBs_P-A of FT:mat_peptide KR905425_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLIPGSTTTSTGPCKTCTTPAQGNSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSSLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|KR905426_MHBs_P-A Product feature CHAIN KR905426_MHBs_P-A of FT:mat_peptide KR905426_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCSLIPGSTTTSTGPCKTCTTAAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR905427_MHBs_P-A Product feature CHAIN KR905427_MHBs_P-A of FT:mat_peptide KR905427_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLSFLEGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR905429_MHBs_P-A Product feature CHAIN KR905429_MHBs_P-A of FT:mat_peptide KR905429_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPATNMENITSGFLGPLLALQAGFFLLTKI
LTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWGFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR905430_MHBs_P-A Product feature CHAIN KR905430_MHBs_P-A of FT:mat_peptide KR905430_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KR905431_MHBs_P-A Product feature CHAIN KR905431_MHBs_P-A of FT:mat_peptide KR905431_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KT151612_MHBs_P-A Product feature CHAIN KT151612_MHBs_P-A of FT:mat_peptide KT151612_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWSWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT151614_MHBs_P-A Product feature CHAIN KT151614_MHBs_P-A of FT:mat_peptide KT151614_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWXSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT151615_MHBs_P-A Product feature CHAIN KT151615_MHBs_P-A of FT:mat_peptide KT151615_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFRQALQDPRVRGLYFPAGGSSSGTLNPAPTIASHISSISXRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT151617_MHBs_P-A Product feature CHAIN KT151617_MHBs_P-A of FT:mat_peptide KT151617_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWSWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT347087_MHBs_P-A Product feature CHAIN KT347087_MHBs_P-A of FT:mat_peptide KT347087_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=281 residues).
MQLNSTAFHQALQDPRVRGLYFPAGASSSGTHNPVPNIASHISSISSKTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT347088_MHBs_P-A Product feature CHAIN KT347088_MHBs_P-A of FT:mat_peptide KT347088_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT347091_MHBs_P-A Product feature CHAIN KT347091_MHBs_P-A of FT:mat_peptide KT347091_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT347092_MHBs_P-A Product feature CHAIN KT347092_MHBs_P-A of FT:mat_peptide KT347092_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT366466_MHBs_P-A Product feature CHAIN KT366466_MHBs_P-A of FT:mat_peptide KT366466_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLIPGSTTTSTGPCKTCTTPAQGNSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSSLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|KT366467_MHBs_P-A Product feature CHAIN KT366467_MHBs_P-A of FT:mat_peptide KT366467_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCSLIPGSTTTSTGPCKTCTTAAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASARFSWLNLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT366468_MHBs_P-A Product feature CHAIN KT366468_MHBs_P-A of FT:mat_peptide KT366468_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KT366469_MHBs_P-A Product feature CHAIN KT366469_MHBs_P-A of FT:mat_peptide KT366469_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT366470_MHBs_P-A Product feature CHAIN KT366470_MHBs_P-A of FT:mat_peptide KT366470_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KT366471_MHBs_P-A Product feature CHAIN KT366471_MHBs_P-A of FT:mat_peptide KT366471_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749822_MHBs_P-A Product feature CHAIN KT749822_MHBs_P-A of FT:mat_peptide KT749822_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGSPVCLGQDSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLFSIVKPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT749824_MHBs_P-A Product feature CHAIN KT749824_MHBs_P-A of FT:mat_peptide KT749824_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749825_MHBs_P-A Product feature CHAIN KT749825_MHBs_P-A of FT:mat_peptide KT749825_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749826_MHBs_P-A Product feature CHAIN KT749826_MHBs_P-A of FT:mat_peptide KT749826_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749829_MHBs_P-A Product feature CHAIN KT749829_MHBs_P-A of FT:mat_peptide KT749829_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749830_MHBs_P-A Product feature CHAIN KT749830_MHBs_P-A of FT:mat_peptide KT749830_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749831_MHBs_P-A Product feature CHAIN KT749831_MHBs_P-A of FT:mat_peptide KT749831_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749832_MHBs_P-A Product feature CHAIN KT749832_MHBs_P-A of FT:mat_peptide KT749832_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749834_MHBs_P-A Product feature CHAIN KT749834_MHBs_P-A of FT:mat_peptide KT749834_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749835_MHBs_P-A Product feature CHAIN KT749835_MHBs_P-A of FT:mat_peptide KT749835_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDLVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749836_MHBs_P-A Product feature CHAIN KT749836_MHBs_P-A of FT:mat_peptide KT749836_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749837_MHBs_P-A Product feature CHAIN KT749837_MHBs_P-A of FT:mat_peptide KT749837_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749838_MHBs_P-A Product feature CHAIN KT749838_MHBs_P-A of FT:mat_peptide KT749838_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWTSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749839_MHBs_P-A Product feature CHAIN KT749839_MHBs_P-A of FT:mat_peptide KT749839_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749840_MHBs_P-A Product feature CHAIN KT749840_MHBs_P-A of FT:mat_peptide KT749840_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749842_MHBs_P-A Product feature CHAIN KT749842_MHBs_P-A of FT:mat_peptide KT749842_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749843_MHBs_P-A Product feature CHAIN KT749843_MHBs_P-A of FT:mat_peptide KT749843_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749844_MHBs_P-A Product feature CHAIN KT749844_MHBs_P-A of FT:mat_peptide KT749844_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749846_MHBs_P-A Product feature CHAIN KT749846_MHBs_P-A of FT:mat_peptide KT749846_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749847_MHBs_P-A Product feature CHAIN KT749847_MHBs_P-A of FT:mat_peptide KT749847_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749849_MHBs_P-A Product feature CHAIN KT749849_MHBs_P-A of FT:mat_peptide KT749849_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT749850_MHBs_P-A Product feature CHAIN KT749850_MHBs_P-A of FT:mat_peptide KT749850_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605532_MHBs_P-A Product feature CHAIN KU605532_MHBs_P-A of FT:mat_peptide KU605532_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605533_MHBs_P-A Product feature CHAIN KU605533_MHBs_P-A of FT:mat_peptide KU605533_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSKTGDPALNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605534_MHBs_P-A Product feature CHAIN KU605534_MHBs_P-A of FT:mat_peptide KU605534_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSKTGDPALNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605535_MHBs_P-A Product feature CHAIN KU605535_MHBs_P-A of FT:mat_peptide KU605535_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605536_MHBs_P-A Product feature CHAIN KU605536_MHBs_P-A of FT:mat_peptide KU605536_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605537_MHBs_P-A Product feature CHAIN KU605537_MHBs_P-A of FT:mat_peptide KU605537_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605538_MHBs_P-A Product feature CHAIN KU605538_MHBs_P-A of FT:mat_peptide KU605538_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU605539_MHBs_P-A Product feature CHAIN KU605539_MHBs_P-A of FT:mat_peptide KU605539_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736918_MHBs_P-A Product feature CHAIN KU736918_MHBs_P-A of FT:mat_peptide KU736918_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736919_MHBs_P-A Product feature CHAIN KU736919_MHBs_P-A of FT:mat_peptide KU736919_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTXPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQXFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736920_MHBs_P-A Product feature CHAIN KU736920_MHBs_P-A of FT:mat_peptide KU736920_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPVGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX276769_MHBs_P-A Product feature CHAIN KX276769_MHBs_P-A of FT:mat_peptide KX276769_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISARTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLXFLGXSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFXLLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWXFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX357642_MHBs_P-A Product feature CHAIN KX357642_MHBs_P-A of FT:mat_peptide KX357642_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPVGGSSSGTLNPVQNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX357643_MHBs_P-A Product feature CHAIN KX357643_MHBs_P-A of FT:mat_peptide KX357643_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLALQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX357645_MHBs_P-A Product feature CHAIN KX357645_MHBs_P-A of FT:mat_peptide KX357645_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX357646_MHBs_P-A Product feature CHAIN KX357646_MHBs_P-A of FT:mat_peptide KX357646_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAANMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX357647_MHBs_P-A Product feature CHAIN KX357647_MHBs_P-A of FT:mat_peptide KX357647_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTLNPVPNTASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX357649_MHBs_P-A Product feature CHAIN KX357649_MHBs_P-A of FT:mat_peptide KX357649_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSIAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX357650_MHBs_P-A Product feature CHAIN KX357650_MHBs_P-A of FT:mat_peptide KX357650_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA46ETH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX648548_MHBs_P-A Product feature CHAIN KX648548_MHBs_P-A of FT:mat_peptide KX648548_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX827293_MHBs_P-A Product feature CHAIN KX827293_MHBs_P-A of FT:mat_peptide KX827293_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENTPSGLLGPLLVLQAGFFLLTRV
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX827294_MHBs_P-A Product feature CHAIN KX827294_MHBs_P-A of FT:mat_peptide KX827294_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX827295_MHBs_P-A Product feature CHAIN KX827295_MHBs_P-A of FT:mat_peptide KX827295_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX827296_MHBs_P-A Product feature CHAIN KX827296_MHBs_P-A of FT:mat_peptide KX827296_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX827297_MHBs_P-A Product feature CHAIN KX827297_MHBs_P-A of FT:mat_peptide KX827297_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVFI
>gnl|hbvpro|KX827298_MHBs_P-A Product feature CHAIN KX827298_MHBs_P-A of FT:mat_peptide KX827298_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTVFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLTPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY003230_MHBs_P-A Product feature CHAIN KY003230_MHBs_P-A of FT:mat_peptide KY003230_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY382410_MHBs_P-A Product feature CHAIN KY382410_MHBs_P-A of FT:mat_peptide KY382410_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLXIFFCLWVYI
>gnl|hbvpro|KY886219_MHBs_P-A Product feature CHAIN KY886219_MHBs_P-A of FT:mat_peptide KY886219_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|L13994_MHBs_P-A Product feature CHAIN L13994_MHBs_P-A of FT:mat_peptide L13994_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LC051141_MHBs_P-A Product feature CHAIN LC051141_MHBs_P-A of FT:mat_peptide LC051141_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LC074724_MHBs_P-A Product feature CHAIN LC074724_MHBs_P-A of FT:mat_peptide LC074724_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LC311241_MHBs_P-A Product feature CHAIN LC311241_MHBs_P-A of FT:mat_peptide LC311241_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LC311242_MHBs_P-A Product feature CHAIN LC311242_MHBs_P-A of FT:mat_peptide LC311242_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LC311243_MHBs_P-A Product feature CHAIN LC311243_MHBs_P-A of FT:mat_peptide LC311243_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LC458430_MHBs_P-A Product feature CHAIN LC458430_MHBs_P-A of FT:mat_peptide LC458430_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LC458431_MHBs_P-A Product feature CHAIN LC458431_MHBs_P-A of FT:mat_peptide LC458431_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT992440_MHBs_P-A Product feature CHAIN LT992440_MHBs_P-A of FT:mat_peptide LT992440_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA119). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRIGDPVPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT992441_MHBs_P-A Product feature CHAIN LT992441_MHBs_P-A of FT:mat_peptide LT992441_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFQQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWFSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT992448_MHBs_P-A Product feature CHAIN LT992448_MHBs_P-A of FT:mat_peptide LT992448_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RISE386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPNIASHISSIFSRTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFAG
LSPTVWLSIIWMMWYWGPSLXXXXXXXIPLLPIFFCLWVYI
>gnl|hbvpro|M57663_MHBs_P-A Product feature CHAIN M57663_MHBs_P-A of FT:mat_peptide M57663_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772344_MHBs_P-A Product feature CHAIN MF772344_MHBs_P-A of FT:mat_peptide MF772344_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772345_MHBs_P-A Product feature CHAIN MF772345_MHBs_P-A of FT:mat_peptide MF772345_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1959). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772346_MHBs_P-A Product feature CHAIN MF772346_MHBs_P-A of FT:mat_peptide MF772346_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772347_MHBs_P-A Product feature CHAIN MF772347_MHBs_P-A of FT:mat_peptide MF772347_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLMPGSTTTSTGPCKTCTTPAQGNSTIPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772348_MHBs_P-A Product feature CHAIN MF772348_MHBs_P-A of FT:mat_peptide MF772348_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=281 residues).
LRRTSTXXXXXHLQWRVRDLCLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772349_MHBs_P-A Product feature CHAIN MF772349_MHBs_P-A of FT:mat_peptide MF772349_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1840). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVVNMENITSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772350_MHBs_P-A Product feature CHAIN MF772350_MHBs_P-A of FT:mat_peptide MF772350_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772351_MHBs_P-A Product feature CHAIN MF772351_MHBs_P-A of FT:mat_peptide MF772351_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772353_MHBs_P-A Product feature CHAIN MF772353_MHBs_P-A of FT:mat_peptide MF772353_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF925361_MHBs_P-A Product feature CHAIN MF925361_MHBs_P-A of FT:mat_peptide MF925361_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIGDPAPNMENITSGFLKPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF925368_MHBs_P-A Product feature CHAIN MF925368_MHBs_P-A of FT:mat_peptide MF925368_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLCLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF925372_MHBs_P-A Product feature CHAIN MF925372_MHBs_P-A of FT:mat_peptide MF925372_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWKATAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSTSSRIGDPATNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF925373_MHBs_P-A Product feature CHAIN MF925373_MHBs_P-A of FT:mat_peptide MF925373_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFPGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF925385_MHBs_P-A Product feature CHAIN MF925385_MHBs_P-A of FT:mat_peptide MF925385_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPHIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF925400_MHBs_P-A Product feature CHAIN MF925400_MHBs_P-A of FT:mat_peptide MF925400_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF925407_MHBs_P-A Product feature CHAIN MF925407_MHBs_P-A of FT:mat_peptide MF925407_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPHIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF979143_MHBs_P-A Product feature CHAIN MF979143_MHBs_P-A of FT:mat_peptide MF979143_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate WC27). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF979144_MHBs_P-A Product feature CHAIN MF979144_MHBs_P-A of FT:mat_peptide MF979144_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate WC28). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF979146_MHBs_P-A Product feature CHAIN MF979146_MHBs_P-A of FT:mat_peptide MF979146_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate WC29). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF979149_MHBs_P-A Product feature CHAIN MF979149_MHBs_P-A of FT:mat_peptide MF979149_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate WC6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKIRXLNLPAGGSSLGTRNPVPTIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVXFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF979151_MHBs_P-A Product feature CHAIN MF979151_MHBs_P-A of FT:mat_peptide MF979151_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate WC26). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGLCKICTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF979153_MHBs_P-A Product feature CHAIN MF979153_MHBs_P-A of FT:mat_peptide MF979153_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate WC14). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464808_MHBs_P-A Product feature CHAIN MH464808_MHBs_P-A of FT:mat_peptide MH464808_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFXQXXQDXRXRGLYFPAGGSSSGTLNPVPNIASHXSSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464809_MHBs_P-A Product feature CHAIN MH464809_MHBs_P-A of FT:mat_peptide MH464809_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA87). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYXPAGGSSSGTLNPVPNIASHISSISSRTGDPALNRENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLXGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLIAGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWPSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464810_MHBs_P-A Product feature CHAIN MH464810_MHBs_P-A of FT:mat_peptide MH464810_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYS
>gnl|hbvpro|MH464811_MHBs_P-A Product feature CHAIN MH464811_MHBs_P-A of FT:mat_peptide MH464811_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA89). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHXSSXSSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464812_MHBs_P-A Product feature CHAIN MH464812_MHBs_P-A of FT:mat_peptide MH464812_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA90). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464813_MHBs_P-A Product feature CHAIN MH464813_MHBs_P-A of FT:mat_peptide MH464813_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464814_MHBs_P-A Product feature CHAIN MH464814_MHBs_P-A of FT:mat_peptide MH464814_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464815_MHBs_P-A Product feature CHAIN MH464815_MHBs_P-A of FT:mat_peptide MH464815_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464816_MHBs_P-A Product feature CHAIN MH464816_MHBs_P-A of FT:mat_peptide MH464816_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA94). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRIRGLYFPAGGSSSGILNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464817_MHBs_P-A Product feature CHAIN MH464817_MHBs_P-A of FT:mat_peptide MH464817_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA95). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLSTAAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLIPGSTTTSTGPCKTCTTPARNNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464818_MHBs_P-A Product feature CHAIN MH464818_MHBs_P-A of FT:mat_peptide MH464818_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464819_MHBs_P-A Product feature CHAIN MH464819_MHBs_P-A of FT:mat_peptide MH464819_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA97). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464820_MHBs_P-A Product feature CHAIN MH464820_MHBs_P-A of FT:mat_peptide MH464820_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA98). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVPLDYQGMLP
VCPLIPGSTTTSTGPCKTYTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464821_MHBs_P-A Product feature CHAIN MH464821_MHBs_P-A of FT:mat_peptide MH464821_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA99). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464822_MHBs_P-A Product feature CHAIN MH464822_MHBs_P-A of FT:mat_peptide MH464822_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA100). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464823_MHBs_P-A Product feature CHAIN MH464823_MHBs_P-A of FT:mat_peptide MH464823_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA101). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYXPAGGSSSGTLNPVPNIASHISSISSRTGDPALNRENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLIAGSITTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWPSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464824_MHBs_P-A Product feature CHAIN MH464824_MHBs_P-A of FT:mat_peptide MH464824_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464825_MHBs_P-A Product feature CHAIN MH464825_MHBs_P-A of FT:mat_peptide MH464825_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLLIFFCLWVYI
>gnl|hbvpro|MH464826_MHBs_P-A Product feature CHAIN MH464826_MHBs_P-A of FT:mat_peptide MH464826_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464827_MHBs_P-A Product feature CHAIN MH464827_MHBs_P-A of FT:mat_peptide MH464827_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA105). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464828_MHBs_P-A Product feature CHAIN MH464828_MHBs_P-A of FT:mat_peptide MH464828_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464829_MHBs_P-A Product feature CHAIN MH464829_MHBs_P-A of FT:mat_peptide MH464829_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGKSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464830_MHBs_P-A Product feature CHAIN MH464830_MHBs_P-A of FT:mat_peptide MH464830_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580627_MHBs_P-A Product feature CHAIN MH580627_MHBs_P-A of FT:mat_peptide MH580627_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|MH580639_MHBs_P-A Product feature CHAIN MH580639_MHBs_P-A of FT:mat_peptide MH580639_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|MH580642_MHBs_P-A Product feature CHAIN MH580642_MHBs_P-A of FT:mat_peptide MH580642_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|MH580643_MHBs_P-A Product feature CHAIN MH580643_MHBs_P-A of FT:mat_peptide MH580643_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|MH932713_MHBs_P-A Product feature CHAIN MH932713_MHBs_P-A of FT:mat_peptide MH932713_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512455_MHBs_P-A Product feature CHAIN MK512455_MHBs_P-A of FT:mat_peptide MK512455_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2079). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMIPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWPSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLTIFFCLWVYI
>gnl|hbvpro|MK512456_MHBs_P-A Product feature CHAIN MK512456_MHBs_P-A of FT:mat_peptide MK512456_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=281 residues).
RQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512457_MHBs_P-A Product feature CHAIN MK512457_MHBs_P-A of FT:mat_peptide MK512457_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=281 residues).
MHWNSTPFHPALQDPRVRGLYCPAGGSSSGTLNPVPNIASHILSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512460_MHBs_P-A Product feature CHAIN MK512460_MHBs_P-A of FT:mat_peptide MK512460_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2199). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512462_MHBs_P-A Product feature CHAIN MK512462_MHBs_P-A of FT:mat_peptide MK512462_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=281 residues).
AQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLPPVPNIASHISSTSSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLIFLVPFVQWLVG
LSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512464_MHBs_P-A Product feature CHAIN MK512464_MHBs_P-A of FT:mat_peptide MK512464_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512465_MHBs_P-A Product feature CHAIN MK512465_MHBs_P-A of FT:mat_peptide MK512465_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512466_MHBs_P-A Product feature CHAIN MK512466_MHBs_P-A of FT:mat_peptide MK512466_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPVSNMENITSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512467_MHBs_P-A Product feature CHAIN MK512467_MHBs_P-A of FT:mat_peptide MK512467_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-220). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWLTSLNFLGGSPVCLGQNSQSPTSNHSPTSCAPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512468_MHBs_P-A Product feature CHAIN MK512468_MHBs_P-A of FT:mat_peptide MK512468_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-203). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMIPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512470_MHBs_P-A Product feature CHAIN MK512470_MHBs_P-A of FT:mat_peptide MK512470_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512471_MHBs_P-A Product feature CHAIN MK512471_MHBs_P-A of FT:mat_peptide MK512471_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTAFHQTLQDPKVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512472_MHBs_P-A Product feature CHAIN MK512472_MHBs_P-A of FT:mat_peptide MK512472_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512473_MHBs_P-A Product feature CHAIN MK512473_MHBs_P-A of FT:mat_peptide MK512473_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFQQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK512475_MHBs_P-A Product feature CHAIN MK512475_MHBs_P-A of FT:mat_peptide MK512475_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVLNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQSNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLNLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87725_MHBs_P-A Product feature CHAIN U87725_MHBs_P-A of FT:mat_peptide U87725_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87726_MHBs_P-A Product feature CHAIN U87726_MHBs_P-A of FT:mat_peptide U87726_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHMCPISARTGDPVTNMENITLGSLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGXTTTSTAPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87727_MHBs_P-A Product feature CHAIN U87727_MHBs_P-A of FT:mat_peptide U87727_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate E14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MHWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLDLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87728_MHBs_P-A Product feature CHAIN U87728_MHBs_P-A of FT:mat_peptide U87728_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate E20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87729_MHBs_P-A Product feature CHAIN U87729_MHBs_P-A of FT:mat_peptide U87729_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87730_MHBs_P-A Product feature CHAIN U87730_MHBs_P-A of FT:mat_peptide U87730_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O04). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87731_MHBs_P-A Product feature CHAIN U87731_MHBs_P-A of FT:mat_peptide U87731_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate E17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPRGGSSSGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87732_MHBs_P-A Product feature CHAIN U87732_MHBs_P-A of FT:mat_peptide U87732_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSLAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYGGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87733_MHBs_P-A Product feature CHAIN U87733_MHBs_P-A of FT:mat_peptide U87733_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate E30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHKALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSTTGDPVPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLDLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87734_MHBs_P-A Product feature CHAIN U87734_MHBs_P-A of FT:mat_peptide U87734_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate E11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPASNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|U87735_MHBs_P-A Product feature CHAIN U87735_MHBs_P-A of FT:mat_peptide U87735_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWDII
>gnl|hbvpro|U87736_MHBs_P-A Product feature CHAIN U87736_MHBs_P-A of FT:mat_peptide U87736_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate E06). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHKALQYPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTGDPVSNMENITSGFLGPLLLLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|V00866_MHBs_P-A Product feature CHAIN V00866_MHBs_P-A of FT:mat_peptide V00866_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTALHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTIMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|X02763_MHBs_C-A Product feature CHAIN X02763_MHBs_C-A of FT:mat_peptide X02763_MHBs_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|X51970_MHBs_P-A Product feature CHAIN X51970_MHBs_P-A of FT:mat_peptide X51970_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLPVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLILGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSSFIPLLPIFFCLWVYI
>gnl|hbvpro|X70185_MHBs_P-A Product feature CHAIN X70185_MHBs_P-A of FT:mat_peptide X70185_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|Z35717_MHBs_P-A Product feature CHAIN Z35717_MHBs_P-A of FT:mat_peptide Z35717_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|Z72478_MHBs_P-A Product feature CHAIN Z72478_MHBs_P-A of FT:mat_peptide Z72478_MHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFLLLTRI
LTIPQSLDSWWTSLNFIGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTVGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
© 1998-2019