HBVdb

Dataset for protein Pol of genotype A

[Download (right click)] [Alignment] [Repertoires]

1137 sequence(s)

>gnl|hbvpro|AB014370_Pol_P-A Product feature CHAIN AB014370_Pol_P-A of FT:mat_peptide AB014370_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPNIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPNSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB064314_Pol_P-A Product feature CHAIN AB064314_Pol_P-A of FT:mat_peptide AB064314_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKCTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB076678_Pol_P-A Product feature CHAIN AB076678_Pol_P-A of FT:mat_peptide AB076678_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLAHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB076679_Pol_P-A Product feature CHAIN AB076679_Pol_P-A of FT:mat_peptide AB076679_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFVGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYSDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQPG
RSGSVRPRVHSPTRRCFGVEPSGSGHIDYSASSSSSCLHQSAVREAAYSHLSTSKRQSSSGRAVEFHSFPTSPTRSQSQG
HISSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLLLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116076_Pol_P-A Product feature CHAIN AB116076_Pol_P-A of FT:mat_peptide AB116076_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDAGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGRAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDKHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VNRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYASLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLEALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPPTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116077_Pol_P-A Product feature CHAIN AB116077_Pol_P-A of FT:mat_peptide AB116077_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVFRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116078_Pol_P-A Product feature CHAIN AB116078_Pol_P-A of FT:mat_peptide AB116078_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116079_Pol_P-A Product feature CHAIN AB116079_Pol_P-A of FT:mat_peptide AB116079_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116080_Pol_P-A Product feature CHAIN AB116080_Pol_P-A of FT:mat_peptide AB116080_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRTRAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRTYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116081_Pol_P-A Product feature CHAIN AB116081_Pol_P-A of FT:mat_peptide AB116081_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116082_Pol_P-A Product feature CHAIN AB116082_Pol_P-A of FT:mat_peptide AB116082_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANKCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIDHSASSTSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPNSARYQSQG
PVFSCWWLQFRNTQPCSDYCLSHLVNLLEDWGPCAEHGEHHIRTPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGMY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116083_Pol_P-A Product feature CHAIN AB116083_Pol_P-A of FT:mat_peptide AB116083_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETSRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLEPHQGPLATSQPG
RSGSIRARTHSPTRRCLGVEPSGSGHIDHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSPARSQSQG
PVYSCWWLQFRNSQPCSQYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HESCSRQLYVSLMLLYKTYGWKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIAG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB116084_Pol_P-A Product feature CHAIN AB116084_Pol_P-A of FT:mat_peptide AB116084_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLHEDLANRCQQFVGPLTANEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQRPLATSQPG
RSGSFRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSPARSQSQG
PVYSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
NTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSGYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116085_Pol_P-A Product feature CHAIN AB116085_Pol_P-A of FT:mat_peptide AB116085_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIXHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSCPPSSARSQSQG
PVYSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AB116086_Pol_P-A Product feature CHAIN AB116086_Pol_P-A of FT:mat_peptide AB116086_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQLFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSIGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGREVEFHNFPPSSARSQSQE
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116087_Pol_P-A Product feature CHAIN AB116087_Pol_P-A of FT:mat_peptide AB116087_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFAGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGFQPHQGPLATSQPG
RSGSIRARVHSPTRRCLGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAMEFHSFPPNSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKLKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGMF
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116088_Pol_P-A Product feature CHAIN AB116088_Pol_P-A of FT:mat_peptide AB116088_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFYGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGSCIRSQFKQSRLGLQPHQGPLATSQPG
GSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKXKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116089_Pol_P-A Product feature CHAIN AB116089_Pol_P-A of FT:mat_peptide AB116089_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQRFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRSFGVEPSGSGHIDHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAT
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNAQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116090_Pol_P-A Product feature CHAIN AB116090_Pol_P-A of FT:mat_peptide AB116090_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYPHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLAASQPGRSGSIRA
RVHSPTRRCFGVEPSGSGHIDHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQGPVFSCWW
LQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIKIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLHDSCSRQ
LYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPINRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLP
YRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AB116091_Pol_P-A Product feature CHAIN AB116091_Pol_P-A of FT:mat_peptide AB116091_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPRQGSLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIDHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHSFSPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGNLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKRCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116092_Pol_P-A Product feature CHAIN AB116092_Pol_P-A of FT:mat_peptide AB116092_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKTYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASYCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPAGILSRSSVGPCIRSQCKQSRLGPQPHQGPLATSQPG
RSGSIWTRAHSPTRRCFGVEPSGSRHIGHRANSASSCLHQSAVGKAAYSHFSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRELYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLSQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB116093_Pol_P-A Product feature CHAIN AB116093_Pol_P-A of FT:mat_peptide AB116093_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGSLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIDHSASRSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVSSCWWLQFRNTQPCSQYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ATRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB116094_Pol_P-A Product feature CHAIN AB116094_Pol_P-A of FT:mat_peptide AB116094_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVXHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGGEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSGYVARLSSNSRIHNNQHGNLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB126580_Pol_P-A Product feature CHAIN AB126580_Pol_P-A of FT:mat_peptide AB126580_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRVVIKTSQRHGDESFWFQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQASSGQAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTYRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYXVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB194950_Pol_P-A Product feature CHAIN AB194950_Pol_P-A of FT:mat_peptide AB194950_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSHTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDKSVCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSRHIDYSASSTSSCLRQSAVRKAAYSHLSTSKRQSSSGHKVEFPSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHLESLYTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYIIGCWGALPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB194951_Pol_P-A Product feature CHAIN AB194951_Pol_P-A of FT:mat_peptide AB194951_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNQEWQTPS
FPKIHLHEDIINRCQQFVGPLNVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQPRLGLQPHQGPLATSQSG
RSGSIWARVHPSTWRRSGVEPSGSGHIDYSASSSSSCLHQSAVKKTAYSHLSTSKRQSSSGHAVEFHKFPPSSARSQSQG
PVSSCWWLQFRNSQPCSEYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLALGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKLKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB194952_Pol_P-A Product feature CHAIN AB194952_Pol_P-A of FT:mat_peptide AB194952_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNQEWQTPS
FPKIHLHEDIINRCQQFVGPLNVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPGHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRSVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQPRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRSSGVEPSGSGHIDYSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHKVPPNSARSQSQG
PVFSCWWLQFRNSQPCSEYCLSHLVNLLEDWGPCADHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKLKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205118_Pol_P-A Product feature CHAIN AB205118_Pol_P-A of FT:mat_peptide AB205118_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKQLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYSGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCPPPSSAGTQSQG
SVSSCWWLQFRNSKPCSEYCLSRLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRTNNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB222707_Pol_P-A Product feature CHAIN AB222707_Pol_P-A of FT:mat_peptide AB222707_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFRSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQTG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSTSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB241114_Pol_P-A Product feature CHAIN AB241114_Pol_P-A of FT:mat_peptide AB241114_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKVGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGSLATSQPG
RSGSIRARVHSPSRRCFGVEPSGSGHIGNSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQNQG
PVFSCWWLHFRNSQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB241115_Pol_P-A Product feature CHAIN AB241115_Pol_P-A of FT:mat_peptide AB241115_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPCCSQPSGILSRSSVGPCIQSQFKQSRLGPQPRQGPLATSQPG
RSGSIRARVHSPTRRSFGVEPSGSGHIDHSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSTSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB246335_Pol_P-A Product feature CHAIN AB246335_Pol_P-A of FT:mat_peptide AB246335_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKVGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGSLATSQPG
RSGSIRARVHSPSRRCFGVEPSGSGHIGNSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQNQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB246336_Pol_P-A Product feature CHAIN AB246336_Pol_P-A of FT:mat_peptide AB246336_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPHSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYFWEQELHHGRLVIKTSQRHGDEPFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCSGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGRAVEFHNFPPNSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMSHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB246337_Pol_P-A Product feature CHAIN AB246337_Pol_P-A of FT:mat_peptide AB246337_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB246338_Pol_P-A Product feature CHAIN AB246338_Pol_P-A of FT:mat_peptide AB246338_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB300366_Pol_P-A Product feature CHAIN AB300366_Pol_P-A of FT:mat_peptide AB300366_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKHYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFDSPLHVAWRPP
>gnl|hbvpro|AB300367_Pol_P-A Product feature CHAIN AB300367_Pol_P-A of FT:mat_peptide AB300367_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB362931_Pol_P-A Product feature CHAIN AB362931_Pol_P-A of FT:mat_peptide AB362931_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLRKDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVSPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB453979_Pol_P-A Product feature CHAIN AB453979_Pol_P-A of FT:mat_peptide AB453979_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB453980_Pol_P-A Product feature CHAIN AB453980_Pol_P-A of FT:mat_peptide AB453980_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKFTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB453981_Pol_P-A Product feature CHAIN AB453981_Pol_P-A of FT:mat_peptide AB453981_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB453982_Pol_P-A Product feature CHAIN AB453982_Pol_P-A of FT:mat_peptide AB453982_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIETSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLARGQSG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKFTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB453983_Pol_P-A Product feature CHAIN AB453983_Pol_P-A of FT:mat_peptide AB453983_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGVLY
KRETTRSASFCGSPYSWEQELQHGRLVIETSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRSFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLRKDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVSPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB453984_Pol_P-A Product feature CHAIN AB453984_Pol_P-A of FT:mat_peptide AB453984_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFDSPLHVAWRPP
>gnl|hbvpro|AB453986_Pol_P-A Product feature CHAIN AB453986_Pol_P-A of FT:mat_peptide AB453986_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
RRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGFQSHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHIVNLLEDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB453987_Pol_P-A Product feature CHAIN AB453987_Pol_P-A of FT:mat_peptide AB453987_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPVCSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSANSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGGWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB453988_Pol_P-A Product feature CHAIN AB453988_Pol_P-A of FT:mat_peptide AB453988_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCVGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB453989_Pol_P-A Product feature CHAIN AB453989_Pol_P-A of FT:mat_peptide AB453989_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPAGILPRSSVGPCIRSQFKQSRLGLQPCQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPNSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
GHRVSWPKFAVPNLQSLTNLLSSNLCWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB480036_Pol_P-A Product feature CHAIN AB480036_Pol_P-A of FT:mat_peptide AB480036_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLSPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB480038_Pol_P-A Product feature CHAIN AB480038_Pol_P-A of FT:mat_peptide AB480038_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB480039_Pol_P-A Product feature CHAIN AB480039_Pol_P-A of FT:mat_peptide AB480039_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKHYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFDSPLHVAWRPP
>gnl|hbvpro|AB480040_Pol_P-A Product feature CHAIN AB480040_Pol_P-A of FT:mat_peptide AB480040_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVXSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVXWRPP
>gnl|hbvpro|AB480041_Pol_P-A Product feature CHAIN AB480041_Pol_P-A of FT:mat_peptide AB480041_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPAHVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB549213_Pol_P-A Product feature CHAIN AB549213_Pol_P-A of FT:mat_peptide AB549213_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697487_Pol_P-A Product feature CHAIN AB697487_Pol_P-A of FT:mat_peptide AB697487_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNFRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697488_Pol_P-A Product feature CHAIN AB697488_Pol_P-A of FT:mat_peptide AB697488_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYXLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697489_Pol_P-A Product feature CHAIN AB697489_Pol_P-A of FT:mat_peptide AB697489_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697491_Pol_P-A Product feature CHAIN AB697491_Pol_P-A of FT:mat_peptide AB697491_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697492_Pol_P-A Product feature CHAIN AB697492_Pol_P-A of FT:mat_peptide AB697492_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQEPQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSPVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697493_Pol_P-A Product feature CHAIN AB697493_Pol_P-A of FT:mat_peptide AB697493_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSXQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697495_Pol_P-A Product feature CHAIN AB697495_Pol_P-A of FT:mat_peptide AB697495_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697496_Pol_P-A Product feature CHAIN AB697496_Pol_P-A of FT:mat_peptide AB697496_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697497_Pol_P-A Product feature CHAIN AB697497_Pol_P-A of FT:mat_peptide AB697497_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697498_Pol_P-A Product feature CHAIN AB697498_Pol_P-A of FT:mat_peptide AB697498_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697499_Pol_P-A Product feature CHAIN AB697499_Pol_P-A of FT:mat_peptide AB697499_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697501_Pol_P-A Product feature CHAIN AB697501_Pol_P-A of FT:mat_peptide AB697501_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697503_Pol_P-A Product feature CHAIN AB697503_Pol_P-A of FT:mat_peptide AB697503_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697504_Pol_P-A Product feature CHAIN AB697504_Pol_P-A of FT:mat_peptide AB697504_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697505_Pol_P-A Product feature CHAIN AB697505_Pol_P-A of FT:mat_peptide AB697505_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697506_Pol_P-A Product feature CHAIN AB697506_Pol_P-A of FT:mat_peptide AB697506_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNXYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697507_Pol_P-A Product feature CHAIN AB697507_Pol_P-A of FT:mat_peptide AB697507_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGXLY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697508_Pol_P-A Product feature CHAIN AB697508_Pol_P-A of FT:mat_peptide AB697508_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697509_Pol_P-A Product feature CHAIN AB697509_Pol_P-A of FT:mat_peptide AB697509_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQTHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697511_Pol_P-A Product feature CHAIN AB697511_Pol_P-A of FT:mat_peptide AB697511_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSRHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVTLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697512_Pol_P-A Product feature CHAIN AB697512_Pol_P-A of FT:mat_peptide AB697512_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB775198_Pol_P-A Product feature CHAIN AB775198_Pol_P-A of FT:mat_peptide AB775198_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB775199_Pol_P-A Product feature CHAIN AB775199_Pol_P-A of FT:mat_peptide AB775199_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPXSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB775200_Pol_P-A Product feature CHAIN AB775200_Pol_P-A of FT:mat_peptide AB775200_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB775201_Pol_P-A Product feature CHAIN AB775201_Pol_P-A of FT:mat_peptide AB775201_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB937791_Pol_P-A Product feature CHAIN AB937791_Pol_P-A of FT:mat_peptide AB937791_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB937792_Pol_P-A Product feature CHAIN AB937792_Pol_P-A of FT:mat_peptide AB937792_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB937793_Pol_P-A Product feature CHAIN AB937793_Pol_P-A of FT:mat_peptide AB937793_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB937794_Pol_P-A Product feature CHAIN AB937794_Pol_P-A of FT:mat_peptide AB937794_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB937795_Pol_P-A Product feature CHAIN AB937795_Pol_P-A of FT:mat_peptide AB937795_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFRSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSLRARVHSPTRRCSGVEPAGSGHIGHSANSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHRFPPSSARSQSQG
PVFSCWWLQFRDTQPCSKYCLSHLINLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSXSRIHNNQHGTLQNL
HDSCSRQLYXSLMLLYKTYGWKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQASTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLPRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AB937796_Pol_P-A Product feature CHAIN AB937796_Pol_P-A of FT:mat_peptide AB937796_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB937797_Pol_P-A Product feature CHAIN AB937797_Pol_P-A of FT:mat_peptide AB937797_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPXWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWXAGILY
KRXTTRSASFCGSPYSWEQELQHGRLVIXTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHXDHSVNNSSSCLHQSAVRKAAXSHLSTXKRXSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRXSKPCSEYCLSHLVXLREDWGPCDEHGEHHIRVPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYIARLSSNSRINXKQYGXXQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB937798_Pol_P-A Product feature CHAIN AB937798_Pol_P-A of FT:mat_peptide AB937798_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF043560_Pol_P-A Product feature CHAIN AF043560_Pol_P-A of FT:mat_peptide AF043560_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTLKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWXTLPQDXIVQKIKHCFRKLPINRPIDWKVCQRIVG
LLGFAAPXTQCGYPALXPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF043580_Pol_P-A Product feature CHAIN AF043580_Pol_P-A of FT:mat_peptide AF043580_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYINLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYXVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF090838_Pol_P-A Product feature CHAIN AF090838_Pol_P-A of FT:mat_peptide AF090838_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAHSHLSTSKRQSSSGDAVEFHCLPPSSARPQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF090839_Pol_P-A Product feature CHAIN AF090839_Pol_P-A of FT:mat_peptide AF090839_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFGSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLARSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSPAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF090840_Pol_P-A Product feature CHAIN AF090840_Pol_P-A of FT:mat_peptide AF090840_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKGRLRLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFGSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF090841_Pol_P-A Product feature CHAIN AF090841_Pol_P-A of FT:mat_peptide AF090841_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPRIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRAGVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSSHAVEFHCLPPSSARPQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF090842_Pol_P-A Product feature CHAIN AF090842_Pol_P-A of FT:mat_peptide AF090842_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTGVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF143298_Pol_P-A Product feature CHAIN AF143298_Pol_P-A of FT:mat_peptide AF143298_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQQFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFYGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVKPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSDYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVALMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF297621_Pol_P-A Product feature CHAIN AF297621_Pol_P-A of FT:mat_peptide AF297621_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHSQRHGDESFCSQPSGIPSRSSAGPCIRSQFKQSRLGLQPHQGPLATSPSGRSGSIRA
RVHSPTRRCFGVEPSGSGHIGHIASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSKGPVFSCWW
LQFRNTQPCSKYCLSHLVNLLDDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGTSGLSRYVARLSSNSRINNNQYGTLQNLHDSCSRQ
LYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSSICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTTVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLP
FRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF297622_Pol_P-A Product feature CHAIN AF297622_Pol_P-A of FT:mat_peptide AF297622_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELKPSQRHGDESFCSQPSGILSRSSVGPCIRSQLNKSRLGLQPHQGPLASRQPGRSGSIRA
RAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLAPSSAGSQSQGSVFSCWW
LQFRNSKPCSEYCLSHLVNLREDWGPCDEHREHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNLHDSCSRQ
LYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSALCSVVSRDFPHCLAFSYMDDVVLGAKSVQHLES
LYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLP
FQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF297624_Pol_P-A Product feature CHAIN AF297624_Pol_P-A of FT:mat_peptide AF297624_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHSQRHGDESFCSQPSGIPSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPGRSGSIRA
RAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQGSVFSCWW
LQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNLHDSCSRQ
LYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHRES
LYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLP
YRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF297625_Pol_P-A Product feature CHAIN AF297625_Pol_P-A of FT:mat_peptide AF297625_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHSQRHGDESFCSQPSGILSRSSVGPCIRSQFNKSRLGLQPHQGPLATSQPGRSGSIRP
RALPSTRRCFGVEPSGSGHIDYSANSSSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFAPSSARSQSQGPVFSCWW
LQFRNTQPCSQYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGLTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHDSCSRQ
LYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHRES
LYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLP
YRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF536524_Pol_P-A Product feature CHAIN AF536524_Pol_P-A of FT:mat_peptide AF536524_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCPPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF537371_Pol_P-A Product feature CHAIN AF537371_Pol_P-A of FT:mat_peptide AF537371_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQRFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLDVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF537372_Pol_P-A Product feature CHAIN AF537372_Pol_P-A of FT:mat_peptide AF537372_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGAEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQPRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNKSSSCLHQSAVRKAAYSHLSTSKGQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVEKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNARINDNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLEALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AJ012207_Pol_P-A Product feature CHAIN AJ012207_Pol_P-A of FT:mat_peptide AJ012207_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSTGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFKGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AJ309369_Pol_P-A Product feature CHAIN AJ309369_Pol_P-A of FT:mat_peptide AJ309369_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
GSGGIRARAHPSTRRYLGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSPRQSSSGHAVEFHCLPPSTAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNRYGTMQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AJ309370_Pol_P-A Product feature CHAIN AJ309370_Pol_P-A of FT:mat_peptide AJ309370_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEEPPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
GSGSIRARAHPSTRRYFGLEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSTKQSSSGHAVEFHCLPPSTAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AJ344115_Pol_P-A Product feature CHAIN AJ344115_Pol_P-A of FT:mat_peptide AJ344115_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYHHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTNTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSANNSSSCIHQSAVRKAAHSHLSTSQRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNYKINNNQYGIMQNL
HDSCSRQIYVSLMLLYKTYGWKLHLYSHPIVLGFRKLPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPSKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGS
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCSANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627227_Pol_P-A Product feature CHAIN AJ627227_Pol_P-A of FT:mat_peptide AJ627227_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESVXXQPSGILSRSSVGPCIRSQLKQPRLGLQSHQGPLASSQPG
RSGSIRARAHPSTRRHFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQPSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSKYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLXRYVARLSSNSRINNNQYGXMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGTR
SVQHREALXTAVTNFLLSLGIHINPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYXNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSXLNPADDPSRGRLGLS
RPLLRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627228_Pol_P-A Product feature CHAIN AJ627228_Pol_P-A of FT:mat_peptide AJ627228_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=841 residues).
MPLSYQFFRKLLLLDDETEVGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELPHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGRAVEFHCXPPSSAGSQSRS
CWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRV
SWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNLHDSC
SRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQH
REALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGF
AAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAP
LPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLL
RLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AM180624_Pol_P-A Product feature CHAIN AM180624_Pol_P-A of FT:mat_peptide AM180624_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGXLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQXSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWTRVHPSTRRCSGVEPSGSGHIDYGASGSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSXYVARLSSNSRIXNHQYGTLQNL
HDSCTRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKXKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGXY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM184125_Pol_P-A Product feature CHAIN AM184125_Pol_P-A of FT:mat_peptide AM184125_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPRIHLHEDIINKCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDKSFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYLASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFKNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCTRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGCWGSLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAASFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGT
FVAPLPIHTAELLAACFARNRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM184126_Pol_P-A Product feature CHAIN AM184126_Pol_P-A of FT:mat_peptide AM184126_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVTKTSQRHGDKSFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYRASSSSSCLHQSAVRKAAYSHLSTSKRQSSAGHAVEFHSFPPSSTRSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCTRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SIQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGCWGSLPQDHIVHKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNHADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM282986_Pol_P-A Product feature CHAIN AM282986_Pol_P-A of FT:mat_peptide AM282986_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIETSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRNNNNQYGTMQNL
HDSCSRQLYVSLMLLYKTFGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AM295795_Pol_P-A Product feature CHAIN AM295795_Pol_P-A of FT:mat_peptide AM295795_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESVCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AM295797_Pol_P-A Product feature CHAIN AM295797_Pol_P-A of FT:mat_peptide AM295797_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESVCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AM410963_Pol_P-A Product feature CHAIN AM410963_Pol_P-A of FT:mat_peptide AM410963_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESVCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AM494718_Pol_P-A Product feature CHAIN AM494718_Pol_P-A of FT:mat_peptide AM494718_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRIHNNQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY034878_Pol_P-A Product feature CHAIN AY034878_Pol_P-A of FT:mat_peptide AY034878_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDNGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRKTTRSASICGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGRAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPVLCQVFADATPTGWGLPIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY128092_Pol_P-A Product feature CHAIN AY128092_Pol_P-A of FT:mat_peptide AY128092_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY152726_Pol_P-A Product feature CHAIN AY152726_Pol_P-A of FT:mat_peptide AY152726_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSIGPCIRSQLEQSRLGLQPHQGPLASSQPG
RSGSIRAGVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNARINNNKYGTMQNL
HDSCSRQLYVALMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY161138_Pol_P-A Product feature CHAIN AY161138_Pol_P-A of FT:mat_peptide AY161138_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=846 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDITNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIWARVHSPTRRCFGVEPSGSGHIGHSASSASFCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSTRSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAGAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQN
LHDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYVDDLVLGA
KSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIV
GLLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRG
TFVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGL
YRPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY161139_Pol_P-A Product feature CHAIN AY161139_Pol_P-A of FT:mat_peptide AY161139_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDITNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIWARVHSPTRRCFGVEPSGSGHIGHSASSASFCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSTRSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233274_Pol_P-A Product feature CHAIN AY233274_Pol_P-A of FT:mat_peptide AY233274_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAGDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KKETTRSASFCGSPYSWEQELHHGRLVSQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGHSANSTSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLANLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFPRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233275_Pol_P-A Product feature CHAIN AY233275_Pol_P-A of FT:mat_peptide AY233275_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVLNTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLELQPHQGPLATSQPG
RSGSLRPRAHSPTRRCFGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIYNNEYGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233276_Pol_P-A Product feature CHAIN AY233276_Pol_P-A of FT:mat_peptide AY233276_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVSKTSQRHGDESFCSQPPGILSRSSVGPCIQSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSATSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCISHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPGYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKCCFRKLPINRPIDWRVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYQAFLSKQYMNLYPVARQRLGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AY233278_Pol_P-A Product feature CHAIN AY233278_Pol_P-A of FT:mat_peptide AY233278_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYLIGSWGTLPQDHIVQKIKHCFKKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSLTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGD
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTPFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233279_Pol_P-A Product feature CHAIN AY233279_Pol_P-A of FT:mat_peptide AY233279_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLASKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGRIGYSATSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCISHLVNLLEDWGPCAEHGEHHIRIPRAPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKCCFRKLPVNRPIDWKVCQRIVS
LLGFAAPFTQCGYPALMPLYACIQAKQAFIFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLARKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233280_Pol_P-A Product feature CHAIN AY233280_Pol_P-A of FT:mat_peptide AY233280_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHRASDASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDASAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233281_Pol_P-A Product feature CHAIN AY233281_Pol_P-A of FT:mat_peptide AY233281_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYLNSIKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVLKTSQRHGDESFCSQSSGILSRSSVGPCIRSQFKQSRPGLQPHQGPLATSQPG
RSGSLRPRVHSPTRRCFGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
SVSSCWWLQFRNTQPCSKYCLSHLANLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIYNNEYGTLQDL
HDSCSKQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233282_Pol_P-A Product feature CHAIN AY233282_Pol_P-A of FT:mat_peptide AY233282_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGINPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVSQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLKPHQGPLARSQPG
RSGSIRPRVHSPTRRCFGVESSGSGHIGYSASSSSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFCHIPLHPAAMPHLLIGSSGLPRYIARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKALLNQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
LVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233283_Pol_P-A Product feature CHAIN AY233283_Pol_P-A of FT:mat_peptide AY233283_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQEVNHYFQTRHYLHTLWKAGILY
KREATRSASFCGSPYSWEQDLHHGRLVSQTSQRHGDESFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYSASSSSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
LVAHQPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233284_Pol_P-A Product feature CHAIN AY233284_Pol_P-A of FT:mat_peptide AY233284_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLASSQPG
RSGSFRPRVHSPTRRCFGVEPSGSGHIGYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
HTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIYNNEYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233285_Pol_P-A Product feature CHAIN AY233285_Pol_P-A of FT:mat_peptide AY233285_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVSQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVESSGSGHIGYSASSSSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVESHSFPPSSARSQSQG
PVFSCWWLQFRTTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTPQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AY233286_Pol_P-A Product feature CHAIN AY233286_Pol_P-A of FT:mat_peptide AY233286_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRINNNQYGAMQNL
HDSCSRQLYVSLMLLYNTYGWKLHLYSHPIVLDFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPRCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKITHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYAPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233287_Pol_P-A Product feature CHAIN AY233287_Pol_P-A of FT:mat_peptide AY233287_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKGGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVNKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSANSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCISHLVNLLEDWGPCAEHGEHYIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLPSSNLSWLSRDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKCCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMSGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY233288_Pol_P-A Product feature CHAIN AY233288_Pol_P-A of FT:mat_peptide AY233288_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPADWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FMAPLPIHTAELLAACFARSRPGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPS
>gnl|hbvpro|AY233289_Pol_P-A Product feature CHAIN AY233289_Pol_P-A of FT:mat_peptide AY233289_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWRTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVSQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVESSGSGHIGYSASSSSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPTAMPHLLIGSSGLPGYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FMAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AY233290_Pol_P-A Product feature CHAIN AY233290_Pol_P-A of FT:mat_peptide AY233290_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPKFNPEWQTPS
FPNIHLHEDIINRCQQFVGPLTKNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQEIHHGRLVIKTSQRHGDESFCSKPSGIPSRSSTGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHIANSSSSCLDQSAVRKAAYSHLSTSKRQSSSGYAVEFHRFPPSSARSQSQG
PVFPCWWLQFRNTQPCSKYCLSHLVNLLDDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
PTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGTSGLSRYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPTILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNQNKTKRWGYSLNSMGYVIGSWGSLPQDHIVQKIKCCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRLGLCQVFADATPPGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVALSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY373428_Pol_P-A Product feature CHAIN AY373428_Pol_P-A of FT:mat_peptide AY373428_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFEGPLTVNEKRRLKLIMPARFYPISTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RNGSIWARVHSPTRRCFGVEPSSSGHIGHSAKSASLCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSTRSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVLLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY373429_Pol_P-A Product feature CHAIN AY373429_Pol_P-A of FT:mat_peptide AY373429_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLVEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSATVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPMATSQPG
RSGSIWARVHSPTRRCFGVEPSGSGHIDHSASSASSCLHQSAVRKAAYSHLSTAKKQSSSGHTVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGQHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFRYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIEQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY373432_Pol_P-A Product feature CHAIN AY373432_Pol_P-A of FT:mat_peptide AY373432_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKKRLNLIMPARLYPISTRYLPLHKGIKPYYPDLVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSILARAHSPTRRCFGVEPSRSGHIGHSASSASSCLHQSAVRKAAYSHISTSKRQSSSGHAVEFHCLPPSSAESQRQG
SVSSCWWLQFRNTQPCSNYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGEKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY707087_Pol_P-A Product feature CHAIN AY707087_Pol_P-A of FT:mat_peptide AY707087_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIETSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRNNNNQYGTMQNL
HDSCSRQLYVSLMLLYKTFGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY738139_Pol_P-A Product feature CHAIN AY738139_Pol_P-A of FT:mat_peptide AY738139_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGSLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRGYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVGRLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTRRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY738140_Pol_P-A Product feature CHAIN AY738140_Pol_P-A of FT:mat_peptide AY738140_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGSLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRGYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTAKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
NTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGFSKYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY738141_Pol_P-A Product feature CHAIN AY738141_Pol_P-A of FT:mat_peptide AY738141_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGSLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRGYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTAKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
NTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGFSKYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGRQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY738142_Pol_P-A Product feature CHAIN AY738142_Pol_P-A of FT:mat_peptide AY738142_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGSLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRGYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTAKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
NTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGFSKYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY738143_Pol_P-A Product feature CHAIN AY738143_Pol_P-A of FT:mat_peptide AY738143_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGSLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRGYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVGRLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNSNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRRYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY862867_Pol_P-A Product feature CHAIN AY862867_Pol_P-A of FT:mat_peptide AY862867_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWFQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRPPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY862868_Pol_P-A Product feature CHAIN AY862868_Pol_P-A of FT:mat_peptide AY862868_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY902775_Pol_P-A Product feature CHAIN AY902775_Pol_P-A of FT:mat_peptide AY902775_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY903452_Pol_P-A Product feature CHAIN AY903452_Pol_P-A of FT:mat_peptide AY903452_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
KIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPGRS
GSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQGPV
FSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTT
RVSWPKFAVPNLQSLTNLLSSKLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHD
SCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLSIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934763_Pol_P-A Product feature CHAIN AY934763_Pol_P-A of FT:mat_peptide AY934763_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRTSVGPCIRSQLKQSRLGLQPHQGPLAKSQSG
RSGSIWTRVHPPTRRCSGVEPSGSGHIDYSASSSSYCLHQSAVRKATYSHISTSKRQSPPGSAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGALQKL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYTLNFMGYRIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY934764_Pol_P-A Product feature CHAIN AY934764_Pol_P-A of FT:mat_peptide AY934764_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPT
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESICSQPSGILSRSSVGPCIRSQHKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSSRRCSGVEPSGSGHIDYCASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRMAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKNCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYVNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY934765_Pol_P-A Product feature CHAIN AY934765_Pol_P-A of FT:mat_peptide AY934765_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQXG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSXSSCLXQSAVRKAAYSHLSTSKRXSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLAHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKKWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSREYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934766_Pol_P-A Product feature CHAIN AY934766_Pol_P-A of FT:mat_peptide AY934766_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVFKTSQRHGDESFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPSKTKKWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934767_Pol_P-A Product feature CHAIN AY934767_Pol_P-A of FT:mat_peptide AY934767_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDITTRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSQYCLAHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLRKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYHPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934768_Pol_P-A Product feature CHAIN AY934768_Pol_P-A of FT:mat_peptide AY934768_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPA
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRKSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLAHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYWTLQNL
HDSCSRQLYGSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934769_Pol_P-A Product feature CHAIN AY934769_Pol_P-A of FT:mat_peptide AY934769_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDITNRCQQFVGPLTVNEKRKLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGFQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLAHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AY934770_Pol_P-A Product feature CHAIN AY934770_Pol_P-A of FT:mat_peptide AY934770_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDITNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFYGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLAHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934771_Pol_P-A Product feature CHAIN AY934771_Pol_P-A of FT:mat_peptide AY934771_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGSCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSTRSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934772_Pol_P-A Product feature CHAIN AY934772_Pol_P-A of FT:mat_peptide AY934772_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDKSFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
PTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSDSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPLNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAXLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY934773_Pol_P-A Product feature CHAIN AY934773_Pol_P-A of FT:mat_peptide AY934773_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGQHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFXHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWXPP
>gnl|hbvpro|AY934774_Pol_P-A Product feature CHAIN AY934774_Pol_P-A of FT:mat_peptide AY934774_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCESPYSWEQELHHRRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIDHSANSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|DQ020002_Pol_P-A Product feature CHAIN DQ020002_Pol_P-A of FT:mat_peptide DQ020002_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWHTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPQQGSLATSQPG
RSGSLRPRVHSSTRRYFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSAGSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ020003_Pol_P-A Product feature CHAIN DQ020003_Pol_P-A of FT:mat_peptide DQ020003_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDVTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRMKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVSKTSQRHGDESICSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ298161_Pol_P-A Product feature CHAIN DQ298161_Pol_P-A of FT:mat_peptide DQ298161_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPNIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRESTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFSSQPAGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVREAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSIMLLYKTYGWKLHMYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLRHQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTAGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ298163_Pol_P-A Product feature CHAIN DQ298163_Pol_P-A of FT:mat_peptide DQ298163_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPNIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGVLY
KRESTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFSSQPAGILSRSSVGPCIRSQLKQSRLGFQPHQGQLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVREAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLLLLYKTYGWKLHMYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLRHQYMNLYPVARQRPGLCQVFADATPTGWGLAIGPQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ298164_Pol_P-A Product feature CHAIN DQ298164_Pol_P-A of FT:mat_peptide DQ298164_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPNIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRESTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFSSQPAGILSRSSVGPCIRSQLKQSRLGLQPHQEPLASSQPG
RSGSIRARAHPTTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVREAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCEEHGEHHIRTPRTPTRVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLLLLYETYGWKLHMYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLRHQYMNLYPVARQRPGLCQVFADATPTGWGLAIGPQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ298165_Pol_P-A Product feature CHAIN DQ298165_Pol_P-A of FT:mat_peptide DQ298165_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPIEEELPRLADADPNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPNIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRESTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFSSQPAGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPTTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVREAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRTPRTPTRVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNPQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLLLLYKTYGWKLHMYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAK
SVQHRVSLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLRHQYMNLYPVARQRPGLCQVFADATPTGWGLAIGPQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ315785_Pol_P-A Product feature CHAIN DQ315785_Pol_P-A of FT:mat_peptide DQ315785_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI0386). Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSPVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHSQRHGDEPFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPGRSGSIRA
RVHSTTRRCFGVDPSGSGHISHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVFHSFPPSSARSQSQGPVSSCWWL
QFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNLHDSCSRQL
YVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
YTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPY
RPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ315786_Pol_P-A Product feature CHAIN DQ315786_Pol_P-A of FT:mat_peptide DQ315786_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCLGVEPSGSGHIGHSASSASSCLHQSEVRKAAYSHLSTSKRQSSSGHAVFHSFPPSSARSQSQGP
VSSCWWLQFRDSQPCSQYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ788725_Pol_P-A Product feature CHAIN DQ788725_Pol_P-A of FT:mat_peptide DQ788725_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQSG
RSGSIRARAHPSTWRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCRPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EF103278_Pol_P-A Product feature CHAIN EF103278_Pol_P-A of FT:mat_peptide EF103278_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPQIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVINHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIETSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCLGVEPSGSGHIGHSASSASSCLHQSTVRKAAYSHLSTPKRQSSSGHAVEFHSFPPNSARSQSQG
PVFSCWWLQFRNTQPCSKYCLAHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPSLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTRRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFKKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVSPLPIHTAELQAAWFARSRSGAKLIGTDNSVVLSRKYTSVPWLLGCTANWILRGTSLVYVPSALNPADDPSRGRLGLY
RPLLRPPYRPTSGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EF208113_Pol_P-A Product feature CHAIN EF208113_Pol_P-A of FT:mat_peptide EF208113_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU054331_Pol_C-A Product feature CHAIN EU054331_Pol_C-A of FT:mat_peptide EU054331_Pol_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNSTKYLPLDKGIKPYYPDHVVNHYFQARHYLHTLWKAGILY
KRETTSSASFCGSPYSWEQELQHGRLVTKTSQRHGDKSFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSSSGHIDYRASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSTRSQSQG
PVFSCGVLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCTRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGCWGSLPQDHIVQKLKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNHADDPSRGPLVIS
RPLLCLTFRTTTERTSHSTAYPSVPSHLTDRVHFASPLHVAWRPP
>gnl|hbvpro|EU086721_Pol_P-A Product feature CHAIN EU086721_Pol_P-A of FT:mat_peptide EU086721_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU185786_Pol_P-A Product feature CHAIN EU185786_Pol_P-A of FT:mat_peptide EU185786_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU11). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQSHQGPLASSQPG
RSGSIRARAHPSXRRYFGVEPSGSGHIDHSVNNSSSCLQQSXVRKAAYSHLSTSXRXSSSGHAVEFHCLPPSSXGSLSQG
SVFSCWWLQFRNSKPCSEYXLSHLVXLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYFARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLXXTYGXKLHLYXXPIVLGXRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVXXAK
SVQHREXLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU185787_Pol_P-A Product feature CHAIN EU185787_Pol_P-A of FT:mat_peptide EU185787_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFXPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRXGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTXESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYFARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYXXPIVLGXRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVZHREXLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU185789_Pol_P-A Product feature CHAIN EU185789_Pol_P-A of FT:mat_peptide EU185789_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCXQFVGPLTVNEKRRLKLXXPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPXSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDXGPCDEHGEHXIRTPRTPAXVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYFARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYXXPIVLGXRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREXLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU366129_Pol_P-A Product feature CHAIN EU366129_Pol_P-A of FT:mat_peptide EU366129_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRXSTXSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLASSQSG
RSGSIRARVHSPTRRCSGVEPSGSGHTXHXASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSPARSQSKG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SAQHLEALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU410082_Pol_P-A Product feature CHAIN EU410082_Pol_P-A of FT:mat_peptide EU410082_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSANSSSSCLHQSAVRKAAYSHFSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU414132_Pol_P-A Product feature CHAIN EU414132_Pol_P-A of FT:mat_peptide EU414132_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNXNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQTG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFXKLPVNRPIDWKVCQXIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADXXPTGWGXAIGHXRMRGT
FVAPLPIHTAXLLXACFARXRSGAKLIXTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPABBPSRGRLXLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPL
>gnl|hbvpro|EU414133_Pol_P-A Product feature CHAIN EU414133_Pol_P-A of FT:mat_peptide EU414133_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYXDQVVNHYFXTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQTG
XSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQKIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594383_Pol_P-A Product feature CHAIN EU594383_Pol_P-A of FT:mat_peptide EU594383_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPNIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSTGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594384_Pol_P-A Product feature CHAIN EU594384_Pol_P-A of FT:mat_peptide EU594384_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSISKRQSSSGNAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594385_Pol_P-A Product feature CHAIN EU594385_Pol_P-A of FT:mat_peptide EU594385_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594386_Pol_P-A Product feature CHAIN EU594386_Pol_P-A of FT:mat_peptide EU594386_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGNAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGFSGLSRYVARLSYNSRINNNQYGTMQNM
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594387_Pol_P-A Product feature CHAIN EU594387_Pol_P-A of FT:mat_peptide EU594387_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSIGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594388_Pol_P-A Product feature CHAIN EU594388_Pol_P-A of FT:mat_peptide EU594388_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594389_Pol_P-A Product feature CHAIN EU594389_Pol_P-A of FT:mat_peptide EU594389_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594390_Pol_P-A Product feature CHAIN EU594390_Pol_P-A of FT:mat_peptide EU594390_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594391_Pol_P-A Product feature CHAIN EU594391_Pol_P-A of FT:mat_peptide EU594391_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594392_Pol_P-A Product feature CHAIN EU594392_Pol_P-A of FT:mat_peptide EU594392_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594393_Pol_P-A Product feature CHAIN EU594393_Pol_P-A of FT:mat_peptide EU594393_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHISTSKRQSSSGHAVEFHCLPPSSAGSKSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594394_Pol_P-A Product feature CHAIN EU594394_Pol_P-A of FT:mat_peptide EU594394_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU594395_Pol_P-A Product feature CHAIN EU594395_Pol_P-A of FT:mat_peptide EU594395_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU747320_Pol_P-A Product feature CHAIN EU747320_Pol_P-A of FT:mat_peptide EU747320_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V51). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SISSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTADSRLVVEFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKECQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKLYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRTP
>gnl|hbvpro|EU859898_Pol_P-A Product feature CHAIN EU859898_Pol_P-A of FT:mat_peptide EU859898_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859899_Pol_P-A Product feature CHAIN EU859899_Pol_P-A of FT:mat_peptide EU859899_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859900_Pol_P-A Product feature CHAIN EU859900_Pol_P-A of FT:mat_peptide EU859900_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSPRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSKG
ITRVSWAKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859901_Pol_P-A Product feature CHAIN EU859901_Pol_P-A of FT:mat_peptide EU859901_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859902_Pol_P-A Product feature CHAIN EU859902_Pol_P-A of FT:mat_peptide EU859902_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWEAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859903_Pol_P-A Product feature CHAIN EU859903_Pol_P-A of FT:mat_peptide EU859903_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859904_Pol_P-A Product feature CHAIN EU859904_Pol_P-A of FT:mat_peptide EU859904_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859905_Pol_P-A Product feature CHAIN EU859905_Pol_P-A of FT:mat_peptide EU859905_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859906_Pol_P-A Product feature CHAIN EU859906_Pol_P-A of FT:mat_peptide EU859906_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859907_Pol_P-A Product feature CHAIN EU859907_Pol_P-A of FT:mat_peptide EU859907_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859908_Pol_P-A Product feature CHAIN EU859908_Pol_P-A of FT:mat_peptide EU859908_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859909_Pol_P-A Product feature CHAIN EU859909_Pol_P-A of FT:mat_peptide EU859909_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859910_Pol_P-A Product feature CHAIN EU859910_Pol_P-A of FT:mat_peptide EU859910_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWEAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859911_Pol_P-A Product feature CHAIN EU859911_Pol_P-A of FT:mat_peptide EU859911_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859912_Pol_P-A Product feature CHAIN EU859912_Pol_P-A of FT:mat_peptide EU859912_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLVDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859913_Pol_P-A Product feature CHAIN EU859913_Pol_P-A of FT:mat_peptide EU859913_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859914_Pol_P-A Product feature CHAIN EU859914_Pol_P-A of FT:mat_peptide EU859914_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859915_Pol_P-A Product feature CHAIN EU859915_Pol_P-A of FT:mat_peptide EU859915_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859916_Pol_P-A Product feature CHAIN EU859916_Pol_P-A of FT:mat_peptide EU859916_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859917_Pol_P-A Product feature CHAIN EU859917_Pol_P-A of FT:mat_peptide EU859917_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859918_Pol_P-A Product feature CHAIN EU859918_Pol_P-A of FT:mat_peptide EU859918_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859919_Pol_P-A Product feature CHAIN EU859919_Pol_P-A of FT:mat_peptide EU859919_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859920_Pol_P-A Product feature CHAIN EU859920_Pol_P-A of FT:mat_peptide EU859920_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRWKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859921_Pol_P-A Product feature CHAIN EU859921_Pol_P-A of FT:mat_peptide EU859921_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859922_Pol_P-A Product feature CHAIN EU859922_Pol_P-A of FT:mat_peptide EU859922_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859923_Pol_P-A Product feature CHAIN EU859923_Pol_P-A of FT:mat_peptide EU859923_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLSPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCEYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859924_Pol_P-A Product feature CHAIN EU859924_Pol_P-A of FT:mat_peptide EU859924_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHFSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859925_Pol_P-A Product feature CHAIN EU859925_Pol_P-A of FT:mat_peptide EU859925_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859926_Pol_P-A Product feature CHAIN EU859926_Pol_P-A of FT:mat_peptide EU859926_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859927_Pol_P-A Product feature CHAIN EU859927_Pol_P-A of FT:mat_peptide EU859927_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADANPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859928_Pol_P-A Product feature CHAIN EU859928_Pol_P-A of FT:mat_peptide EU859928_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859929_Pol_P-A Product feature CHAIN EU859929_Pol_P-A of FT:mat_peptide EU859929_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859930_Pol_P-A Product feature CHAIN EU859930_Pol_P-A of FT:mat_peptide EU859930_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859931_Pol_P-A Product feature CHAIN EU859931_Pol_P-A of FT:mat_peptide EU859931_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859932_Pol_P-A Product feature CHAIN EU859932_Pol_P-A of FT:mat_peptide EU859932_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859933_Pol_P-A Product feature CHAIN EU859933_Pol_P-A of FT:mat_peptide EU859933_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859934_Pol_P-A Product feature CHAIN EU859934_Pol_P-A of FT:mat_peptide EU859934_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQIPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSTYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRHSSSGHTVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGCKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859935_Pol_P-A Product feature CHAIN EU859935_Pol_P-A of FT:mat_peptide EU859935_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859936_Pol_P-A Product feature CHAIN EU859936_Pol_P-A of FT:mat_peptide EU859936_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859937_Pol_P-A Product feature CHAIN EU859937_Pol_P-A of FT:mat_peptide EU859937_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLATSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859938_Pol_P-A Product feature CHAIN EU859938_Pol_P-A of FT:mat_peptide EU859938_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELPHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGRAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAT
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859939_Pol_P-A Product feature CHAIN EU859939_Pol_P-A of FT:mat_peptide EU859939_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSSHAVEFHCLPPSSTGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAT
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FGAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859940_Pol_P-A Product feature CHAIN EU859940_Pol_P-A of FT:mat_peptide EU859940_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGALPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859941_Pol_P-A Product feature CHAIN EU859941_Pol_P-A of FT:mat_peptide EU859941_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859942_Pol_P-A Product feature CHAIN EU859942_Pol_P-A of FT:mat_peptide EU859942_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859943_Pol_P-A Product feature CHAIN EU859943_Pol_P-A of FT:mat_peptide EU859943_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCHEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859944_Pol_P-A Product feature CHAIN EU859944_Pol_P-A of FT:mat_peptide EU859944_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPQQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSTGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859945_Pol_P-A Product feature CHAIN EU859945_Pol_P-A of FT:mat_peptide EU859945_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859946_Pol_P-A Product feature CHAIN EU859946_Pol_P-A of FT:mat_peptide EU859946_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGALPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYTCIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859947_Pol_P-A Product feature CHAIN EU859947_Pol_P-A of FT:mat_peptide EU859947_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSTSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGALPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859948_Pol_P-A Product feature CHAIN EU859948_Pol_P-A of FT:mat_peptide EU859948_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQSG
RSGSIRARAHPSTRGYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859949_Pol_P-A Product feature CHAIN EU859949_Pol_P-A of FT:mat_peptide EU859949_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQSG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859950_Pol_P-A Product feature CHAIN EU859950_Pol_P-A of FT:mat_peptide EU859950_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESKLVVDFSQFSRGIT
RVSWPRFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNLHD
SCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859951_Pol_P-A Product feature CHAIN EU859951_Pol_P-A of FT:mat_peptide EU859951_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSQSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859952_Pol_P-A Product feature CHAIN EU859952_Pol_P-A of FT:mat_peptide EU859952_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSTTVPTFNPDWQTPS
FPKIHLHEDIINRCQHFVGPLTVNEKRRLKLIMPARFYPTSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVINTSHRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSAKGSSSCLDQSAVRKAADSHLSTSKRQSSSGHAVEFHNLPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGTSGLSRYVARLSSNSRNHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIAQKLKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FAAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU859953_Pol_P-A Product feature CHAIN EU859953_Pol_P-A of FT:mat_peptide EU859953_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASGQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859954_Pol_P-A Product feature CHAIN EU859954_Pol_P-A of FT:mat_peptide EU859954_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859955_Pol_P-A Product feature CHAIN EU859955_Pol_P-A of FT:mat_peptide EU859955_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVKLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU859956_Pol_P-A Product feature CHAIN EU859956_Pol_P-A of FT:mat_peptide EU859956_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVKLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349224_Pol_P-A Product feature CHAIN FJ349224_Pol_P-A of FT:mat_peptide FJ349224_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349296_Pol_P-A Product feature CHAIN FJ349296_Pol_P-A of FT:mat_peptide FJ349296_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIIDRCQQFVGPLTINEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQSG
RSGSIWARVHPSTRRYSGVEPSGSGHIDYRANSSSSCLHQSAVRKAADSHLSTSKRQSSSGHAVEFHSFPPSSTRSQSQG
PVFSCWWVQFRNSQPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLFTAVTNFLLSLGIHLNTNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIRHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYRAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSGLNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692554_Pol_P-A Product feature CHAIN FJ692554_Pol_P-A of FT:mat_peptide FJ692554_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQWHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQAG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLRQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPNSTRSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCSDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQKL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ692557_Pol_P-A Product feature CHAIN FJ692557_Pol_P-A of FT:mat_peptide FJ692557_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692558_Pol_P-A Product feature CHAIN FJ692558_Pol_P-A of FT:mat_peptide FJ692558_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETVAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLNLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRGQFKQSRLGLQPXQXPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLYQSAVRKAAYSHLSTSKRQSSSGPXVEFHSFTXNSARSQSQG
PXFPCWWLQFRNTQPCSEYCLSHLVNLREDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLLLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVXNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692559_Pol_P-A Product feature CHAIN FJ692559_Pol_P-A of FT:mat_peptide FJ692559_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQXFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGXLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSIGPRIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHFSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VNRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692561_Pol_P-A Product feature CHAIN FJ692561_Pol_P-A of FT:mat_peptide FJ692561_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRXLLLLDVEPEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQXSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
XSGSIRARVHSPTRRCXGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ATRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692562_Pol_P-A Product feature CHAIN FJ692562_Pol_P-A of FT:mat_peptide FJ692562_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHSFPPSSARSQSQG
PVFSCWWLQFKNTQPCSKYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGALPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692563_Pol_P-A Product feature CHAIN FJ692563_Pol_P-A of FT:mat_peptide FJ692563_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692564_Pol_P-A Product feature CHAIN FJ692564_Pol_P-A of FT:mat_peptide FJ692564_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQPRLGLQPRQGPLATGQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHNASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692565_Pol_P-A Product feature CHAIN FJ692565_Pol_P-A of FT:mat_peptide FJ692565_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDEXEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQPRLGLQPRQGPLATGQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHXASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHXVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGXHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692566_Pol_P-A Product feature CHAIN FJ692566_Pol_P-A of FT:mat_peptide FJ692566_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDEPFCSQPSGIPSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSTTRRCFGVEPSGSGHIGHGASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSTYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
INRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKQCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAXLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692567_Pol_P-A Product feature CHAIN FJ692567_Pol_P-A of FT:mat_peptide FJ692567_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNXNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISTRCQEFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIETSQRHGDEPFCSQXSGILSRSSVGPCIRSQFKQXRLGLQPSQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHBFPXSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692571_Pol_P-A Product feature CHAIN FJ692571_Pol_P-A of FT:mat_peptide FJ692571_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRHVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWXPP
>gnl|hbvpro|FJ692572_Pol_P-A Product feature CHAIN FJ692572_Pol_P-A of FT:mat_peptide FJ692572_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50013). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIETSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ATRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYXSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPARVHFXSPLHVAWRPP
>gnl|hbvpro|FJ692574_Pol_P-A Product feature CHAIN FJ692574_Pol_P-A of FT:mat_peptide FJ692574_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692575_Pol_P-A Product feature CHAIN FJ692575_Pol_P-A of FT:mat_peptide FJ692575_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIADRCQQFVGPLTANEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHXXHSASSSSSCLXQSAVRXAAYSHLSTSKRQSSSGXAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYXNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692576_Pol_P-A Product feature CHAIN FJ692576_Pol_P-A of FT:mat_peptide FJ692576_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLEDDPEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETSRSASFCGSPYSWEQELHHGRLVINTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEXHSFPPXSARSQXQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692577_Pol_P-A Product feature CHAIN FJ692577_Pol_P-A of FT:mat_peptide FJ692577_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TXQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692578_Pol_P-A Product feature CHAIN FJ692578_Pol_P-A of FT:mat_peptide FJ692578_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692579_Pol_P-A Product feature CHAIN FJ692579_Pol_P-A of FT:mat_peptide FJ692579_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692580_Pol_P-A Product feature CHAIN FJ692580_Pol_P-A of FT:mat_peptide FJ692580_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692581_Pol_P-A Product feature CHAIN FJ692581_Pol_P-A of FT:mat_peptide FJ692581_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692582_Pol_P-A Product feature CHAIN FJ692582_Pol_P-A of FT:mat_peptide FJ692582_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692583_Pol_P-A Product feature CHAIN FJ692583_Pol_P-A of FT:mat_peptide FJ692583_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692584_Pol_P-A Product feature CHAIN FJ692584_Pol_P-A of FT:mat_peptide FJ692584_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692585_Pol_P-A Product feature CHAIN FJ692585_Pol_P-A of FT:mat_peptide FJ692585_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPRIRSQFKQSRLGLQPRQGPLATSQPS
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAGSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692587_Pol_P-A Product feature CHAIN FJ692587_Pol_P-A of FT:mat_peptide FJ692587_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Non-functional genomic sequence. [Hepadnaviridae] (length=839 residues).
MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPTIHLHEDIIBRCQQFVGPLTVNEKRRLKLIMPARFFPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQPGRSGSIR
PRVHSPTRRCFGVEPSGSGHIGYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQGPVSSCW
WLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGPTRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRIHNNQYGTLQNLHDSCSR
QLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLE
SLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692588_Pol_P-A Product feature CHAIN FJ692588_Pol_P-A of FT:mat_peptide FJ692588_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=846 residues).
MPLSYQHFRKLLLLDDETGKAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTP
SFPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGIL
YKRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQPRLGLQPRQGPLATSQP
GRSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQ
GPVFSCWWLQFRNTQPCSKYCLSQLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSR
GITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTLQN
LHDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGA
KSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHILQKIKHCFRKLPVNRPIDWKVCQRIV
GLLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRG
TFVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGL
YRPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692590_Pol_P-A Product feature CHAIN FJ692590_Pol_P-A of FT:mat_peptide FJ692590_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDISNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQPRLGLQPRQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692591_Pol_P-A Product feature CHAIN FJ692591_Pol_P-A of FT:mat_peptide FJ692591_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIXNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLXKGIKPYYPDHXVNHYFQXRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLXIKTSQRHGDEXFCSQPSGILSRSSVGPCIRSQXKQPRLGLQPXQGPLATSQXG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHXFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692592_Pol_P-A Product feature CHAIN FJ692592_Pol_P-A of FT:mat_peptide FJ692592_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNSTKYLPLHKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQEIHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQXHQGPLATSQPG
RSGSIWPRVHSPTRRCFGVEPAGSGHSGYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSAGSKSQG
PVFSCWWLQFRNAQPCSXYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSXLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAX
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692593_Pol_P-A Product feature CHAIN FJ692593_Pol_P-A of FT:mat_peptide FJ692593_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPXTHKVGNFTGLYSSTVPSFNPDWQTPAFP
KIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLDISTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQEPLATSQSGRS
GSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPSSAXSQSQGPV
FSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGIS
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNLHD
SCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692595_Pol_P-A Product feature CHAIN FJ692595_Pol_P-A of FT:mat_peptide FJ692595_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDNDTEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRESTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQXSGIXSRSSVGPCIRSQLKQSRLGLQPQQGPLATSQSG
XSGSIWARVHPSTRRCPGVEPSGSGHIDHSASSSSSCLHQSAVRKAAXSHLSTSKRQSSSGHXVEFHSFPPXSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
FLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692596_Pol_P-A Product feature CHAIN FJ692596_Pol_P-A of FT:mat_peptide FJ692596_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPXWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQSSSXHAVEFHXFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSGYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692597_Pol_P-A Product feature CHAIN FJ692597_Pol_P-A of FT:mat_peptide FJ692597_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDXXSEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRESTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQAG
RSGSIXARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYXHLSTSKRQSSSGHAVEFHSXPPSXARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHYIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGXWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGXTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692598_Pol_P-A Product feature CHAIN FJ692598_Pol_P-A of FT:mat_peptide FJ692598_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
GSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCISHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSBLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLXXYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAXTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYAXIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ692599_Pol_P-A Product feature CHAIN FJ692599_Pol_P-A of FT:mat_peptide FJ692599_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYRHFLKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLNVNEKRRLKLIMPARFYPNNTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGSCIRSQLKQSRLGLQPHQGPLATSQSG
RSGRIWARVHPSTRRCSGVEPSGSGHIDYSASSSPSCLHQSAVRKAAYAHLSTSKRQSSSGHAVEFHSFSPSAARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAXCSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692600_Pol_P-A Product feature CHAIN FJ692600_Pol_P-A of FT:mat_peptide FJ692600_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDXTEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGXLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFXSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYXHLSTXKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHXIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSGYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692601_Pol_P-A Product feature CHAIN FJ692601_Pol_P-A of FT:mat_peptide FJ692601_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQXPLATSQSG
RSGSIWARVHPSTRRCSGMEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692602_Pol_P-A Product feature CHAIN FJ692602_Pol_P-A of FT:mat_peptide FJ692602_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQRPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYXHLSTSKRQSSSGHAMEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692603_Pol_P-A Product feature CHAIN FJ692603_Pol_P-A of FT:mat_peptide FJ692603_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEELNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTANEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRSDINTSQRHGDESFCSQPSGILSRSSVGPXIRXQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSASCLHQSAVXKAAYXHLSTSKRQSSSGHAVEFHSFPPXSARSQSQE
PVSSCWWLQFRNSKPCSEYCLSHLVNLXEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HYSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPXTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692604_Pol_P-A Product feature CHAIN FJ692604_Pol_P-A of FT:mat_peptide FJ692604_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRESTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSIGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPSXARSQSQG
PVFSCWWLQFRNSXPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692605_Pol_P-A Product feature CHAIN FJ692605_Pol_P-A of FT:mat_peptide FJ692605_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRXDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPXSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
XVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692606_Pol_P-A Product feature CHAIN FJ692606_Pol_P-A of FT:mat_peptide FJ692606_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINSSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQRPLATSQSG
RSGSIWPRVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQPSSGHAMEFPSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHIVNLLEDWGPCTDHGEHHIRIPXTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNXQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ692607_Pol_P-A Product feature CHAIN FJ692607_Pol_P-A of FT:mat_peptide FJ692607_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
GSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSQRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692608_Pol_P-A Product feature CHAIN FJ692608_Pol_P-A of FT:mat_peptide FJ692608_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINSSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQRPLATSQSG
RSGSIWPRVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQPSSGHAMEFHSFPPSSARSQGQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKITHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLRTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692609_Pol_P-A Product feature CHAIN FJ692609_Pol_P-A of FT:mat_peptide FJ692609_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRSDINTPQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692610_Pol_P-A Product feature CHAIN FJ692610_Pol_P-A of FT:mat_peptide FJ692610_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDEXEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRSDINTPQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPXXSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSXSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692611_Pol_P-A Product feature CHAIN FJ692611_Pol_P-A of FT:mat_peptide FJ692611_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRSXINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSPSCLHQSAVRKAAYTHLSTSKRQSSSGNTVEFHSFPPSSARSHSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLRTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHPPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ692612_Pol_P-A Product feature CHAIN FJ692612_Pol_P-A of FT:mat_peptide FJ692612_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPSAARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYQTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692613_Pol_P-A Product feature CHAIN FJ692613_Pol_P-A of FT:mat_peptide FJ692613_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRRLLLLDDEIEAGPLEDELPRLADEDLNHRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDINTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASNSSSCLHQSAVRKTAYTHLSTSKGQSSSGHAVEFHSFPPXPARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYITLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYAAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904434_Pol_P-A Product feature CHAIN FJ904434_Pol_P-A of FT:mat_peptide FJ904434_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=836 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTYTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQDLQHGRLVIKTSQRHGDESICSQPSGILSRSSVGPCIXSQLKQSRLGLQPHQGSLASSQPG
RSGSIRPRVHPSTRRCFGVEPSGSGHIDNSVNSSSSCLHQSAVRKAAYSHFSSSKRQSSSGHAXEFHCHPPTSVSCWWLQ
FRNSKPCSEYCLSHLVNLREDWGPCEEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGATRVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTLQNLHDSCSRQLY
VSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAXCSXVRRAFPHCLAFSYMDDVVLGAKSVQHRESLF
TAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYASIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVSPLPIHT
AELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQ
PTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FM199974_Pol_P-A Product feature CHAIN FM199974_Pol_P-A of FT:mat_peptide FM199974_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIRPRVHSPTRRCLGVEPSGSGQIGYFASSSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFXSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHIVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPGYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAXGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLX
RPLLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FM199976_Pol_P-A Product feature CHAIN FM199976_Pol_P-A of FT:mat_peptide FM199976_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQSSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCLGVEPSGSGHIGYFASSSSSCLHQSAVRKAAHSHLSTSKRQSSSGXAVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLKAQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FM199977_Pol_P-A Product feature CHAIN FM199977_Pol_P-A of FT:mat_peptide FM199977_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLXIKTSQRHGDESICSQPSGILSRSSIGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPXYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGXHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FM199978_Pol_P-A Product feature CHAIN FM199978_Pol_P-A of FT:mat_peptide FM199978_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTXFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FM199979_Pol_P-A Product feature CHAIN FM199979_Pol_P-A of FT:mat_peptide FM199979_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSTSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FM199980_Pol_P-A Product feature CHAIN FM199980_Pol_P-A of FT:mat_peptide FM199980_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRXLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGXLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FM199981_Pol_P-A Product feature CHAIN FM199981_Pol_P-A of FT:mat_peptide FM199981_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRXVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELXHGRLVIKTSQRHGDESICSQPSGILSRSSIGPCIRSQFKQSRLGPQPHQGPLATIQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHIVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYXARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FN545825_Pol_P-A Product feature CHAIN FN545825_Pol_P-A of FT:mat_peptide FN545825_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEXLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNQEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQARLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHNFPPSSARSQSKG
PVSSCWWLQFRNSNPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKLKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALXPLYACIHAKQAFTFSPTYKAFLRKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545826_Pol_P-A Product feature CHAIN FN545826_Pol_P-A of FT:mat_peptide FN545826_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQSG
RSGSIWARXHPSTRRYSGVEPSGSGHIDYSANSSSSCLHQSAVRKAADSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTEHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVPWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNDQYRTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLFTAVTNFLLSLGIHLNTNKTKRWGYSLNFMGYIIGSWGSLPQDHIVRKIRQCFRLLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FMAPLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545828_Pol_P-A Product feature CHAIN FN545828_Pol_P-A of FT:mat_peptide FN545828_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTQAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHIVNHYFQAQHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQVLPHGRLVAKTSQRHGDESVCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARXHPSTRRCSGVEPSGSGHTDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSTRSQGQG
PVFPCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSAGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLDSLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQAHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545829_Pol_P-A Product feature CHAIN FN545829_Pol_P-A of FT:mat_peptide FN545829_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTELGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQAQHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVAKTSQRHGDESFGSQPSGILSRSSVGPCIRSQLKQSRLGLQPQQGPLVTSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHNFPPSSAGSQGQG
PVFPCWWLQFRNSKPCSEYCLSHLVNLREDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSAGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVPLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQAHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545830_Pol_P-A Product feature CHAIN FN545830_Pol_P-A of FT:mat_peptide FN545830_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHQVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRFVAKTSQRHGDESFCSKPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLVTSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHPVXFHNFPPSSARSQGQG
PVFTCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRXPRTPARVTGGIFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSAGLSRYVARLSSNSRIHDHQXGTLPNL
HDSCSRQLYVSLLLLYKTYGRKLHLYSHPLIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYTIGSWGSLPQAHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLREQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545831_Pol_P-A Product feature CHAIN FN545831_Pol_P-A of FT:mat_peptide FN545831_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNSEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLRQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQHGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSTLNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545832_Pol_P-A Product feature CHAIN FN545832_Pol_P-A of FT:mat_peptide FN545832_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDXGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLNKNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQAQHYLHTLWKAGILY
XRETTRSASFCGSPYXWEQELHHGRLVAKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATGQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDNSASSSSSCLHQSEVRKAAYSHFSTSKRQSSSGHAVEFHNFPPSSARSQGQG
PVFPCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
XTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSAGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIXHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545833_Pol_P-A Product feature CHAIN FN545833_Pol_P-A of FT:mat_peptide FN545833_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFXGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRFVTKTSQRHGDESFCAQPSGIFSRSSVGPCIRSQLKQSRLGRQPLQGSLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYSHLSTSKRHSSSGHSVEFHNFPPSSARSQGQG
PVSPCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPXRVTGGVFLVDKNPHNTXESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSAGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLLLLYKTYGRKLHLYSHPIXLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPSKTKRWGYSLNFMGYIIGSWGSLPQDHIVHKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545834_Pol_P-A Product feature CHAIN FN545834_Pol_P-A of FT:mat_peptide FN545834_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPCTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRXVXKTSQRHGDESFCAQPSGIFSRSSVGPCIRSQLKQSRLGRQPLQGSLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHTDYSASSSSSCLHQSAVRKAAYAHLSTSKRHSSSGHSVEFHNFPPSSARSQGQG
PVSPCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPXRVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLXGSAGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLLLLYKTYGRKLHLYSHPIVLGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPSKTKRWGYSLNFMGYIIGSWGSLPQDHIVHKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545835_Pol_P-A Product feature CHAIN FN545835_Pol_P-A of FT:mat_peptide FN545835_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQAQHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVAKTSQRHGDESVCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGXTDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAXEFHNFPPSSTRSQGQG
PVFPCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSAGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQAHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545836_Pol_P-A Product feature CHAIN FN545836_Pol_P-A of FT:mat_peptide FN545836_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDSKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLRQSAVRKAAYTHLSTSKRQSSSGHAVEFHSFPPSSTRSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNYQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQTRQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545838_Pol_P-A Product feature CHAIN FN545838_Pol_P-A of FT:mat_peptide FN545838_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDYGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVTKTSQRHGDKSFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQSG
RSGSIRARVHPSTRRCSGVEPSGSGHIDYRASSSSSCLHQSAVREAAYSHLSTSKRQSSAGHAVEFHXFPPSSXRSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSAGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGCWGTLPQDHIVHKLKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545840_Pol_P-A Product feature CHAIN FN545840_Pol_P-A of FT:mat_peptide FN545840_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=841 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPKWQTPS
FPKIHLHEDIINRCQQFVGPLTANEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQAQHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQXLHHGRLVAKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQSHQGPLVTSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPTSSARSQGQG
CWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGPTRV
SWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGAAGLSRYVARLSSNSRIHNHQYGTLQNLHDSC
SRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQH
LESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGF
AAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAP
LPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLL
RLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161813_Pol_P-A Product feature CHAIN GQ161813_Pol_P-A of FT:mat_peptide GQ161813_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPT
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESICSQPSGILSRSSVGPCIRSQHKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCSGVEPSGSGHIDYCASSSSSCCHQSAVRKAAYSHLSTSKRQSSSGHAVELHSFPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKNCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYVNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ184323_Pol_P-A Product feature CHAIN GQ184323_Pol_P-A of FT:mat_peptide GQ184323_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFLPLSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTPNWILRGTSFVYVPSALNPADDPSRARLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ184324_Pol_P-A Product feature CHAIN GQ184324_Pol_P-A of FT:mat_peptide GQ184324_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLFGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDFCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ331046_Pol_P-A Product feature CHAIN GQ331046_Pol_P-A of FT:mat_peptide GQ331046_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSTTVPTFNPDWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTSTKYLPLDKGIKPYYPNQVVNHYFQAQHYLHTLWKAGILY
KRESTRSASFCGSPYSWEQELQHGRLVINSSQRHGDKSFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLAKSQPG
RSGSIWARVHPSTRRCFGVEPSGSGSIDHAAKGSSSCLHQSAVRKAAYSHLSTSKRQSSSGRAVGVHNLPPSSARSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGTSGLSRYVARLSSNSRNHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKQCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ331047_Pol_P-A Product feature CHAIN GQ331047_Pol_P-A of FT:mat_peptide GQ331047_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNPNVSIPWTHKVGNFTGLYSTTVPTFNPDWQTPS
FPKIHLHEDIINRCQHFVGPLTVNEKRRLKLIMPARFYPTSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVINTSHRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSAKGSSSCLDQSAVRKAADSHLSTSKRQSSSGHAVEFHNLPPSSARSQSQG
PVFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGTSGLSRYVARLSSNSRNHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIAQKLKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FAAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ414522_Pol_P-A Product feature CHAIN GQ414522_Pol_P-A of FT:mat_peptide GQ414522_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477461_Pol_P-A Product feature CHAIN GQ477461_Pol_P-A of FT:mat_peptide GQ477461_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477462_Pol_P-A Product feature CHAIN GQ477462_Pol_P-A of FT:mat_peptide GQ477462_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLHLGDLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNERRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQARHYLETLWKAGILY
KRESTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRHFGVEPSGSGHIDNSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPDKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477463_Pol_P-A Product feature CHAIN GQ477463_Pol_P-A of FT:mat_peptide GQ477463_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQLFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSKVPIFNPEWQTPS
FPKIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFKARQYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARTHPSTRRYIGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGNAVELHCLPPSSARSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTGAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477464_Pol_P-A Product feature CHAIN GQ477464_Pol_P-A of FT:mat_peptide GQ477464_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTYTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWEAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRSFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHFSTSKRHSSSGHAVEFHCFPPSSAKSQSQG
SVFSCWWLQFRNSKPCSEYCISHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477465_Pol_P-A Product feature CHAIN GQ477465_Pol_P-A of FT:mat_peptide GQ477465_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLFVDDGSEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRVTTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGNAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477466_Pol_P-A Product feature CHAIN GQ477466_Pol_P-A of FT:mat_peptide GQ477466_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTANEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPPTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477467_Pol_P-A Product feature CHAIN GQ477467_Pol_P-A of FT:mat_peptide GQ477467_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSTRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477468_Pol_P-A Product feature CHAIN GQ477468_Pol_P-A of FT:mat_peptide GQ477468_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ISRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSKQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477469_Pol_P-A Product feature CHAIN GQ477469_Pol_P-A of FT:mat_peptide GQ477469_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQSFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTANEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQEPQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPPTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGNAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
NTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477470_Pol_P-A Product feature CHAIN GQ477470_Pol_P-A of FT:mat_peptide GQ477470_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGFQPHQGPLASSQPG
RSGSIRARAHPSTRRYFRVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477472_Pol_P-A Product feature CHAIN GQ477472_Pol_P-A of FT:mat_peptide GQ477472_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQYFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPRSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVNKNPHNTEESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477473_Pol_P-A Product feature CHAIN GQ477473_Pol_P-A of FT:mat_peptide GQ477473_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPHYPDQVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRHFGVEPSGSGHINHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSPAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAT
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGTLPQDHIVQKLKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRHQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477474_Pol_P-A Product feature CHAIN GQ477474_Pol_P-A of FT:mat_peptide GQ477474_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLHLGNLNVSIPWTHKVGNFTGLYSSTVPLFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILPRSSVGPCIRSQLKQSGLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKATYSHLSTSKRQSSSGHAVELRCLPPGSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLDSLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477475_Pol_P-A Product feature CHAIN GQ477475_Pol_P-A of FT:mat_peptide GQ477475_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPIHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFRSQPSGILSRSSVGPRIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARTHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSSHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477476_Pol_P-A Product feature CHAIN GQ477476_Pol_P-A of FT:mat_peptide GQ477476_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFSGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRSFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSTGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
VNRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSGYVARLSSNSRINNNQYGTMQNL
HVSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477477_Pol_P-A Product feature CHAIN GQ477477_Pol_P-A of FT:mat_peptide GQ477477_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRQTTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCRPPRSAGPQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCEEQGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYIARLSSNSRSNNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477478_Pol_P-A Product feature CHAIN GQ477478_Pol_P-A of FT:mat_peptide GQ477478_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKILLLDHGAEAGPLEEELPRLADADLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRKTTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQSHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSEGYQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGFAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477479_Pol_P-A Product feature CHAIN GQ477479_Pol_P-A of FT:mat_peptide GQ477479_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPNSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477480_Pol_P-A Product feature CHAIN GQ477480_Pol_P-A of FT:mat_peptide GQ477480_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQEIQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPNQGPLASSQPG
RSGSIRARAHPSTRRHFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAESQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477482_Pol_P-A Product feature CHAIN GQ477482_Pol_P-A of FT:mat_peptide GQ477482_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPQWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSTGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477484_Pol_P-A Product feature CHAIN GQ477484_Pol_P-A of FT:mat_peptide GQ477484_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDSTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWTAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQRPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITSVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477486_Pol_P-A Product feature CHAIN GQ477486_Pol_P-A of FT:mat_peptide GQ477486_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTANEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCFHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLKQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477487_Pol_P-A Product feature CHAIN GQ477487_Pol_P-A of FT:mat_peptide GQ477487_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLNLIMPARFYPSHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQTRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSSHAVEFHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFDSPLHVAWRPP
>gnl|hbvpro|GQ477488_Pol_P-A Product feature CHAIN GQ477488_Pol_P-A of FT:mat_peptide GQ477488_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477490_Pol_P-A Product feature CHAIN GQ477490_Pol_P-A of FT:mat_peptide GQ477490_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRSPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKLYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477491_Pol_P-A Product feature CHAIN GQ477491_Pol_P-A of FT:mat_peptide GQ477491_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTANEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPPTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477493_Pol_P-A Product feature CHAIN GQ477493_Pol_P-A of FT:mat_peptide GQ477493_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPEIHLQEDIINRCEHFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESVCSQPAGILSRSSVGPCIRSQLKQSRLGLQPPQGPLASSQPG
RSGSIRARAHTSTRRYFGVEPSGSXHMDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCFPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGKHHIRIPRTPARVTGGVFLVDKNPHNPAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFDSPLHVAWKPP
>gnl|hbvpro|GQ477494_Pol_P-A Product feature CHAIN GQ477494_Pol_P-A of FT:mat_peptide GQ477494_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQDLQHGRLVIKTSQRHGDESFGSQPSGILSRSSVGPCIRSQLKQSRLGLQSHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGAMQNL
HDSCSRQLYVSLLLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLSCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477495_Pol_P-A Product feature CHAIN GQ477495_Pol_P-A of FT:mat_peptide GQ477495_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGVLY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGSCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNKSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VSRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSKQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477496_Pol_P-A Product feature CHAIN GQ477496_Pol_P-A of FT:mat_peptide GQ477496_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQRFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477497_Pol_P-A Product feature CHAIN GQ477497_Pol_P-A of FT:mat_peptide GQ477497_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYAHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLMSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|GQ477498_Pol_P-A Product feature CHAIN GQ477498_Pol_P-A of FT:mat_peptide GQ477498_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGPGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLLLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477499_Pol_P-A Product feature CHAIN GQ477499_Pol_P-A of FT:mat_peptide GQ477499_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P105). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADANLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLNLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRRSTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARTHPSTRRYLGVEPSSSGHIDHSINNSSSCLHQSAVRKAAYSHLSTSKRQSSSSHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVEHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477500_Pol_P-A Product feature CHAIN GQ477500_Pol_P-A of FT:mat_peptide GQ477500_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYIARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477501_Pol_P-A Product feature CHAIN GQ477501_Pol_P-A of FT:mat_peptide GQ477501_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQDLQHGRLVIKTSQRHGDESFGSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASRQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLREQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477502_Pol_P-A Product feature CHAIN GQ477502_Pol_P-A of FT:mat_peptide GQ477502_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDHETEAGPLEEELPRLADADLNRRVAEDLNLGDLNVSIPWTHKVGNFSGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPAHTKYLPLDKGIKPYYPDQVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSINNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRG
NTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAT
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477503_Pol_P-A Product feature CHAIN GQ477503_Pol_P-A of FT:mat_peptide GQ477503_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477504_Pol_P-A Product feature CHAIN GQ477504_Pol_P-A of FT:mat_peptide GQ477504_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSKVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRKTTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRHFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSTNSRINNNQYRTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563545_Pol_P-A Product feature CHAIN GU563545_Pol_P-A of FT:mat_peptide GU563545_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563546_Pol_P-A Product feature CHAIN GU563546_Pol_P-A of FT:mat_peptide GU563546_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563547_Pol_P-A Product feature CHAIN GU563547_Pol_P-A of FT:mat_peptide GU563547_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQPSGILPRSSVGPRIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGMEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPNSARFQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563548_Pol_P-A Product feature CHAIN GU563548_Pol_P-A of FT:mat_peptide GU563548_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESICSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYFASSSSSCLHQSAVRKAAYSHLSTSKRKSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCFEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNTQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563550_Pol_P-A Product feature CHAIN GU563550_Pol_P-A of FT:mat_peptide GU563550_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563551_Pol_P-A Product feature CHAIN GU563551_Pol_P-A of FT:mat_peptide GU563551_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPSIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYAHLSTSKRQSSSGRAVEFHCLPPSSTGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVTWRPP
>gnl|hbvpro|GU563553_Pol_P-A Product feature CHAIN GU563553_Pol_P-A of FT:mat_peptide GU563553_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563554_Pol_P-A Product feature CHAIN GU563554_Pol_P-A of FT:mat_peptide GU563554_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQKIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563555_Pol_P-A Product feature CHAIN GU563555_Pol_P-A of FT:mat_peptide GU563555_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAFRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563557_Pol_P-A Product feature CHAIN GU563557_Pol_P-A of FT:mat_peptide GU563557_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563558_Pol_P-A Product feature CHAIN GU563558_Pol_P-A of FT:mat_peptide GU563558_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYSSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFLPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU563562_Pol_P-A Product feature CHAIN GU563562_Pol_P-A of FT:mat_peptide GU563562_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGNIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFXKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HE576988_Pol_P-A Product feature CHAIN HE576988_Pol_P-A of FT:mat_peptide HE576988_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HE576989_Pol_P-A Product feature CHAIN HE576989_Pol_P-A of FT:mat_peptide HE576989_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVESHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSGYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HM011485_Pol_P-A Product feature CHAIN HM011485_Pol_P-A of FT:mat_peptide HM011485_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETKAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPAGILSRSSVGPCIRSQFKQSRLGLQPHQRPLATSQPG
RSGSIRARAHSPTRRCFGVEPSGSGHIDHGASSSSSCLHQSAGRKAAYSHLSTSKRKSSSGHAVEFHSVPPSSARSQSQG
PVFSCWWLQFRNTQPCSQYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTMQNL
HDFCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVTWRPP
>gnl|hbvpro|HM363612_Pol_P-A Product feature CHAIN HM363612_Pol_P-A of FT:mat_peptide HM363612_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNQEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDESVCSQPSGILSRSSVGPRIRSQLKQSRLGLQPHQGPLATSQSG
RRGCIWARVHPSTRRCSGVEPSGSGHIDYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PIFSCWWLQFRNSKPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQSRQAFTFSPTFKAFLSNQYMNLYPVARQRPGLCQVSADATPTGSGKAIGKQGMRGP
FAARTPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPS
>gnl|hbvpro|HM363613_Pol_P-A Product feature CHAIN HM363613_Pol_P-A of FT:mat_peptide HM363613_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNQEWQTPS
FPKIHLHEDIINRCQQFVGPLNVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPGHVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRSVTKTSQRHGDESFCSQPSGILSRSQFGPCIRSQLKQARLGLQPHQGPLATSQSG
RSGSIWTRVHPSTRRCFGVEPSGSEPSPYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSKG
PVFSCWWLQFRNSNPCSEYCLSHLVNLLEDWGPCTDHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNHQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPS
>gnl|hbvpro|HM535200_Pol_P-A Product feature CHAIN HM535200_Pol_P-A of FT:mat_peptide HM535200_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWRAGILY
KRETTRSASFCGSPYSWEQELHHGRLVSQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYSASSSSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIEIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HM535205_Pol_P-A Product feature CHAIN HM535205_Pol_P-A of FT:mat_peptide HM535205_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVSQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRPRVHSPTRRCFGVEPSGSGHIGYSASSSSHCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSGWWLQFRNTQPCSKYCLSHLGNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLLLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGVHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYMNLYPVARQRSGLCQVFADATPTGWGLAVGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439721_Pol_P-A Product feature CHAIN JF439721_Pol_P-A of FT:mat_peptide JF439721_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHSSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEDHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439722_Pol_P-A Product feature CHAIN JF439722_Pol_P-A of FT:mat_peptide JF439722_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAVGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439723_Pol_P-A Product feature CHAIN JF439723_Pol_P-A of FT:mat_peptide JF439723_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDESFCSQPSGILPRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSGRSGSIW
ARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQGPVSSCW
WLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTTRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHGSCSR
QLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSAQHLE
SLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCLRKLPVDRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAVGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439724_Pol_P-A Product feature CHAIN JF439724_Pol_P-A of FT:mat_peptide JF439724_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHSSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLPSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADNPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439725_Pol_P-A Product feature CHAIN JF439725_Pol_P-A of FT:mat_peptide JF439725_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL451). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHSSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLCKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQSTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTLSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439727_Pol_P-A Product feature CHAIN JF439727_Pol_P-A of FT:mat_peptide JF439727_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL453). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQAPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWEAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSRG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAETRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSPYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439728_Pol_P-A Product feature CHAIN JF439728_Pol_P-A of FT:mat_peptide JF439728_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL454). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHSSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLCKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQSTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTLSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439729_Pol_P-A Product feature CHAIN JF439729_Pol_P-A of FT:mat_peptide JF439729_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLCPVARQRPGLCQVFADATPTGWGLAVGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439730_Pol_P-A Product feature CHAIN JF439730_Pol_P-A of FT:mat_peptide JF439730_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLPTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKRYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439731_Pol_P-A Product feature CHAIN JF439731_Pol_P-A of FT:mat_peptide JF439731_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL458). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSGEQELPQGRLVTQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATGQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHLASPLHVAWRPP
>gnl|hbvpro|JF439732_Pol_P-A Product feature CHAIN JF439732_Pol_P-A of FT:mat_peptide JF439732_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSGRSGSIW
ARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHPSTSKRQSSSGHAVEFHSFSPNSARSQSQGPVSSCW
WLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTTRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHDSCSR
QLYVSLMLLYKTYGRKLHLYSHPTILGFRKIPMGVGPSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSAQHLE
SLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439733_Pol_P-A Product feature CHAIN JF439733_Pol_P-A of FT:mat_peptide JF439733_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSGRSGSIW
ARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHPSTSKRQSSSGHAVEFHSFSPNSARSQSQGPVSSCW
WLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTTRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHDSCSR
QLYVSLMLLYKTYGRKLHLYSHPTILGFRKIPMGVGPSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSAQHLE
SLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439734_Pol_P-A Product feature CHAIN JF439734_Pol_P-A of FT:mat_peptide JF439734_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL461). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQHFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVPWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439735_Pol_P-A Product feature CHAIN JF439735_Pol_P-A of FT:mat_peptide JF439735_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439736_Pol_P-A Product feature CHAIN JF439736_Pol_P-A of FT:mat_peptide JF439736_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHSSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439737_Pol_P-A Product feature CHAIN JF439737_Pol_P-A of FT:mat_peptide JF439737_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439738_Pol_P-A Product feature CHAIN JF439738_Pol_P-A of FT:mat_peptide JF439738_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439739_Pol_P-A Product feature CHAIN JF439739_Pol_P-A of FT:mat_peptide JF439739_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL467). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDCVHFASPLHVAWRPP
>gnl|hbvpro|JF439740_Pol_P-A Product feature CHAIN JF439740_Pol_P-A of FT:mat_peptide JF439740_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL468). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQSTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439741_Pol_P-A Product feature CHAIN JF439741_Pol_P-A of FT:mat_peptide JF439741_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLATKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTPKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439742_Pol_P-A Product feature CHAIN JF439742_Pol_P-A of FT:mat_peptide JF439742_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLPSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWSLAVGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439743_Pol_P-A Product feature CHAIN JF439743_Pol_P-A of FT:mat_peptide JF439743_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTAQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAAKKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAVGHQRMRGT
FVAPLPIHTAEPLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439744_Pol_P-A Product feature CHAIN JF439744_Pol_P-A of FT:mat_peptide JF439744_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL473). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIYPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439745_Pol_P-A Product feature CHAIN JF439745_Pol_P-A of FT:mat_peptide JF439745_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL474). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSGRSGSIW
ARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQGPVSSCW
WLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTTRVSW
PKFAVPNLQSLTNLLPSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHDSCSR
QLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLE
SLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439746_Pol_P-A Product feature CHAIN JF439746_Pol_P-A of FT:mat_peptide JF439746_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPPTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439747_Pol_P-A Product feature CHAIN JF439747_Pol_P-A of FT:mat_peptide JF439747_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYRHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHSSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLRFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SAQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGHIIGSWGSLPQDHIVQKIKHCFRKLPVDRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439748_Pol_P-A Product feature CHAIN JF439748_Pol_P-A of FT:mat_peptide JF439748_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDPNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSG
RSGSIWARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAARKAAYSHLSTSKRQSSSGHAVDFHSFSPNSARSQSQG
PVSSCWWLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLPSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLRNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439750_Pol_P-A Product feature CHAIN JF439750_Pol_P-A of FT:mat_peptide JF439750_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL498). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQHFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSGRSGSIW
ARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQGPVSSCW
WLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTTRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHDSCSR
QLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFIYMDDVVLGAKSVQHLE
SLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439751_Pol_P-A Product feature CHAIN JF439751_Pol_P-A of FT:mat_peptide JF439751_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQSGRSGSIW
ARVHPSTRRCFGVEPSGSGHIDHSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPNSARSQSQGPVSSCW
WLQFRNSKPCSEYCLSHLVNLLDDWGPCTNHGEHHIRIPKAPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTTRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNLHDSCSR
QLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSAQHLE
SLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAVGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439752_Pol_P-A Product feature CHAIN JF439752_Pol_P-A of FT:mat_peptide JF439752_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439753_Pol_P-A Product feature CHAIN JF439753_Pol_P-A of FT:mat_peptide JF439753_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHFFIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439754_Pol_P-A Product feature CHAIN JF439754_Pol_P-A of FT:mat_peptide JF439754_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439755_Pol_P-A Product feature CHAIN JF439755_Pol_P-A of FT:mat_peptide JF439755_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439756_Pol_P-A Product feature CHAIN JF439756_Pol_P-A of FT:mat_peptide JF439756_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439757_Pol_P-A Product feature CHAIN JF439757_Pol_P-A of FT:mat_peptide JF439757_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439758_Pol_P-A Product feature CHAIN JF439758_Pol_P-A of FT:mat_peptide JF439758_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439759_Pol_P-A Product feature CHAIN JF439759_Pol_P-A of FT:mat_peptide JF439759_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKILLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439760_Pol_P-A Product feature CHAIN JF439760_Pol_P-A of FT:mat_peptide JF439760_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439761_Pol_P-A Product feature CHAIN JF439761_Pol_P-A of FT:mat_peptide JF439761_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439762_Pol_P-A Product feature CHAIN JF439762_Pol_P-A of FT:mat_peptide JF439762_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILFRSSVGPCIRSQLKQYRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHFLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439763_Pol_P-A Product feature CHAIN JF439763_Pol_P-A of FT:mat_peptide JF439763_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439764_Pol_P-A Product feature CHAIN JF439764_Pol_P-A of FT:mat_peptide JF439764_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439765_Pol_P-A Product feature CHAIN JF439765_Pol_P-A of FT:mat_peptide JF439765_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439766_Pol_P-A Product feature CHAIN JF439766_Pol_P-A of FT:mat_peptide JF439766_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF439767_Pol_P-A Product feature CHAIN JF439767_Pol_P-A of FT:mat_peptide JF439767_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSARPQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439768_Pol_P-A Product feature CHAIN JF439768_Pol_P-A of FT:mat_peptide JF439768_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSARPQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439769_Pol_P-A Product feature CHAIN JF439769_Pol_P-A of FT:mat_peptide JF439769_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSARPQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439774_Pol_P-A Product feature CHAIN JF439774_Pol_P-A of FT:mat_peptide JF439774_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLTPSSARPQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439777_Pol_P-A Product feature CHAIN JF439777_Pol_P-A of FT:mat_peptide JF439777_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSARPQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF440020_Pol_P-A Product feature CHAIN JF440020_Pol_P-A of FT:mat_peptide JF440020_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAKPQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182318_Pol_P-A Product feature CHAIN JN182318_Pol_P-A of FT:mat_peptide JN182318_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRGQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSYLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGLAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182320_Pol_P-A Product feature CHAIN JN182320_Pol_P-A of FT:mat_peptide JN182320_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFRVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHFSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQPYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVDRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182321_Pol_P-A Product feature CHAIN JN182321_Pol_P-A of FT:mat_peptide JN182321_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNFQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPRLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182323_Pol_P-A Product feature CHAIN JN182323_Pol_P-A of FT:mat_peptide JN182323_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQGHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRAGVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTTVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182324_Pol_P-A Product feature CHAIN JN182324_Pol_P-A of FT:mat_peptide JN182324_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQRYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVANFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182325_Pol_P-A Product feature CHAIN JN182325_Pol_P-A of FT:mat_peptide JN182325_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQAPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182326_Pol_P-A Product feature CHAIN JN182326_Pol_P-A of FT:mat_peptide JN182326_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPISNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKGQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPASMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTVELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSLVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182327_Pol_P-A Product feature CHAIN JN182327_Pol_P-A of FT:mat_peptide JN182327_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSPVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPPRRCFGVGPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182329_Pol_P-A Product feature CHAIN JN182329_Pol_P-A of FT:mat_peptide JN182329_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTAGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182330_Pol_P-A Product feature CHAIN JN182330_Pol_P-A of FT:mat_peptide JN182330_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HGSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLSPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182331_Pol_P-A Product feature CHAIN JN182331_Pol_P-A of FT:mat_peptide JN182331_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSPNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182332_Pol_P-A Product feature CHAIN JN182332_Pol_P-A of FT:mat_peptide JN182332_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARCYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRGTTRSASFCGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVSGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACMQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN182333_Pol_P-A Product feature CHAIN JN182333_Pol_P-A of FT:mat_peptide JN182333_Pol_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFRGSPYSWEQELHHGRLVTKTSQRHGDESFCPQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGYSASSASSCLHQSAVRKAAYSHLSTSKRQPSSGNAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNIQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFPQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLPRYVARLSSNSRIHNHQHGTLQDL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVSGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIVQKIKHCFRKLPVNRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACMQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHPPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ023661_Pol_P-A Product feature CHAIN JQ023661_Pol_P-A of FT:mat_peptide JQ023661_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=845 residues).
RPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWETPS
FPKIHLHEDIANRCQQFVGPLPVNEKRRLKLIKPARFFPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILF
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSCSGHIGHGASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCPEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRANPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPINRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ023662_Pol_P-A Product feature CHAIN JQ023662_Pol_P-A of FT:mat_peptide JQ023662_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1164). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
RPLSYQHFRKLLLFDDETEAGPLKEELPRLADENLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSCSGHIGHGASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFSPSSARSQSQG
PVFSCWWLQFRNTEPCSEYCLSHIINLLEDWGPCHEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTPANL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPINXXVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ023663_Pol_P-A Product feature CHAIN JQ023663_Pol_P-A of FT:mat_peptide JQ023663_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1159). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
RPLSYQHFRKLLLFDDETEAGPLKEELPRLANENLNRRVAKNLNLGNLNVSIPWTHKGGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSCSGHIGHGASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPINRPVDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ687529_Pol_P-A Product feature CHAIN JQ687529_Pol_P-A of FT:mat_peptide JQ687529_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRLSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ687533_Pol_P-A Product feature CHAIN JQ687533_Pol_P-A of FT:mat_peptide JQ687533_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPRIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLHKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLLLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707299_Pol_P-A Product feature CHAIN JQ707299_Pol_P-A of FT:mat_peptide JQ707299_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFFLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707300_Pol_P-A Product feature CHAIN JQ707300_Pol_P-A of FT:mat_peptide JQ707300_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRIAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPPYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707301_Pol_P-A Product feature CHAIN JQ707301_Pol_P-A of FT:mat_peptide JQ707301_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVHKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707302_Pol_P-A Product feature CHAIN JQ707302_Pol_P-A of FT:mat_peptide JQ707302_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707303_Pol_P-A Product feature CHAIN JQ707303_Pol_P-A of FT:mat_peptide JQ707303_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707304_Pol_P-A Product feature CHAIN JQ707304_Pol_P-A of FT:mat_peptide JQ707304_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707305_Pol_P-A Product feature CHAIN JQ707305_Pol_P-A of FT:mat_peptide JQ707305_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVKPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHEVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707306_Pol_P-A Product feature CHAIN JQ707306_Pol_P-A of FT:mat_peptide JQ707306_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RIGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLIGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707307_Pol_P-A Product feature CHAIN JQ707307_Pol_P-A of FT:mat_peptide JQ707307_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707308_Pol_P-A Product feature CHAIN JQ707308_Pol_P-A of FT:mat_peptide JQ707308_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707309_Pol_P-A Product feature CHAIN JQ707309_Pol_P-A of FT:mat_peptide JQ707309_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSFAGSQSQG
SVSSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707310_Pol_P-A Product feature CHAIN JQ707310_Pol_P-A of FT:mat_peptide JQ707310_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707311_Pol_P-A Product feature CHAIN JQ707311_Pol_P-A of FT:mat_peptide JQ707311_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707312_Pol_P-A Product feature CHAIN JQ707312_Pol_P-A of FT:mat_peptide JQ707312_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCPQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCSGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707313_Pol_P-A Product feature CHAIN JQ707313_Pol_P-A of FT:mat_peptide JQ707313_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707314_Pol_P-A Product feature CHAIN JQ707314_Pol_P-A of FT:mat_peptide JQ707314_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707315_Pol_P-A Product feature CHAIN JQ707315_Pol_P-A of FT:mat_peptide JQ707315_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707316_Pol_P-A Product feature CHAIN JQ707316_Pol_P-A of FT:mat_peptide JQ707316_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIETSQRHGDESFSSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707317_Pol_P-A Product feature CHAIN JQ707317_Pol_P-A of FT:mat_peptide JQ707317_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGVLY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707318_Pol_P-A Product feature CHAIN JQ707318_Pol_P-A of FT:mat_peptide JQ707318_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGRAVEFRCLPPSSAGSQSQG
SVFSWWWLQFRNSKPCSEYCLSHLVNLPEDWGPCEERGQCHISVQRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707319_Pol_P-A Product feature CHAIN JQ707319_Pol_P-A of FT:mat_peptide JQ707319_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKGQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCYEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSHSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707320_Pol_P-A Product feature CHAIN JQ707320_Pol_P-A of FT:mat_peptide JQ707320_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSKLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707321_Pol_P-A Product feature CHAIN JQ707321_Pol_P-A of FT:mat_peptide JQ707321_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707322_Pol_P-A Product feature CHAIN JQ707322_Pol_P-A of FT:mat_peptide JQ707322_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
GSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707323_Pol_P-A Product feature CHAIN JQ707323_Pol_P-A of FT:mat_peptide JQ707323_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWKTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHSVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707324_Pol_P-A Product feature CHAIN JQ707324_Pol_P-A of FT:mat_peptide JQ707324_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707325_Pol_P-A Product feature CHAIN JQ707325_Pol_P-A of FT:mat_peptide JQ707325_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVKPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707326_Pol_P-A Product feature CHAIN JQ707326_Pol_P-A of FT:mat_peptide JQ707326_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707327_Pol_P-A Product feature CHAIN JQ707327_Pol_P-A of FT:mat_peptide JQ707327_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQARLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707328_Pol_P-A Product feature CHAIN JQ707328_Pol_P-A of FT:mat_peptide JQ707328_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707329_Pol_P-A Product feature CHAIN JQ707329_Pol_P-A of FT:mat_peptide JQ707329_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQNFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLALGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPCHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707330_Pol_P-A Product feature CHAIN JQ707330_Pol_P-A of FT:mat_peptide JQ707330_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707331_Pol_P-A Product feature CHAIN JQ707331_Pol_P-A of FT:mat_peptide JQ707331_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
GSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707332_Pol_P-A Product feature CHAIN JQ707332_Pol_P-A of FT:mat_peptide JQ707332_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
GSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTRRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707333_Pol_P-A Product feature CHAIN JQ707333_Pol_P-A of FT:mat_peptide JQ707333_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVTRLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707334_Pol_P-A Product feature CHAIN JQ707334_Pol_P-A of FT:mat_peptide JQ707334_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707335_Pol_P-A Product feature CHAIN JQ707335_Pol_P-A of FT:mat_peptide JQ707335_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C44). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLDVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSHPSGILSRSSVGPCIRSQLRQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHTVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707336_Pol_P-A Product feature CHAIN JQ707336_Pol_P-A of FT:mat_peptide JQ707336_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
GSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707337_Pol_P-A Product feature CHAIN JQ707337_Pol_P-A of FT:mat_peptide JQ707337_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRRGDESFCPQPSGILSRSSVGPCIRRQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707338_Pol_P-A Product feature CHAIN JQ707338_Pol_P-A of FT:mat_peptide JQ707338_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707339_Pol_P-A Product feature CHAIN JQ707339_Pol_P-A of FT:mat_peptide JQ707339_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFVAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707340_Pol_P-A Product feature CHAIN JQ707340_Pol_P-A of FT:mat_peptide JQ707340_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C5). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPSTGRTSLYAVSPSVPSHLPVRVHFTSPLHVAWRPP
>gnl|hbvpro|JQ707341_Pol_P-A Product feature CHAIN JQ707341_Pol_P-A of FT:mat_peptide JQ707341_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707342_Pol_P-A Product feature CHAIN JQ707342_Pol_P-A of FT:mat_peptide JQ707342_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSQRQSSSGRAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HESCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707343_Pol_P-A Product feature CHAIN JQ707343_Pol_P-A of FT:mat_peptide JQ707343_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707344_Pol_P-A Product feature CHAIN JQ707344_Pol_P-A of FT:mat_peptide JQ707344_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707345_Pol_P-A Product feature CHAIN JQ707345_Pol_P-A of FT:mat_peptide JQ707345_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKVAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707346_Pol_P-A Product feature CHAIN JQ707346_Pol_P-A of FT:mat_peptide JQ707346_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707347_Pol_P-A Product feature CHAIN JQ707347_Pol_P-A of FT:mat_peptide JQ707347_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707348_Pol_P-A Product feature CHAIN JQ707348_Pol_P-A of FT:mat_peptide JQ707348_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKITHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707349_Pol_P-A Product feature CHAIN JQ707349_Pol_P-A of FT:mat_peptide JQ707349_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGNIRARVHPSTRRCFGVEPSGSRHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707350_Pol_P-A Product feature CHAIN JQ707350_Pol_P-A of FT:mat_peptide JQ707350_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYFHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707351_Pol_P-A Product feature CHAIN JQ707351_Pol_P-A of FT:mat_peptide JQ707351_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSEGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYAIGSWGTLPQDHIVQKITHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707352_Pol_P-A Product feature CHAIN JQ707352_Pol_P-A of FT:mat_peptide JQ707352_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLREDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVINHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707353_Pol_P-A Product feature CHAIN JQ707353_Pol_P-A of FT:mat_peptide JQ707353_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVINHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEYHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVSVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707354_Pol_P-A Product feature CHAIN JQ707354_Pol_P-A of FT:mat_peptide JQ707354_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVINTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707355_Pol_P-A Product feature CHAIN JQ707355_Pol_P-A of FT:mat_peptide JQ707355_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707356_Pol_P-A Product feature CHAIN JQ707356_Pol_P-A of FT:mat_peptide JQ707356_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707357_Pol_P-A Product feature CHAIN JQ707357_Pol_P-A of FT:mat_peptide JQ707357_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKITHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707358_Pol_P-A Product feature CHAIN JQ707358_Pol_P-A of FT:mat_peptide JQ707358_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLVSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707359_Pol_P-A Product feature CHAIN JQ707359_Pol_P-A of FT:mat_peptide JQ707359_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707360_Pol_P-A Product feature CHAIN JQ707360_Pol_P-A of FT:mat_peptide JQ707360_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKTGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707361_Pol_P-A Product feature CHAIN JQ707361_Pol_P-A of FT:mat_peptide JQ707361_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMYLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707362_Pol_P-A Product feature CHAIN JQ707362_Pol_P-A of FT:mat_peptide JQ707362_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVINTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707363_Pol_P-A Product feature CHAIN JQ707363_Pol_P-A of FT:mat_peptide JQ707363_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707364_Pol_P-A Product feature CHAIN JQ707364_Pol_P-A of FT:mat_peptide JQ707364_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVINTSQRHGDESFCSQPSGILSRPSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGNAVEFHCLPPSSAGSQSQG
SVSSCWRLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFADPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707365_Pol_P-A Product feature CHAIN JQ707365_Pol_P-A of FT:mat_peptide JQ707365_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707366_Pol_P-A Product feature CHAIN JQ707366_Pol_P-A of FT:mat_peptide JQ707366_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKTGILY
KRETTRSASFCGSPYSWEQELHHGRLVINTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707367_Pol_P-A Product feature CHAIN JQ707367_Pol_P-A of FT:mat_peptide JQ707367_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRSRVHPSTRRCFGVETSGSGHIEHSVNNYCSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707368_Pol_P-A Product feature CHAIN JQ707368_Pol_P-A of FT:mat_peptide JQ707368_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYFHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGVESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSPDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707369_Pol_P-A Product feature CHAIN JQ707369_Pol_P-A of FT:mat_peptide JQ707369_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVINHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707370_Pol_P-A Product feature CHAIN JQ707370_Pol_P-A of FT:mat_peptide JQ707370_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVINTSQRHGDESFCSQPSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPSSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGNMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707371_Pol_P-A Product feature CHAIN JQ707371_Pol_P-A of FT:mat_peptide JQ707371_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDYSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707372_Pol_P-A Product feature CHAIN JQ707372_Pol_P-A of FT:mat_peptide JQ707372_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
INRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINSNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLCSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707373_Pol_P-A Product feature CHAIN JQ707373_Pol_P-A of FT:mat_peptide JQ707373_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRHGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707374_Pol_P-A Product feature CHAIN JQ707374_Pol_P-A of FT:mat_peptide JQ707374_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDERGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVSVHFASPLHVAWRPP
>gnl|hbvpro|JQ707375_Pol_P-A Product feature CHAIN JQ707375_Pol_P-A of FT:mat_peptide JQ707375_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707376_Pol_P-A Product feature CHAIN JQ707376_Pol_P-A of FT:mat_peptide JQ707376_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707377_Pol_P-A Product feature CHAIN JQ707377_Pol_P-A of FT:mat_peptide JQ707377_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707378_Pol_P-A Product feature CHAIN JQ707378_Pol_P-A of FT:mat_peptide JQ707378_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESLCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTLSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707379_Pol_P-A Product feature CHAIN JQ707379_Pol_P-A of FT:mat_peptide JQ707379_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707380_Pol_P-A Product feature CHAIN JQ707380_Pol_P-A of FT:mat_peptide JQ707380_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPGIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707381_Pol_P-A Product feature CHAIN JQ707381_Pol_P-A of FT:mat_peptide JQ707381_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707382_Pol_P-A Product feature CHAIN JQ707382_Pol_P-A of FT:mat_peptide JQ707382_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707383_Pol_P-A Product feature CHAIN JQ707383_Pol_P-A of FT:mat_peptide JQ707383_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTEPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707384_Pol_P-A Product feature CHAIN JQ707384_Pol_P-A of FT:mat_peptide JQ707384_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707385_Pol_P-A Product feature CHAIN JQ707385_Pol_P-A of FT:mat_peptide JQ707385_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707386_Pol_P-A Product feature CHAIN JQ707386_Pol_P-A of FT:mat_peptide JQ707386_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQRPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGI
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707387_Pol_P-A Product feature CHAIN JQ707387_Pol_P-A of FT:mat_peptide JQ707387_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPYNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707388_Pol_P-A Product feature CHAIN JQ707388_Pol_P-A of FT:mat_peptide JQ707388_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVERHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707389_Pol_P-A Product feature CHAIN JQ707389_Pol_P-A of FT:mat_peptide JQ707389_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707390_Pol_P-A Product feature CHAIN JQ707390_Pol_P-A of FT:mat_peptide JQ707390_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707391_Pol_P-A Product feature CHAIN JQ707391_Pol_P-A of FT:mat_peptide JQ707391_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSKSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707392_Pol_P-A Product feature CHAIN JQ707392_Pol_P-A of FT:mat_peptide JQ707392_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707393_Pol_P-A Product feature CHAIN JQ707393_Pol_P-A of FT:mat_peptide JQ707393_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707394_Pol_P-A Product feature CHAIN JQ707394_Pol_P-A of FT:mat_peptide JQ707394_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNERRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707395_Pol_P-A Product feature CHAIN JQ707395_Pol_P-A of FT:mat_peptide JQ707395_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTAAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPD
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPILLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707396_Pol_P-A Product feature CHAIN JQ707396_Pol_P-A of FT:mat_peptide JQ707396_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707397_Pol_P-A Product feature CHAIN JQ707397_Pol_P-A of FT:mat_peptide JQ707397_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSPDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707398_Pol_P-A Product feature CHAIN JQ707398_Pol_P-A of FT:mat_peptide JQ707398_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNM
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLTPNKTKRWGYSLKFMGYIIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGLGAPFSQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707399_Pol_P-A Product feature CHAIN JQ707399_Pol_P-A of FT:mat_peptide JQ707399_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHADESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707400_Pol_P-A Product feature CHAIN JQ707400_Pol_P-A of FT:mat_peptide JQ707400_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKICQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707401_Pol_P-A Product feature CHAIN JQ707401_Pol_P-A of FT:mat_peptide JQ707401_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVINHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVNFSQFSRE
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVSLSPFLMAQFTSAIYSVVRRAFPHCLAFSYVNDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIKSWGTLPQNHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFATPFTQCGYPALMPLYAYIQAKQTFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIRTDNSVILSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGHTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707402_Pol_P-A Product feature CHAIN JQ707402_Pol_P-A of FT:mat_peptide JQ707402_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707403_Pol_P-A Product feature CHAIN JQ707403_Pol_P-A of FT:mat_peptide JQ707403_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707404_Pol_P-A Product feature CHAIN JQ707404_Pol_P-A of FT:mat_peptide JQ707404_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707405_Pol_P-A Product feature CHAIN JQ707405_Pol_P-A of FT:mat_peptide JQ707405_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707406_Pol_P-A Product feature CHAIN JQ707406_Pol_P-A of FT:mat_peptide JQ707406_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPCSSGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707407_Pol_P-A Product feature CHAIN JQ707407_Pol_P-A of FT:mat_peptide JQ707407_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707408_Pol_P-A Product feature CHAIN JQ707408_Pol_P-A of FT:mat_peptide JQ707408_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707409_Pol_P-A Product feature CHAIN JQ707409_Pol_P-A of FT:mat_peptide JQ707409_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707410_Pol_P-A Product feature CHAIN JQ707410_Pol_P-A of FT:mat_peptide JQ707410_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKINNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707411_Pol_P-A Product feature CHAIN JQ707411_Pol_P-A of FT:mat_peptide JQ707411_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKPSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707412_Pol_P-A Product feature CHAIN JQ707412_Pol_P-A of FT:mat_peptide JQ707412_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707413_Pol_P-A Product feature CHAIN JQ707413_Pol_P-A of FT:mat_peptide JQ707413_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707414_Pol_P-A Product feature CHAIN JQ707414_Pol_P-A of FT:mat_peptide JQ707414_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKPSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707415_Pol_P-A Product feature CHAIN JQ707415_Pol_P-A of FT:mat_peptide JQ707415_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYLDQLVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707416_Pol_P-A Product feature CHAIN JQ707416_Pol_P-A of FT:mat_peptide JQ707416_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707417_Pol_P-A Product feature CHAIN JQ707417_Pol_P-A of FT:mat_peptide JQ707417_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SIFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707418_Pol_P-A Product feature CHAIN JQ707418_Pol_P-A of FT:mat_peptide JQ707418_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAVCFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707419_Pol_P-A Product feature CHAIN JQ707419_Pol_P-A of FT:mat_peptide JQ707419_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSDHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707420_Pol_P-A Product feature CHAIN JQ707420_Pol_P-A of FT:mat_peptide JQ707420_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKNCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707531_Pol_P-A Product feature CHAIN JQ707531_Pol_P-A of FT:mat_peptide JQ707531_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707532_Pol_P-A Product feature CHAIN JQ707532_Pol_P-A of FT:mat_peptide JQ707532_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIKNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707533_Pol_P-A Product feature CHAIN JQ707533_Pol_P-A of FT:mat_peptide JQ707533_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQLTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707534_Pol_P-A Product feature CHAIN JQ707534_Pol_P-A of FT:mat_peptide JQ707534_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707535_Pol_P-A Product feature CHAIN JQ707535_Pol_P-A of FT:mat_peptide JQ707535_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707536_Pol_P-A Product feature CHAIN JQ707536_Pol_P-A of FT:mat_peptide JQ707536_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIKNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707537_Pol_P-A Product feature CHAIN JQ707537_Pol_P-A of FT:mat_peptide JQ707537_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARVSSTSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707538_Pol_P-A Product feature CHAIN JQ707538_Pol_P-A of FT:mat_peptide JQ707538_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGIPSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707539_Pol_P-A Product feature CHAIN JQ707539_Pol_P-A of FT:mat_peptide JQ707539_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707540_Pol_P-A Product feature CHAIN JQ707540_Pol_P-A of FT:mat_peptide JQ707540_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707541_Pol_P-A Product feature CHAIN JQ707541_Pol_P-A of FT:mat_peptide JQ707541_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707542_Pol_P-A Product feature CHAIN JQ707542_Pol_P-A of FT:mat_peptide JQ707542_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707543_Pol_P-A Product feature CHAIN JQ707543_Pol_P-A of FT:mat_peptide JQ707543_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707544_Pol_P-A Product feature CHAIN JQ707544_Pol_P-A of FT:mat_peptide JQ707544_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707545_Pol_P-A Product feature CHAIN JQ707545_Pol_P-A of FT:mat_peptide JQ707545_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707546_Pol_P-A Product feature CHAIN JQ707546_Pol_P-A of FT:mat_peptide JQ707546_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707547_Pol_P-A Product feature CHAIN JQ707547_Pol_P-A of FT:mat_peptide JQ707547_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSCNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707548_Pol_P-A Product feature CHAIN JQ707548_Pol_P-A of FT:mat_peptide JQ707548_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707549_Pol_P-A Product feature CHAIN JQ707549_Pol_P-A of FT:mat_peptide JQ707549_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707550_Pol_P-A Product feature CHAIN JQ707550_Pol_P-A of FT:mat_peptide JQ707550_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGIEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707551_Pol_P-A Product feature CHAIN JQ707551_Pol_P-A of FT:mat_peptide JQ707551_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707552_Pol_P-A Product feature CHAIN JQ707552_Pol_P-A of FT:mat_peptide JQ707552_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707553_Pol_P-A Product feature CHAIN JQ707553_Pol_P-A of FT:mat_peptide JQ707553_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707554_Pol_P-A Product feature CHAIN JQ707554_Pol_P-A of FT:mat_peptide JQ707554_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707555_Pol_P-A Product feature CHAIN JQ707555_Pol_P-A of FT:mat_peptide JQ707555_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707556_Pol_P-A Product feature CHAIN JQ707556_Pol_P-A of FT:mat_peptide JQ707556_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707557_Pol_P-A Product feature CHAIN JQ707557_Pol_P-A of FT:mat_peptide JQ707557_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707558_Pol_P-A Product feature CHAIN JQ707558_Pol_P-A of FT:mat_peptide JQ707558_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707559_Pol_P-A Product feature CHAIN JQ707559_Pol_P-A of FT:mat_peptide JQ707559_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707560_Pol_P-A Product feature CHAIN JQ707560_Pol_P-A of FT:mat_peptide JQ707560_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707561_Pol_P-A Product feature CHAIN JQ707561_Pol_P-A of FT:mat_peptide JQ707561_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILHGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707562_Pol_P-A Product feature CHAIN JQ707562_Pol_P-A of FT:mat_peptide JQ707562_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707563_Pol_P-A Product feature CHAIN JQ707563_Pol_P-A of FT:mat_peptide JQ707563_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
INRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707564_Pol_P-A Product feature CHAIN JQ707564_Pol_P-A of FT:mat_peptide JQ707564_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707565_Pol_P-A Product feature CHAIN JQ707565_Pol_P-A of FT:mat_peptide JQ707565_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHILWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707566_Pol_P-A Product feature CHAIN JQ707566_Pol_P-A of FT:mat_peptide JQ707566_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707567_Pol_P-A Product feature CHAIN JQ707567_Pol_P-A of FT:mat_peptide JQ707567_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707568_Pol_P-A Product feature CHAIN JQ707568_Pol_P-A of FT:mat_peptide JQ707568_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707569_Pol_P-A Product feature CHAIN JQ707569_Pol_P-A of FT:mat_peptide JQ707569_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707570_Pol_P-A Product feature CHAIN JQ707570_Pol_P-A of FT:mat_peptide JQ707570_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707571_Pol_P-A Product feature CHAIN JQ707571_Pol_P-A of FT:mat_peptide JQ707571_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707572_Pol_P-A Product feature CHAIN JQ707572_Pol_P-A of FT:mat_peptide JQ707572_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707573_Pol_P-A Product feature CHAIN JQ707573_Pol_P-A of FT:mat_peptide JQ707573_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707574_Pol_P-A Product feature CHAIN JQ707574_Pol_P-A of FT:mat_peptide JQ707574_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707575_Pol_P-A Product feature CHAIN JQ707575_Pol_P-A of FT:mat_peptide JQ707575_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYTHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707576_Pol_P-A Product feature CHAIN JQ707576_Pol_P-A of FT:mat_peptide JQ707576_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SEFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707577_Pol_P-A Product feature CHAIN JQ707577_Pol_P-A of FT:mat_peptide JQ707577_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707578_Pol_P-A Product feature CHAIN JQ707578_Pol_P-A of FT:mat_peptide JQ707578_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYTHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDTVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707579_Pol_P-A Product feature CHAIN JQ707579_Pol_P-A of FT:mat_peptide JQ707579_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707580_Pol_P-A Product feature CHAIN JQ707580_Pol_P-A of FT:mat_peptide JQ707580_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGRIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHREALYTAVTNFLWSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707581_Pol_P-A Product feature CHAIN JQ707581_Pol_P-A of FT:mat_peptide JQ707581_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYRTYGWKLHLYTHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707582_Pol_P-A Product feature CHAIN JQ707582_Pol_P-A of FT:mat_peptide JQ707582_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707583_Pol_P-A Product feature CHAIN JQ707583_Pol_P-A of FT:mat_peptide JQ707583_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYTHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707584_Pol_P-A Product feature CHAIN JQ707584_Pol_P-A of FT:mat_peptide JQ707584_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707585_Pol_P-A Product feature CHAIN JQ707585_Pol_P-A of FT:mat_peptide JQ707585_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAVCFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707586_Pol_P-A Product feature CHAIN JQ707586_Pol_P-A of FT:mat_peptide JQ707586_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707587_Pol_P-A Product feature CHAIN JQ707587_Pol_P-A of FT:mat_peptide JQ707587_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHREALYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707588_Pol_P-A Product feature CHAIN JQ707588_Pol_P-A of FT:mat_peptide JQ707588_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707589_Pol_P-A Product feature CHAIN JQ707589_Pol_P-A of FT:mat_peptide JQ707589_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLRLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707590_Pol_P-A Product feature CHAIN JQ707590_Pol_P-A of FT:mat_peptide JQ707590_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707591_Pol_P-A Product feature CHAIN JQ707591_Pol_P-A of FT:mat_peptide JQ707591_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707592_Pol_P-A Product feature CHAIN JQ707592_Pol_P-A of FT:mat_peptide JQ707592_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707593_Pol_P-A Product feature CHAIN JQ707593_Pol_P-A of FT:mat_peptide JQ707593_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707594_Pol_P-A Product feature CHAIN JQ707594_Pol_P-A of FT:mat_peptide JQ707594_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707595_Pol_P-A Product feature CHAIN JQ707595_Pol_P-A of FT:mat_peptide JQ707595_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSIRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SEFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707596_Pol_P-A Product feature CHAIN JQ707596_Pol_P-A of FT:mat_peptide JQ707596_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707597_Pol_P-A Product feature CHAIN JQ707597_Pol_P-A of FT:mat_peptide JQ707597_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCFQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARHRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707598_Pol_P-A Product feature CHAIN JQ707598_Pol_P-A of FT:mat_peptide JQ707598_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707599_Pol_P-A Product feature CHAIN JQ707599_Pol_P-A of FT:mat_peptide JQ707599_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRHFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707600_Pol_P-A Product feature CHAIN JQ707600_Pol_P-A of FT:mat_peptide JQ707600_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVIRRAFPHCLAFSYVDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707601_Pol_P-A Product feature CHAIN JQ707601_Pol_P-A of FT:mat_peptide JQ707601_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707602_Pol_P-A Product feature CHAIN JQ707602_Pol_P-A of FT:mat_peptide JQ707602_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPINRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707603_Pol_P-A Product feature CHAIN JQ707603_Pol_P-A of FT:mat_peptide JQ707603_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYTHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRTYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707604_Pol_P-A Product feature CHAIN JQ707604_Pol_P-A of FT:mat_peptide JQ707604_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYTHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707605_Pol_P-A Product feature CHAIN JQ707605_Pol_P-A of FT:mat_peptide JQ707605_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREVWGPCDEHGEHHIRRPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707606_Pol_P-A Product feature CHAIN JQ707606_Pol_P-A of FT:mat_peptide JQ707606_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYTHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707607_Pol_P-A Product feature CHAIN JQ707607_Pol_P-A of FT:mat_peptide JQ707607_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
TTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDIVLGAK
SVQHREALYTPVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707608_Pol_P-A Product feature CHAIN JQ707608_Pol_P-A of FT:mat_peptide JQ707608_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707609_Pol_P-A Product feature CHAIN JQ707609_Pol_P-A of FT:mat_peptide JQ707609_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLAIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707610_Pol_P-A Product feature CHAIN JQ707610_Pol_P-A of FT:mat_peptide JQ707610_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPAQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707611_Pol_P-A Product feature CHAIN JQ707611_Pol_P-A of FT:mat_peptide JQ707611_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707612_Pol_P-A Product feature CHAIN JQ707612_Pol_P-A of FT:mat_peptide JQ707612_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707613_Pol_P-A Product feature CHAIN JQ707613_Pol_P-A of FT:mat_peptide JQ707613_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707614_Pol_P-A Product feature CHAIN JQ707614_Pol_P-A of FT:mat_peptide JQ707614_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIGIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707615_Pol_P-A Product feature CHAIN JQ707615_Pol_P-A of FT:mat_peptide JQ707615_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSMASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707616_Pol_P-A Product feature CHAIN JQ707616_Pol_P-A of FT:mat_peptide JQ707616_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
INRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGGWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707617_Pol_P-A Product feature CHAIN JQ707617_Pol_P-A of FT:mat_peptide JQ707617_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFATPLHVAWRPP
>gnl|hbvpro|JQ707618_Pol_P-A Product feature CHAIN JQ707618_Pol_P-A of FT:mat_peptide JQ707618_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707619_Pol_P-A Product feature CHAIN JQ707619_Pol_P-A of FT:mat_peptide JQ707619_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707620_Pol_P-A Product feature CHAIN JQ707620_Pol_P-A of FT:mat_peptide JQ707620_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707621_Pol_P-A Product feature CHAIN JQ707621_Pol_P-A of FT:mat_peptide JQ707621_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707622_Pol_P-A Product feature CHAIN JQ707622_Pol_P-A of FT:mat_peptide JQ707622_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707623_Pol_P-A Product feature CHAIN JQ707623_Pol_P-A of FT:mat_peptide JQ707623_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707624_Pol_P-A Product feature CHAIN JQ707624_Pol_P-A of FT:mat_peptide JQ707624_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707625_Pol_P-A Product feature CHAIN JQ707625_Pol_P-A of FT:mat_peptide JQ707625_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPQQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707626_Pol_P-A Product feature CHAIN JQ707626_Pol_P-A of FT:mat_peptide JQ707626_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707627_Pol_P-A Product feature CHAIN JQ707627_Pol_P-A of FT:mat_peptide JQ707627_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707628_Pol_P-A Product feature CHAIN JQ707628_Pol_P-A of FT:mat_peptide JQ707628_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707629_Pol_P-A Product feature CHAIN JQ707629_Pol_P-A of FT:mat_peptide JQ707629_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTTKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707630_Pol_P-A Product feature CHAIN JQ707630_Pol_P-A of FT:mat_peptide JQ707630_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQTSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707631_Pol_P-A Product feature CHAIN JQ707631_Pol_P-A of FT:mat_peptide JQ707631_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707632_Pol_P-A Product feature CHAIN JQ707632_Pol_P-A of FT:mat_peptide JQ707632_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707633_Pol_P-A Product feature CHAIN JQ707633_Pol_P-A of FT:mat_peptide JQ707633_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQLVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707634_Pol_P-A Product feature CHAIN JQ707634_Pol_P-A of FT:mat_peptide JQ707634_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSGLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTSGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFLPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707635_Pol_P-A Product feature CHAIN JQ707635_Pol_P-A of FT:mat_peptide JQ707635_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRHADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRFIIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKWHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707636_Pol_P-A Product feature CHAIN JQ707636_Pol_P-A of FT:mat_peptide JQ707636_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707637_Pol_P-A Product feature CHAIN JQ707637_Pol_P-A of FT:mat_peptide JQ707637_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707638_Pol_P-A Product feature CHAIN JQ707638_Pol_P-A of FT:mat_peptide JQ707638_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGVQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707639_Pol_P-A Product feature CHAIN JQ707639_Pol_P-A of FT:mat_peptide JQ707639_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707640_Pol_P-A Product feature CHAIN JQ707640_Pol_P-A of FT:mat_peptide JQ707640_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707641_Pol_P-A Product feature CHAIN JQ707641_Pol_P-A of FT:mat_peptide JQ707641_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707642_Pol_P-A Product feature CHAIN JQ707642_Pol_P-A of FT:mat_peptide JQ707642_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707643_Pol_P-A Product feature CHAIN JQ707643_Pol_P-A of FT:mat_peptide JQ707643_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707644_Pol_P-A Product feature CHAIN JQ707644_Pol_P-A of FT:mat_peptide JQ707644_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707645_Pol_P-A Product feature CHAIN JQ707645_Pol_P-A of FT:mat_peptide JQ707645_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKVGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707646_Pol_P-A Product feature CHAIN JQ707646_Pol_P-A of FT:mat_peptide JQ707646_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707647_Pol_P-A Product feature CHAIN JQ707647_Pol_P-A of FT:mat_peptide JQ707647_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYFARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707648_Pol_P-A Product feature CHAIN JQ707648_Pol_P-A of FT:mat_peptide JQ707648_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707649_Pol_P-A Product feature CHAIN JQ707649_Pol_P-A of FT:mat_peptide JQ707649_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRQGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707650_Pol_P-A Product feature CHAIN JQ707650_Pol_P-A of FT:mat_peptide JQ707650_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707651_Pol_P-A Product feature CHAIN JQ707651_Pol_P-A of FT:mat_peptide JQ707651_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SIQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707652_Pol_P-A Product feature CHAIN JQ707652_Pol_P-A of FT:mat_peptide JQ707652_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQSG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVLADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707653_Pol_P-A Product feature CHAIN JQ707653_Pol_P-A of FT:mat_peptide JQ707653_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTSGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707654_Pol_P-A Product feature CHAIN JQ707654_Pol_P-A of FT:mat_peptide JQ707654_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQLVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707655_Pol_P-A Product feature CHAIN JQ707655_Pol_P-A of FT:mat_peptide JQ707655_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707656_Pol_P-A Product feature CHAIN JQ707656_Pol_P-A of FT:mat_peptide JQ707656_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707658_Pol_P-A Product feature CHAIN JQ707658_Pol_P-A of FT:mat_peptide JQ707658_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707659_Pol_P-A Product feature CHAIN JQ707659_Pol_P-A of FT:mat_peptide JQ707659_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707661_Pol_P-A Product feature CHAIN JQ707661_Pol_P-A of FT:mat_peptide JQ707661_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGRQRMRGT
FVAPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707662_Pol_P-A Product feature CHAIN JQ707662_Pol_P-A of FT:mat_peptide JQ707662_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707663_Pol_P-A Product feature CHAIN JQ707663_Pol_P-A of FT:mat_peptide JQ707663_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707664_Pol_P-A Product feature CHAIN JQ707664_Pol_P-A of FT:mat_peptide JQ707664_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILPRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707665_Pol_P-A Product feature CHAIN JQ707665_Pol_P-A of FT:mat_peptide JQ707665_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707667_Pol_P-A Product feature CHAIN JQ707667_Pol_P-A of FT:mat_peptide JQ707667_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707669_Pol_P-A Product feature CHAIN JQ707669_Pol_P-A of FT:mat_peptide JQ707669_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707670_Pol_P-A Product feature CHAIN JQ707670_Pol_P-A of FT:mat_peptide JQ707670_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707672_Pol_P-A Product feature CHAIN JQ707672_Pol_P-A of FT:mat_peptide JQ707672_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707674_Pol_P-A Product feature CHAIN JQ707674_Pol_P-A of FT:mat_peptide JQ707674_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGMGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707675_Pol_P-A Product feature CHAIN JQ707675_Pol_P-A of FT:mat_peptide JQ707675_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707676_Pol_P-A Product feature CHAIN JQ707676_Pol_P-A of FT:mat_peptide JQ707676_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707681_Pol_P-A Product feature CHAIN JQ707681_Pol_P-A of FT:mat_peptide JQ707681_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JX096952_Pol_P-A Product feature CHAIN JX096952_Pol_P-A of FT:mat_peptide JX096952_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHHSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
TVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGMGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JX096953_Pol_P-A Product feature CHAIN JX096953_Pol_P-A of FT:mat_peptide JX096953_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPDLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JX154579_Pol_P-A Product feature CHAIN JX154579_Pol_P-A of FT:mat_peptide JX154579_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIWPRVHSPTRRCFGVEPSGSGHIGYSASSSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PEFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSKYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JX154580_Pol_P-A Product feature CHAIN JX154580_Pol_P-A of FT:mat_peptide JX154580_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIWPRVHSPTRRCFGVEPSGSGHIGYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSKYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JX154581_Pol_P-A Product feature CHAIN JX154581_Pol_P-A of FT:mat_peptide JX154581_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIWPRVHSPTRRCFGVEPSGSGHIGYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSKYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JX154582_Pol_P-A Product feature CHAIN JX154582_Pol_P-A of FT:mat_peptide JX154582_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIWPRVHSPTRRCFGVEPSGSGHIGYSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSQG
PVFSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
LTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSKYVARLSSNSRIHNNQYGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPNGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|JX310721_Pol_P-A Product feature CHAIN JX310721_Pol_P-A of FT:mat_peptide JX310721_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLH
>gnl|hbvpro|JX310722_Pol_P-A Product feature CHAIN JX310722_Pol_P-A of FT:mat_peptide JX310722_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSVICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JX310723_Pol_P-A Product feature CHAIN JX310723_Pol_P-A of FT:mat_peptide JX310723_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHISTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KC875251_Pol_P-A Product feature CHAIN KC875251_Pol_P-A of FT:mat_peptide KC875251_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVFHSFPPSSARSQSQGP
VSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFVGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRPGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KC875252_Pol_P-A Product feature CHAIN KC875252_Pol_P-A of FT:mat_peptide KC875252_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSANSASSCLHQSAVRKAANSHLSTSKRQSSSAHAVLHSFPPSSARSQSQGP
VSSCWWLQFRNTQPCSQYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPTILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKPFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|KC875253_Pol_P-A Product feature CHAIN KC875253_Pol_P-A of FT:mat_peptide KC875253_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSTGHAVLHSFPPSSARSQSQGP
VSSCWWLQFRDTQPCSQYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTARTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KC875255_Pol_P-A Product feature CHAIN KC875255_Pol_P-A of FT:mat_peptide KC875255_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVLHSLPPSSARSQSQGP
VSSCWWLQFRNSQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYTVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KC875256_Pol_P-A Product feature CHAIN KC875256_Pol_P-A of FT:mat_peptide KC875256_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSPLSTSKRQSSSGHAVFHSFPPSSARSQSQGP
VSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYTVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KC875257_Pol_P-A Product feature CHAIN KC875257_Pol_P-A of FT:mat_peptide KC875257_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV14). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQRHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGTGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVFHSFPPSSARSQSQGP
VSSCWWLQFRNTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQRIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPPDDPSRGRLGLYR
PLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KC875258_Pol_P-A Product feature CHAIN KC875258_Pol_P-A of FT:mat_peptide KC875258_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV66). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKEAYSHLSTSKRQSSSGHAVFHSFPPSSARSQSQGP
VSSCWWLQFRHTQPCSKYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYDSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
SAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KC875259_Pol_P-A Product feature CHAIN KC875259_Pol_P-A of FT:mat_peptide KC875259_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Non-functional genomic sequence. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLVLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLTTSQPG
RSGSTRARVHSPTRRCFGVGPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVLHSFPPSSARSQSQGP
VSSCWWLQFRDSQPCSQYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGI
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIHNNQHGTLQNLH
DSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQTIKHCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQAKQAFTFSPPYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF214657_Pol_P-A Product feature CHAIN KF214657_Pol_P-A of FT:mat_peptide KF214657_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=839 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHQTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPQQGPLATSKSGRSGSIR
ARVHSPTRRCFGVEPSGSGHINHSASSASFCLHQSAVRKAAYSHRSTSKRQSSSGHAVEFHSFPPNSARSQSQGPVSSCW
WLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGITRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNLHDSCSR
QLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHRLAFSYMDDVVLGAKSVQHLE
SLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRL
PYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF214659_Pol_P-A Product feature CHAIN KF214659_Pol_P-A of FT:mat_peptide KF214659_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSKPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHRFPPNSARSQSQG
PVFSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRFVARLSSNSRINNNQHGTLQNL
HDSCSRKLYVSLLLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSPGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF214660_Pol_P-A Product feature CHAIN KF214660_Pol_P-A of FT:mat_peptide KF214660_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGSLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIDHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHTVEFHSFPPSSARSQSQG
PVSSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF214661_Pol_P-A Product feature CHAIN KF214661_Pol_P-A of FT:mat_peptide KF214661_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPAGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAISASSCLLQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFPCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGLAAPFTQCGYPALMPLYACIQAKQAFTSSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLF
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF214662_Pol_P-A Product feature CHAIN KF214662_Pol_P-A of FT:mat_peptide KF214662_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPILNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRGLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIQTSQRHGDEPFCSQSAGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSAISASSCLHQSAVRKAAYSHLSTSKRQSSSGRAVEFHSFPPNSARSQSQG
PVSSCWWLQFRNTQPCSNYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRHLYVSLLLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKFPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYAYIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|KF214663_Pol_P-A Product feature CHAIN KF214663_Pol_P-A of FT:mat_peptide KF214663_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANKCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSPVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPSSARSQSQG
PVFSCWWLQFRNSEPCSNYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|KF214665_Pol_P-A Product feature CHAIN KF214665_Pol_P-A of FT:mat_peptide KF214665_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDEPFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHVGSSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFPSFPPSSARSQSQG
PVCSCWWLQFKNTQPCSNYCLSHLVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF214666_Pol_P-A Product feature CHAIN KF214666_Pol_P-A of FT:mat_peptide KF214666_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEVGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
KIHLHEDIVNRCQQFVGPLTANEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQELHHGRLDIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQFKQSRLGLQPHQRPLATSQPGRS
GSIRARVHSPTRRCFGVEPSGSGHIGHSASSASSCLHQSAVRTTAYSHLSTSKRQSSSGHAVEFHSFPSSSARSQSQGPV
FSCWWLQFRNTQPCSNYCLSHLVNLLEDWGPCAEHGEHHIGIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGIN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQHGTLQNLHD
SCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779210_Pol_P-A Product feature CHAIN KF779210_Pol_P-A of FT:mat_peptide KF779210_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5547). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRSLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPTSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779211_Pol_P-A Product feature CHAIN KF779211_Pol_P-A of FT:mat_peptide KF779211_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5691). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQARHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPTSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779213_Pol_P-A Product feature CHAIN KF779213_Pol_P-A of FT:mat_peptide KF779213_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5744). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLNVSIPWTHKVGNVTGLYSSTVPIFNPEWKTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRASPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAKLLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779215_Pol_P-A Product feature CHAIN KF779215_Pol_P-A of FT:mat_peptide KF779215_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLNVSIPWTHKVGNVTGLYSSTVPIFNPEWKTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRASPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|KF779221_Pol_P-A Product feature CHAIN KF779221_Pol_P-A of FT:mat_peptide KF779221_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5934). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADSDRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSALGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779227_Pol_P-A Product feature CHAIN KF779227_Pol_P-A of FT:mat_peptide KF779227_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779231_Pol_P-A Product feature CHAIN KF779231_Pol_P-A of FT:mat_peptide KF779231_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
STRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYASLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779232_Pol_P-A Product feature CHAIN KF779232_Pol_P-A of FT:mat_peptide KF779232_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPRIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHNVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLLLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779234_Pol_P-A Product feature CHAIN KF779234_Pol_P-A of FT:mat_peptide KF779234_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHVDHSVNNSSSCLRQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSARSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779238_Pol_P-A Product feature CHAIN KF779238_Pol_P-A of FT:mat_peptide KF779238_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAHSHLSTSKRQSSSGHAVEFHCLPPSSEGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779239_Pol_P-A Product feature CHAIN KF779239_Pol_P-A of FT:mat_peptide KF779239_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6120). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIHRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779240_Pol_P-A Product feature CHAIN KF779240_Pol_P-A of FT:mat_peptide KF779240_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLREDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
VTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779243_Pol_P-A Product feature CHAIN KF779243_Pol_P-A of FT:mat_peptide KF779243_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCHQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779244_Pol_P-A Product feature CHAIN KF779244_Pol_P-A of FT:mat_peptide KF779244_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779245_Pol_P-A Product feature CHAIN KF779245_Pol_P-A of FT:mat_peptide KF779245_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779246_Pol_P-A Product feature CHAIN KF779246_Pol_P-A of FT:mat_peptide KF779246_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6163). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSEGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779247_Pol_P-A Product feature CHAIN KF779247_Pol_P-A of FT:mat_peptide KF779247_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSEGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779248_Pol_P-A Product feature CHAIN KF779248_Pol_P-A of FT:mat_peptide KF779248_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSEGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779249_Pol_P-A Product feature CHAIN KF779249_Pol_P-A of FT:mat_peptide KF779249_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779251_Pol_P-A Product feature CHAIN KF779251_Pol_P-A of FT:mat_peptide KF779251_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779252_Pol_P-A Product feature CHAIN KF779252_Pol_P-A of FT:mat_peptide KF779252_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQASRR
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779253_Pol_P-A Product feature CHAIN KF779253_Pol_P-A of FT:mat_peptide KF779253_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3817). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779254_Pol_P-A Product feature CHAIN KF779254_Pol_P-A of FT:mat_peptide KF779254_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3820). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSNQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPPTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779255_Pol_P-A Product feature CHAIN KF779255_Pol_P-A of FT:mat_peptide KF779255_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3825). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPRIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRTSVGPCIWSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLHEDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779256_Pol_P-A Product feature CHAIN KF779256_Pol_P-A of FT:mat_peptide KF779256_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3829). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHSAELLAACFARSRSGAKLIPTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779257_Pol_P-A Product feature CHAIN KF779257_Pol_P-A of FT:mat_peptide KF779257_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3857). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRASPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779258_Pol_P-A Product feature CHAIN KF779258_Pol_P-A of FT:mat_peptide KF779258_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779259_Pol_P-A Product feature CHAIN KF779259_Pol_P-A of FT:mat_peptide KF779259_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPRIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779261_Pol_P-A Product feature CHAIN KF779261_Pol_P-A of FT:mat_peptide KF779261_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3896). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTANEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYQTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYTDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTSNWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779262_Pol_P-A Product feature CHAIN KF779262_Pol_P-A of FT:mat_peptide KF779262_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3898). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVREAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCISHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779263_Pol_P-A Product feature CHAIN KF779263_Pol_P-A of FT:mat_peptide KF779263_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3903). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTANEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQPSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPQCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779264_Pol_P-A Product feature CHAIN KF779264_Pol_P-A of FT:mat_peptide KF779264_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3945). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLELQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHYIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779265_Pol_P-A Product feature CHAIN KF779265_Pol_P-A of FT:mat_peptide KF779265_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3946). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAYLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDGVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779266_Pol_P-A Product feature CHAIN KF779266_Pol_P-A of FT:mat_peptide KF779266_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3949). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCFHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779268_Pol_P-A Product feature CHAIN KF779268_Pol_P-A of FT:mat_peptide KF779268_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3966). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADASLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDGVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779269_Pol_P-A Product feature CHAIN KF779269_Pol_P-A of FT:mat_peptide KF779269_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779271_Pol_P-A Product feature CHAIN KF779271_Pol_P-A of FT:mat_peptide KF779271_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779272_Pol_P-A Product feature CHAIN KF779272_Pol_P-A of FT:mat_peptide KF779272_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPLLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779273_Pol_P-A Product feature CHAIN KF779273_Pol_P-A of FT:mat_peptide KF779273_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFAPSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSPGRLGLS
PPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779274_Pol_P-A Product feature CHAIN KF779274_Pol_P-A of FT:mat_peptide KF779274_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779275_Pol_P-A Product feature CHAIN KF779275_Pol_P-A of FT:mat_peptide KF779275_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779276_Pol_P-A Product feature CHAIN KF779276_Pol_P-A of FT:mat_peptide KF779276_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779277_Pol_P-A Product feature CHAIN KF779277_Pol_P-A of FT:mat_peptide KF779277_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779279_Pol_P-A Product feature CHAIN KF779279_Pol_P-A of FT:mat_peptide KF779279_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779280_Pol_P-A Product feature CHAIN KF779280_Pol_P-A of FT:mat_peptide KF779280_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4364). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPLLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779281_Pol_P-A Product feature CHAIN KF779281_Pol_P-A of FT:mat_peptide KF779281_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4390). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779282_Pol_P-A Product feature CHAIN KF779282_Pol_P-A of FT:mat_peptide KF779282_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFGSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCEEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779283_Pol_P-A Product feature CHAIN KF779283_Pol_P-A of FT:mat_peptide KF779283_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIWARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFKNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779284_Pol_P-A Product feature CHAIN KF779284_Pol_P-A of FT:mat_peptide KF779284_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAVSHINRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQPSRG
MTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779286_Pol_P-A Product feature CHAIN KF779286_Pol_P-A of FT:mat_peptide KF779286_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0606). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFTCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSLLPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779287_Pol_P-A Product feature CHAIN KF779287_Pol_P-A of FT:mat_peptide KF779287_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0613). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGSLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFTCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSLLPHCLAFSYMDDGVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779290_Pol_P-A Product feature CHAIN KF779290_Pol_P-A of FT:mat_peptide KF779290_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSLLPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779291_Pol_P-A Product feature CHAIN KF779291_Pol_P-A of FT:mat_peptide KF779291_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0765). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSLLPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779293_Pol_P-A Product feature CHAIN KF779293_Pol_P-A of FT:mat_peptide KF779293_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSIGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSERQSSSGHAVELHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRNLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRMHFASPLHVAWRPP
>gnl|hbvpro|KF779294_Pol_P-A Product feature CHAIN KF779294_Pol_P-A of FT:mat_peptide KF779294_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0796). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSLLPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779295_Pol_P-A Product feature CHAIN KF779295_Pol_P-A of FT:mat_peptide KF779295_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIETSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARFHPSTRRSFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSERQSSSGHAVEFHCLPPNSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779297_Pol_P-A Product feature CHAIN KF779297_Pol_P-A of FT:mat_peptide KF779297_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0874). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLYRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARPHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLNLVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779298_Pol_P-A Product feature CHAIN KF779298_Pol_P-A of FT:mat_peptide KF779298_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0908). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQSSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVLSLLPHCLAFIYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779299_Pol_P-A Product feature CHAIN KF779299_Pol_P-A of FT:mat_peptide KF779299_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0943). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779304_Pol_P-A Product feature CHAIN KF779304_Pol_P-A of FT:mat_peptide KF779304_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRPRAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSTGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779305_Pol_P-A Product feature CHAIN KF779305_Pol_P-A of FT:mat_peptide KF779305_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIAWTHKVGNFTGLYSSTVAIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779306_Pol_P-A Product feature CHAIN KF779306_Pol_P-A of FT:mat_peptide KF779306_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779307_Pol_P-A Product feature CHAIN KF779307_Pol_P-A of FT:mat_peptide KF779307_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCHQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779308_Pol_P-A Product feature CHAIN KF779308_Pol_P-A of FT:mat_peptide KF779308_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRQYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779309_Pol_P-A Product feature CHAIN KF779309_Pol_P-A of FT:mat_peptide KF779309_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779310_Pol_P-A Product feature CHAIN KF779310_Pol_P-A of FT:mat_peptide KF779310_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3845). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINGCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCRWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779311_Pol_P-A Product feature CHAIN KF779311_Pol_P-A of FT:mat_peptide KF779311_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCRWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAEYRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRPFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779312_Pol_P-A Product feature CHAIN KF779312_Pol_P-A of FT:mat_peptide KF779312_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3907). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIHRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779313_Pol_P-A Product feature CHAIN KF779313_Pol_P-A of FT:mat_peptide KF779313_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3958). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTYKRQSSSGRAVEFHCLPPSSAGSQSQG
SVSSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779314_Pol_P-A Product feature CHAIN KF779314_Pol_P-A of FT:mat_peptide KF779314_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3985). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVKPSGSGHIDHSVNNSSSGLHQSAVRKTAYSHLSSSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779315_Pol_P-A Product feature CHAIN KF779315_Pol_P-A of FT:mat_peptide KF779315_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQISRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779316_Pol_P-A Product feature CHAIN KF779316_Pol_P-A of FT:mat_peptide KF779316_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWKTPS
FPQIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVHNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779317_Pol_P-A Product feature CHAIN KF779317_Pol_P-A of FT:mat_peptide KF779317_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRASPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779319_Pol_P-A Product feature CHAIN KF779319_Pol_P-A of FT:mat_peptide KF779319_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
TVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779320_Pol_P-A Product feature CHAIN KF779320_Pol_P-A of FT:mat_peptide KF779320_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQVKQSRLVLQPHQGPLASSQPG
RSGSIRARAHPSTRRCFGVEPSGSGHIDLSVNNSSSCLLQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSAFPHYLAFSYMDDVLLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779321_Pol_P-A Product feature CHAIN KF779321_Pol_P-A of FT:mat_peptide KF779321_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4362). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRSAFPHCLAFSYMDDVLLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779322_Pol_P-A Product feature CHAIN KF779322_Pol_P-A of FT:mat_peptide KF779322_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNNAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779323_Pol_P-A Product feature CHAIN KF779323_Pol_P-A of FT:mat_peptide KF779323_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNNAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779324_Pol_P-A Product feature CHAIN KF779324_Pol_P-A of FT:mat_peptide KF779324_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPQSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNNAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHREALYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779325_Pol_P-A Product feature CHAIN KF779325_Pol_P-A of FT:mat_peptide KF779325_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPQSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779326_Pol_P-A Product feature CHAIN KF779326_Pol_P-A of FT:mat_peptide KF779326_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPPTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779328_Pol_P-A Product feature CHAIN KF779328_Pol_P-A of FT:mat_peptide KF779328_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4532). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIHRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779329_Pol_P-A Product feature CHAIN KF779329_Pol_P-A of FT:mat_peptide KF779329_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVPEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKILMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779330_Pol_P-A Product feature CHAIN KF779330_Pol_P-A of FT:mat_peptide KF779330_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4541). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIHRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779331_Pol_P-A Product feature CHAIN KF779331_Pol_P-A of FT:mat_peptide KF779331_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4543). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIHRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVVKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779332_Pol_P-A Product feature CHAIN KF779332_Pol_P-A of FT:mat_peptide KF779332_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4549). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPNQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPYQGPLATSQPG
RSGSIRARVHSPTRRCFGVEPSGSGHIGHSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHSFPPNSAGSQSQG
PVLSCWWLQFRNSQPCSKYCLSHLVNLLEDWGPCEEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAYSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779333_Pol_P-A Product feature CHAIN KF779333_Pol_P-A of FT:mat_peptide KF779333_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4661). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLANSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFRGYVIGSWGNLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAAFFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGGTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779335_Pol_P-A Product feature CHAIN KF779335_Pol_P-A of FT:mat_peptide KF779335_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4687). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779336_Pol_P-A Product feature CHAIN KF779336_Pol_P-A of FT:mat_peptide KF779336_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQPSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779337_Pol_P-A Product feature CHAIN KF779337_Pol_P-A of FT:mat_peptide KF779337_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4733). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779338_Pol_P-A Product feature CHAIN KF779338_Pol_P-A of FT:mat_peptide KF779338_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779339_Pol_P-A Product feature CHAIN KF779339_Pol_P-A of FT:mat_peptide KF779339_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4804). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIQTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779342_Pol_P-A Product feature CHAIN KF779342_Pol_P-A of FT:mat_peptide KF779342_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4865). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIIHRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779344_Pol_P-A Product feature CHAIN KF779344_Pol_P-A of FT:mat_peptide KF779344_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4928). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779345_Pol_P-A Product feature CHAIN KF779345_Pol_P-A of FT:mat_peptide KF779345_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4936). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLTKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779346_Pol_P-A Product feature CHAIN KF779346_Pol_P-A of FT:mat_peptide KF779346_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4938). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779347_Pol_P-A Product feature CHAIN KF779347_Pol_P-A of FT:mat_peptide KF779347_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4950). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779348_Pol_P-A Product feature CHAIN KF779348_Pol_P-A of FT:mat_peptide KF779348_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4951). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779349_Pol_P-A Product feature CHAIN KF779349_Pol_P-A of FT:mat_peptide KF779349_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4999). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELHHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARVHPSTRRCFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHCLSPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779350_Pol_P-A Product feature CHAIN KF779350_Pol_P-A of FT:mat_peptide KF779350_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQSSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLAFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF779351_Pol_P-A Product feature CHAIN KF779351_Pol_P-A of FT:mat_peptide KF779351_Pol_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPS
FPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVIKTSQRHGDESFCSQPSGILSRSSVGPCIRSQLKQSRLGLQPHQGPLASSQPG
RSGSIRARAHPSTRRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHCLPPSSAGSQSQG
SVFSCWWLQFRNSKPCSEYCLSHLVNLREDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
ITRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRINNNQYGTMQNL
HDSCSRQLYVSLMLLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHRESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLS
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl