HBVdb

Dataset for protein HBSP of genotype B

[Download (right click)] [Alignment] [Repertoires]

2170 sequence(s)

>gnl|hbvpro|AB010289_HBSP_P-B Product feature CHAIN AB010289_HBSP_P-B of FT:mat_peptide AB010289_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB010290_HBSP_P-B Product feature CHAIN AB010290_HBSP_P-B of FT:mat_peptide AB010290_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB010291_HBSP_P-B Product feature CHAIN AB010291_HBSP_P-B of FT:mat_peptide AB010291_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB010292_HBSP_P-B Product feature CHAIN AB010292_HBSP_P-B of FT:mat_peptide AB010292_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB014366_HBSP_P-B Product feature CHAIN AB014366_HBSP_P-B of FT:mat_peptide AB014366_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 07D07HCC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB031266_HBSP_P-B Product feature CHAIN AB031266_HBSP_P-B of FT:mat_peptide AB031266_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB031267_HBSP_P-B Product feature CHAIN AB031267_HBSP_P-B of FT:mat_peptide AB031267_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB033555_HBSP_P-B Product feature CHAIN AB033555_HBSP_P-B of FT:mat_peptide AB033555_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRPVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB048705_HBSP_P-B Product feature CHAIN AB048705_HBSP_P-B of FT:mat_peptide AB048705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|AB073821_HBSP_P-B Product feature CHAIN AB073821_HBSP_P-B of FT:mat_peptide AB073821_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073822_HBSP_P-B Product feature CHAIN AB073822_HBSP_P-B of FT:mat_peptide AB073822_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073823_HBSP_P-B Product feature CHAIN AB073823_HBSP_P-B of FT:mat_peptide AB073823_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|AB073824_HBSP_P-B Product feature CHAIN AB073824_HBSP_P-B of FT:mat_peptide AB073824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDRQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073825_HBSP_P-B Product feature CHAIN AB073825_HBSP_P-B of FT:mat_peptide AB073825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073826_HBSP_P-B Product feature CHAIN AB073826_HBSP_P-B of FT:mat_peptide AB073826_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073827_HBSP_P-B Product feature CHAIN AB073827_HBSP_P-B of FT:mat_peptide AB073827_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073828_HBSP_P-B Product feature CHAIN AB073828_HBSP_P-B of FT:mat_peptide AB073828_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073829_HBSP_P-B Product feature CHAIN AB073829_HBSP_P-B of FT:mat_peptide AB073829_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073830_HBSP_P-B Product feature CHAIN AB073830_HBSP_P-B of FT:mat_peptide AB073830_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQXFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073831_HBSP_P-B Product feature CHAIN AB073831_HBSP_P-B of FT:mat_peptide AB073831_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073832_HBSP_P-B Product feature CHAIN AB073832_HBSP_P-B of FT:mat_peptide AB073832_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073833_HBSP_P-B Product feature CHAIN AB073833_HBSP_P-B of FT:mat_peptide AB073833_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073834_HBSP_P-B Product feature CHAIN AB073834_HBSP_P-B of FT:mat_peptide AB073834_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073835_HBSP_P-B Product feature CHAIN AB073835_HBSP_P-B of FT:mat_peptide AB073835_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB073836_HBSP_P-B Product feature CHAIN AB073836_HBSP_P-B of FT:mat_peptide AB073836_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073837_HBSP_P-B Product feature CHAIN AB073837_HBSP_P-B of FT:mat_peptide AB073837_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHHGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073838_HBSP_P-B Product feature CHAIN AB073838_HBSP_P-B of FT:mat_peptide AB073838_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073839_HBSP_P-B Product feature CHAIN AB073839_HBSP_P-B of FT:mat_peptide AB073839_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073840_HBSP_P-B Product feature CHAIN AB073840_HBSP_P-B of FT:mat_peptide AB073840_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073841_HBSP_P-B Product feature CHAIN AB073841_HBSP_P-B of FT:mat_peptide AB073841_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073842_HBSP_P-B Product feature CHAIN AB073842_HBSP_P-B of FT:mat_peptide AB073842_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQPPARDHARPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB073843_HBSP_P-B Product feature CHAIN AB073843_HBSP_P-B of FT:mat_peptide AB073843_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAPLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073844_HBSP_P-B Product feature CHAIN AB073844_HBSP_P-B of FT:mat_peptide AB073844_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073845_HBSP_P-B Product feature CHAIN AB073845_HBSP_P-B of FT:mat_peptide AB073845_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073846_HBSP_P-B Product feature CHAIN AB073846_HBSP_P-B of FT:mat_peptide AB073846_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHHVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073847_HBSP_P-B Product feature CHAIN AB073847_HBSP_P-B of FT:mat_peptide AB073847_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073848_HBSP_P-B Product feature CHAIN AB073848_HBSP_P-B of FT:mat_peptide AB073848_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073849_HBSP_P-B Product feature CHAIN AB073849_HBSP_P-B of FT:mat_peptide AB073849_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLXLLDDEAGPLEEELPRLADEGLNXRVAEDLNLGNPNDHQPPARXHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073850_HBSP_P-B Product feature CHAIN AB073850_HBSP_P-B of FT:mat_peptide AB073850_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073851_HBSP_P-B Product feature CHAIN AB073851_HBSP_P-B of FT:mat_peptide AB073851_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKETLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSFGSVY
>gnl|hbvpro|AB073852_HBSP_P-B Product feature CHAIN AB073852_HBSP_P-B of FT:mat_peptide AB073852_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073853_HBSP_P-B Product feature CHAIN AB073853_HBSP_P-B of FT:mat_peptide AB073853_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB073854_HBSP_P-B Product feature CHAIN AB073854_HBSP_P-B of FT:mat_peptide AB073854_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073855_HBSP_P-B Product feature CHAIN AB073855_HBSP_P-B of FT:mat_peptide AB073855_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073857_HBSP_P-B Product feature CHAIN AB073857_HBSP_P-B of FT:mat_peptide AB073857_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPTDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073858_HBSP_P-B Product feature CHAIN AB073858_HBSP_P-B of FT:mat_peptide AB073858_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB100695_HBSP_P-B Product feature CHAIN AB100695_HBSP_P-B of FT:mat_peptide AB100695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPPFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB106884_HBSP_P-B Product feature CHAIN AB106884_HBSP_P-B of FT:mat_peptide AB106884_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB115551_HBSP_P-B Product feature CHAIN AB115551_HBSP_P-B of FT:mat_peptide AB115551_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB117759_HBSP_P-B Product feature CHAIN AB117759_HBSP_P-B of FT:mat_peptide AB117759_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPARDHARPAQLLLETPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB195933_HBSP_P-B Product feature CHAIN AB195933_HBSP_P-B of FT:mat_peptide AB195933_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB195934_HBSP_P-B Product feature CHAIN AB195934_HBSP_P-B of FT:mat_peptide AB195934_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB195935_HBSP_P-B Product feature CHAIN AB195935_HBSP_P-B of FT:mat_peptide AB195935_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205119_HBSP_P-B Product feature CHAIN AB205119_HBSP_P-B of FT:mat_peptide AB205119_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205120_HBSP_P-B Product feature CHAIN AB205120_HBSP_P-B of FT:mat_peptide AB205120_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205121_HBSP_P-B Product feature CHAIN AB205121_HBSP_P-B of FT:mat_peptide AB205121_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205122_HBSP_P-B Product feature CHAIN AB205122_HBSP_P-B of FT:mat_peptide AB205122_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLPLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB212625_HBSP_P-B Product feature CHAIN AB212625_HBSP_P-B of FT:mat_peptide AB212625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEQAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB219427_HBSP_P-B Product feature CHAIN AB219427_HBSP_P-B of FT:mat_peptide AB219427_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPPVAVQNLRK
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB219428_HBSP_C-B Product feature CHAIN AB219428_HBSP_C-B of FT:mat_peptide AB219428_HBSP_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB219430_HBSP_P-B Product feature CHAIN AB219430_HBSP_P-B of FT:mat_peptide AB219430_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB231909_HBSP_P-B Product feature CHAIN AB231909_HBSP_P-B of FT:mat_peptide AB231909_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNHRVAEDLNLGNLNDHQPPALDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241116_HBSP_P-B Product feature CHAIN AB241116_HBSP_P-B of FT:mat_peptide AB241116_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLRFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241117_HBSP_P-B Product feature CHAIN AB241117_HBSP_P-B of FT:mat_peptide AB241117_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLRFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246339_HBSP_P-B Product feature CHAIN AB246339_HBSP_P-B of FT:mat_peptide AB246339_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246340_HBSP_P-B Product feature CHAIN AB246340_HBSP_P-B of FT:mat_peptide AB246340_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246341_HBSP_P-B Product feature CHAIN AB246341_HBSP_P-B of FT:mat_peptide AB246341_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246342_HBSP_P-B Product feature CHAIN AB246342_HBSP_P-B of FT:mat_peptide AB246342_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246343_HBSP_P-B Product feature CHAIN AB246343_HBSP_P-B of FT:mat_peptide AB246343_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287314_HBSP_P-B Product feature CHAIN AB287314_HBSP_P-B of FT:mat_peptide AB287314_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287315_HBSP_P-B Product feature CHAIN AB287315_HBSP_P-B of FT:mat_peptide AB287315_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287316_HBSP_P-B Product feature CHAIN AB287316_HBSP_P-B of FT:mat_peptide AB287316_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDESGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287317_HBSP_P-B Product feature CHAIN AB287317_HBSP_P-B of FT:mat_peptide AB287317_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQYFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287318_HBSP_P-B Product feature CHAIN AB287318_HBSP_P-B of FT:mat_peptide AB287318_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287319_HBSP_P-B Product feature CHAIN AB287319_HBSP_P-B of FT:mat_peptide AB287319_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287320_HBSP_P-B Product feature CHAIN AB287320_HBSP_P-B of FT:mat_peptide AB287320_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287321_HBSP_P-B Product feature CHAIN AB287321_HBSP_P-B of FT:mat_peptide AB287321_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGALEEELPRLADPDLNHRVAEDLNLGDPNDHQPPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287322_HBSP_P-B Product feature CHAIN AB287322_HBSP_P-B of FT:mat_peptide AB287322_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287323_HBSP_P-B Product feature CHAIN AB287323_HBSP_P-B of FT:mat_peptide AB287323_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNRRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287325_HBSP_P-B Product feature CHAIN AB287325_HBSP_P-B of FT:mat_peptide AB287325_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHAKPARLLLKGPLCFPHVVVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287326_HBSP_P-B Product feature CHAIN AB287326_HBSP_P-B of FT:mat_peptide AB287326_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287327_HBSP_P-B Product feature CHAIN AB287327_HBSP_P-B of FT:mat_peptide AB287327_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADAGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287328_HBSP_P-B Product feature CHAIN AB287328_HBSP_P-B of FT:mat_peptide AB287328_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287329_HBSP_P-B Product feature CHAIN AB287329_HBSP_P-B of FT:mat_peptide AB287329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300364_HBSP_P-B Product feature CHAIN AB300364_HBSP_P-B of FT:mat_peptide AB300364_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300370_HBSP_P-B Product feature CHAIN AB300370_HBSP_P-B of FT:mat_peptide AB300370_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300371_HBSP_P-B Product feature CHAIN AB300371_HBSP_P-B of FT:mat_peptide AB300371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQLFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQQPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302095_HBSP_P-B Product feature CHAIN AB302095_HBSP_P-B of FT:mat_peptide AB302095_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKETLRFPHVAVQNLRM
ETAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302942_HBSP_P-B Product feature CHAIN AB302942_HBSP_P-B of FT:mat_peptide AB302942_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302943_HBSP_P-B Product feature CHAIN AB302943_HBSP_P-B of FT:mat_peptide AB302943_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302944_HBSP_P-B Product feature CHAIN AB302944_HBSP_P-B of FT:mat_peptide AB302944_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302945_HBSP_P-B Product feature CHAIN AB302945_HBSP_P-B of FT:mat_peptide AB302945_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB362933_HBSP_P-B Product feature CHAIN AB362933_HBSP_P-B of FT:mat_peptide AB362933_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPQARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB365445_HBSP_P-B Product feature CHAIN AB365445_HBSP_P-B of FT:mat_peptide AB365445_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB368295_HBSP_P-B Product feature CHAIN AB368295_HBSP_P-B of FT:mat_peptide AB368295_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB471854_HBSP_P-B Product feature CHAIN AB471854_HBSP_P-B of FT:mat_peptide AB471854_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB471855_HBSP_P-B Product feature CHAIN AB471855_HBSP_P-B of FT:mat_peptide AB471855_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB493833_HBSP_P-B Product feature CHAIN AB493833_HBSP_P-B of FT:mat_peptide AB493833_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB555498_HBSP_P-B Product feature CHAIN AB555498_HBSP_P-B of FT:mat_peptide AB555498_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB555499_HBSP_P-B Product feature CHAIN AB555499_HBSP_P-B of FT:mat_peptide AB555499_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB642093_HBSP_P-B Product feature CHAIN AB642093_HBSP_P-B of FT:mat_peptide AB642093_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHAKXAQLLLKEPLCFPHAXVQNLRT
ETAPVFPSHXLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB642094_HBSP_P-B Product feature CHAIN AB642094_HBSP_P-B of FT:mat_peptide AB642094_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB675676_HBSP_P-B Product feature CHAIN AB675676_HBSP_P-B of FT:mat_peptide AB675676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713527_HBSP_P-B Product feature CHAIN AB713527_HBSP_P-B of FT:mat_peptide AB713527_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLMEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713528_HBSP_P-B Product feature CHAIN AB713528_HBSP_P-B of FT:mat_peptide AB713528_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPPVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713529_HBSP_P-B Product feature CHAIN AB713529_HBSP_P-B of FT:mat_peptide AB713529_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv68). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713530_HBSP_P-B Product feature CHAIN AB713530_HBSP_P-B of FT:mat_peptide AB713530_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKETLCFPHGAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713531_HBSP_P-B Product feature CHAIN AB713531_HBSP_P-B of FT:mat_peptide AB713531_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713532_HBSP_P-B Product feature CHAIN AB713532_HBSP_P-B of FT:mat_peptide AB713532_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv132). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLMEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900095_HBSP_P-B Product feature CHAIN AB900095_HBSP_P-B of FT:mat_peptide AB900095_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900096_HBSP_P-B Product feature CHAIN AB900096_HBSP_P-B of FT:mat_peptide AB900096_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKATLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900097_HBSP_P-B Product feature CHAIN AB900097_HBSP_P-B of FT:mat_peptide AB900097_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900098_HBSP_P-B Product feature CHAIN AB900098_HBSP_P-B of FT:mat_peptide AB900098_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPAPDHARPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900102_HBSP_P-B Product feature CHAIN AB900102_HBSP_P-B of FT:mat_peptide AB900102_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900103_HBSP_P-B Product feature CHAIN AB900103_HBSP_P-B of FT:mat_peptide AB900103_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900104_HBSP_P-B Product feature CHAIN AB900104_HBSP_P-B of FT:mat_peptide AB900104_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900105_HBSP_P-B Product feature CHAIN AB900105_HBSP_P-B of FT:mat_peptide AB900105_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900106_HBSP_P-B Product feature CHAIN AB900106_HBSP_P-B of FT:mat_peptide AB900106_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDPQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB900107_HBSP_P-B Product feature CHAIN AB900107_HBSP_P-B of FT:mat_peptide AB900107_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPAPDPARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900108_HBSP_P-B Product feature CHAIN AB900108_HBSP_P-B of FT:mat_peptide AB900108_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPDDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900110_HBSP_P-B Product feature CHAIN AB900110_HBSP_P-B of FT:mat_peptide AB900110_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900111_HBSP_P-B Product feature CHAIN AB900111_HBSP_P-B of FT:mat_peptide AB900111_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNHRVAEDLNLGIDPNDHXPPARDHARPAQLLLKEPLCFPHVAVQNLR
TETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900112_HBSP_P-B Product feature CHAIN AB900112_HBSP_P-B of FT:mat_peptide AB900112_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB931168_HBSP_P-B Product feature CHAIN AB931168_HBSP_P-B of FT:mat_peptide AB931168_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB931169_HBSP_P-B Product feature CHAIN AB931169_HBSP_P-B of FT:mat_peptide AB931169_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB976562_HBSP_P-B Product feature CHAIN AB976562_HBSP_P-B of FT:mat_peptide AB976562_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF100308_HBSP_P-B Product feature CHAIN AF100308_HBSP_P-B of FT:mat_peptide AF100308_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF100309_HBSP_P-B Product feature CHAIN AF100309_HBSP_P-B of FT:mat_peptide AF100309_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121243_HBSP_P-B Product feature CHAIN AF121243_HBSP_P-B of FT:mat_peptide AF121243_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121244_HBSP_P-B Product feature CHAIN AF121244_HBSP_P-B of FT:mat_peptide AF121244_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121245_HBSP_P-B Product feature CHAIN AF121245_HBSP_P-B of FT:mat_peptide AF121245_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121246_HBSP_P-B Product feature CHAIN AF121246_HBSP_P-B of FT:mat_peptide AF121246_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121247_HBSP_P-B Product feature CHAIN AF121247_HBSP_P-B of FT:mat_peptide AF121247_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121248_HBSP_P-B Product feature CHAIN AF121248_HBSP_P-B of FT:mat_peptide AF121248_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|AF121249_HBSP_P-B Product feature CHAIN AF121249_HBSP_P-B of FT:mat_peptide AF121249_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121250_HBSP_P-B Product feature CHAIN AF121250_HBSP_P-B of FT:mat_peptide AF121250_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121251_HBSP_P-B Product feature CHAIN AF121251_HBSP_P-B of FT:mat_peptide AF121251_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AF282917_HBSP_P-B Product feature CHAIN AF282917_HBSP_P-B of FT:mat_peptide AF282917_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AF282918_HBSP_P-B Product feature CHAIN AF282918_HBSP_P-B of FT:mat_peptide AF282918_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF461360_HBSP_P-B Product feature CHAIN AF461360_HBSP_P-B of FT:mat_peptide AF461360_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|AF461362_HBSP_P-B Product feature CHAIN AF461362_HBSP_P-B of FT:mat_peptide AF461362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH10). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF479684_HBSP_P-B Product feature CHAIN AF479684_HBSP_P-B of FT:mat_peptide AF479684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDGEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ627225_HBSP_P-B Product feature CHAIN AJ627225_HBSP_P-B of FT:mat_peptide AJ627225_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011084_HBSP_P-B Product feature CHAIN AP011084_HBSP_P-B of FT:mat_peptide AP011084_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011085_HBSP_P-B Product feature CHAIN AP011085_HBSP_P-B of FT:mat_peptide AP011085_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011086_HBSP_P-B Product feature CHAIN AP011086_HBSP_P-B of FT:mat_peptide AP011086_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLYFPHVAVQNLRT
EIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011087_HBSP_P-B Product feature CHAIN AP011087_HBSP_P-B of FT:mat_peptide AP011087_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011088_HBSP_P-B Product feature CHAIN AP011088_HBSP_P-B of FT:mat_peptide AP011088_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011089_HBSP_P-B Product feature CHAIN AP011089_HBSP_P-B of FT:mat_peptide AP011089_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011090_HBSP_P-B Product feature CHAIN AP011090_HBSP_P-B of FT:mat_peptide AP011090_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011091_HBSP_P-B Product feature CHAIN AP011091_HBSP_P-B of FT:mat_peptide AP011091_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011092_HBSP_P-B Product feature CHAIN AP011092_HBSP_P-B of FT:mat_peptide AP011092_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011093_HBSP_P-B Product feature CHAIN AP011093_HBSP_P-B of FT:mat_peptide AP011093_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011094_HBSP_P-B Product feature CHAIN AP011094_HBSP_P-B of FT:mat_peptide AP011094_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AP011095_HBSP_P-B Product feature CHAIN AP011095_HBSP_P-B of FT:mat_peptide AP011095_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011096_HBSP_P-B Product feature CHAIN AP011096_HBSP_P-B of FT:mat_peptide AP011096_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY033072_HBSP_P-B Product feature CHAIN AY033072_HBSP_P-B of FT:mat_peptide AY033072_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY033073_HBSP_P-B Product feature CHAIN AY033073_HBSP_P-B of FT:mat_peptide AY033073_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAHVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY163869_HBSP_P-B Product feature CHAIN AY163869_HBSP_P-B of FT:mat_peptide AY163869_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPAREHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY163870_HBSP_P-B Product feature CHAIN AY163870_HBSP_P-B of FT:mat_peptide AY163870_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPAREHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167089_HBSP_P-B Product feature CHAIN AY167089_HBSP_P-B of FT:mat_peptide AY167089_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167093_HBSP_P-B Product feature CHAIN AY167093_HBSP_P-B of FT:mat_peptide AY167093_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167094_HBSP_P-B Product feature CHAIN AY167094_HBSP_P-B of FT:mat_peptide AY167094_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167097_HBSP_P-B Product feature CHAIN AY167097_HBSP_P-B of FT:mat_peptide AY167097_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167098_HBSP_P-B Product feature CHAIN AY167098_HBSP_P-B of FT:mat_peptide AY167098_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167100_HBSP_P-B Product feature CHAIN AY167100_HBSP_P-B of FT:mat_peptide AY167100_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167101_HBSP_P-B Product feature CHAIN AY167101_HBSP_P-B of FT:mat_peptide AY167101_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167102_HBSP_P-B Product feature CHAIN AY167102_HBSP_P-B of FT:mat_peptide AY167102_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHYLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY206375_HBSP_P-B Product feature CHAIN AY206375_HBSP_P-B of FT:mat_peptide AY206375_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY206383_HBSP_P-B Product feature CHAIN AY206383_HBSP_P-B of FT:mat_peptide AY206383_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLEQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY206387_HBSP_P-B Product feature CHAIN AY206387_HBSP_P-B of FT:mat_peptide AY206387_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDGDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPEHAKPARLLLKEPLCFPHVAVQNLRT
QTAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY206390_HBSP_P-B Product feature CHAIN AY206390_HBSP_P-B of FT:mat_peptide AY206390_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY206391_HBSP_P-B Product feature CHAIN AY206391_HBSP_P-B of FT:mat_peptide AY206391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217356_HBSP_P-B Product feature CHAIN AY217356_HBSP_P-B of FT:mat_peptide AY217356_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217357_HBSP_P-B Product feature CHAIN AY217357_HBSP_P-B of FT:mat_peptide AY217357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217358_HBSP_P-B Product feature CHAIN AY217358_HBSP_P-B of FT:mat_peptide AY217358_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217359_HBSP_P-B Product feature CHAIN AY217359_HBSP_P-B of FT:mat_peptide AY217359_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217360_HBSP_P-B Product feature CHAIN AY217360_HBSP_P-B of FT:mat_peptide AY217360_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRIAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217361_HBSP_P-B Product feature CHAIN AY217361_HBSP_P-B of FT:mat_peptide AY217361_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY217362_HBSP_P-B Product feature CHAIN AY217362_HBSP_P-B of FT:mat_peptide AY217362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217364_HBSP_P-B Product feature CHAIN AY217364_HBSP_P-B of FT:mat_peptide AY217364_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 586). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLNEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217368_HBSP_P-B Product feature CHAIN AY217368_HBSP_P-B of FT:mat_peptide AY217368_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21949). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|AY220697_HBSP_P-B Product feature CHAIN AY220697_HBSP_P-B of FT:mat_peptide AY220697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|AY220698_HBSP_P-B Product feature CHAIN AY220698_HBSP_P-B of FT:mat_peptide AY220698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY220703_HBSP_P-B Product feature CHAIN AY220703_HBSP_P-B of FT:mat_peptide AY220703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY220704_HBSP_P-B Product feature CHAIN AY220704_HBSP_P-B of FT:mat_peptide AY220704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY293309_HBSP_P-B Product feature CHAIN AY293309_HBSP_P-B of FT:mat_peptide AY293309_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY518556_HBSP_P-B Product feature CHAIN AY518556_HBSP_P-B of FT:mat_peptide AY518556_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596102_HBSP_P-B Product feature CHAIN AY596102_HBSP_P-B of FT:mat_peptide AY596102_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596103_HBSP_P-B Product feature CHAIN AY596103_HBSP_P-B of FT:mat_peptide AY596103_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|AY596104_HBSP_P-B Product feature CHAIN AY596104_HBSP_P-B of FT:mat_peptide AY596104_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY596105_HBSP_P-B Product feature CHAIN AY596105_HBSP_P-B of FT:mat_peptide AY596105_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596106_HBSP_P-B Product feature CHAIN AY596106_HBSP_P-B of FT:mat_peptide AY596106_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596109_HBSP_P-B Product feature CHAIN AY596109_HBSP_P-B of FT:mat_peptide AY596109_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596110_HBSP_P-B Product feature CHAIN AY596110_HBSP_P-B of FT:mat_peptide AY596110_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596111_HBSP_P-B Product feature CHAIN AY596111_HBSP_P-B of FT:mat_peptide AY596111_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596112_HBSP_P-B Product feature CHAIN AY596112_HBSP_P-B of FT:mat_peptide AY596112_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY766463_HBSP_P-B Product feature CHAIN AY766463_HBSP_P-B of FT:mat_peptide AY766463_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY800389_HBSP_P-B Product feature CHAIN AY800389_HBSP_P-B of FT:mat_peptide AY800389_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQPFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY800391_HBSP_P-B Product feature CHAIN AY800391_HBSP_P-B of FT:mat_peptide AY800391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARRLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY800392_HBSP_P-B Product feature CHAIN AY800392_HBSP_P-B of FT:mat_peptide AY800392_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARRLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D00329_HBSP_P-B Product feature CHAIN D00329_HBSP_P-B of FT:mat_peptide D00329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLWM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D00330_HBSP_P-B Product feature CHAIN D00330_HBSP_P-B of FT:mat_peptide D00330_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D00331_HBSP_C-B Product feature CHAIN D00331_HBSP_C-B of FT:mat_peptide D00331_HBSP_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAQDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D23678_HBSP_P-B Product feature CHAIN D23678_HBSP_P-B of FT:mat_peptide D23678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D23679_HBSP_P-B Product feature CHAIN D23679_HBSP_P-B of FT:mat_peptide D23679_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARGHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D50521_HBSP_P-B Product feature CHAIN D50521_HBSP_P-B of FT:mat_peptide D50521_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNDHQPPARDHARPAQLLLETPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D50522_HBSP_P-B Product feature CHAIN D50522_HBSP_P-B of FT:mat_peptide D50522_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNDHQPPARDHARPAQLLLKAPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ361535_HBSP_P-B Product feature CHAIN DQ361535_HBSP_P-B of FT:mat_peptide DQ361535_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKETLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ377158_HBSP_P-B Product feature CHAIN DQ377158_HBSP_P-B of FT:mat_peptide DQ377158_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448619_HBSP_P-B Product feature CHAIN DQ448619_HBSP_P-B of FT:mat_peptide DQ448619_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448620_HBSP_P-B Product feature CHAIN DQ448620_HBSP_P-B of FT:mat_peptide DQ448620_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448621_HBSP_P-B Product feature CHAIN DQ448621_HBSP_P-B of FT:mat_peptide DQ448621_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448622_HBSP_P-B Product feature CHAIN DQ448622_HBSP_P-B of FT:mat_peptide DQ448622_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448623_HBSP_P-B Product feature CHAIN DQ448623_HBSP_P-B of FT:mat_peptide DQ448623_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448624_HBSP_P-B Product feature CHAIN DQ448624_HBSP_P-B of FT:mat_peptide DQ448624_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448625_HBSP_P-B Product feature CHAIN DQ448625_HBSP_P-B of FT:mat_peptide DQ448625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448626_HBSP_P-B Product feature CHAIN DQ448626_HBSP_P-B of FT:mat_peptide DQ448626_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448627_HBSP_P-B Product feature CHAIN DQ448627_HBSP_P-B of FT:mat_peptide DQ448627_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448628_HBSP_P-B Product feature CHAIN DQ448628_HBSP_P-B of FT:mat_peptide DQ448628_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463787_HBSP_P-B Product feature CHAIN DQ463787_HBSP_P-B of FT:mat_peptide DQ463787_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463788_HBSP_P-B Product feature CHAIN DQ463788_HBSP_P-B of FT:mat_peptide DQ463788_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463789_HBSP_P-B Product feature CHAIN DQ463789_HBSP_P-B of FT:mat_peptide DQ463789_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463790_HBSP_P-B Product feature CHAIN DQ463790_HBSP_P-B of FT:mat_peptide DQ463790_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463791_HBSP_P-B Product feature CHAIN DQ463791_HBSP_P-B of FT:mat_peptide DQ463791_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHRPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463792_HBSP_P-B Product feature CHAIN DQ463792_HBSP_P-B of FT:mat_peptide DQ463792_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDTDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463793_HBSP_P-B Product feature CHAIN DQ463793_HBSP_P-B of FT:mat_peptide DQ463793_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHAKLARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463794_HBSP_P-B Product feature CHAIN DQ463794_HBSP_P-B of FT:mat_peptide DQ463794_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGDPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463795_HBSP_P-B Product feature CHAIN DQ463795_HBSP_P-B of FT:mat_peptide DQ463795_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDRARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463796_HBSP_P-B Product feature CHAIN DQ463796_HBSP_P-B of FT:mat_peptide DQ463796_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463797_HBSP_P-B Product feature CHAIN DQ463797_HBSP_P-B of FT:mat_peptide DQ463797_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463798_HBSP_P-B Product feature CHAIN DQ463798_HBSP_P-B of FT:mat_peptide DQ463798_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463799_HBSP_P-B Product feature CHAIN DQ463799_HBSP_P-B of FT:mat_peptide DQ463799_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463800_HBSP_P-B Product feature CHAIN DQ463800_HBSP_P-B of FT:mat_peptide DQ463800_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463801_HBSP_P-B Product feature CHAIN DQ463801_HBSP_P-B of FT:mat_peptide DQ463801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQPPAPDHAKLARLLLKEPLCFPHVVVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463802_HBSP_P-B Product feature CHAIN DQ463802_HBSP_P-B of FT:mat_peptide DQ463802_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ904357_HBSP_P-B Product feature CHAIN DQ904357_HBSP_P-B of FT:mat_peptide DQ904357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993680_HBSP_P-B Product feature CHAIN DQ993680_HBSP_P-B of FT:mat_peptide DQ993680_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYEDFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993681_HBSP_P-B Product feature CHAIN DQ993681_HBSP_P-B of FT:mat_peptide DQ993681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993683_HBSP_P-B Product feature CHAIN DQ993683_HBSP_P-B of FT:mat_peptide DQ993683_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993684_HBSP_P-B Product feature CHAIN DQ993684_HBSP_P-B of FT:mat_peptide DQ993684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993685_HBSP_P-B Product feature CHAIN DQ993685_HBSP_P-B of FT:mat_peptide DQ993685_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993686_HBSP_P-B Product feature CHAIN DQ993686_HBSP_P-B of FT:mat_peptide DQ993686_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPARDHARPAQLLLETPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993687_HBSP_P-B Product feature CHAIN DQ993687_HBSP_P-B of FT:mat_peptide DQ993687_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFASHHLGLSQNTYGSGPQSVSLGSVYY
>gnl|hbvpro|DQ993696_HBSP_P-B Product feature CHAIN DQ993696_HBSP_P-B of FT:mat_peptide DQ993696_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHGIPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQFVSLGSVY
>gnl|hbvpro|DQ993697_HBSP_P-B Product feature CHAIN DQ993697_HBSP_P-B of FT:mat_peptide DQ993697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993698_HBSP_P-B Product feature CHAIN DQ993698_HBSP_P-B of FT:mat_peptide DQ993698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEAAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993699_HBSP_P-B Product feature CHAIN DQ993699_HBSP_P-B of FT:mat_peptide DQ993699_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEAAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993700_HBSP_P-B Product feature CHAIN DQ993700_HBSP_P-B of FT:mat_peptide DQ993700_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993701_HBSP_P-B Product feature CHAIN DQ993701_HBSP_P-B of FT:mat_peptide DQ993701_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993702_HBSP_P-B Product feature CHAIN DQ993702_HBSP_P-B of FT:mat_peptide DQ993702_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993703_HBSP_P-B Product feature CHAIN DQ993703_HBSP_P-B of FT:mat_peptide DQ993703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993704_HBSP_P-B Product feature CHAIN DQ993704_HBSP_P-B of FT:mat_peptide DQ993704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLYYQHFRKLLLLDEQAGPLEKELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993705_HBSP_P-B Product feature CHAIN DQ993705_HBSP_P-B of FT:mat_peptide DQ993705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993706_HBSP_P-B Product feature CHAIN DQ993706_HBSP_P-B of FT:mat_peptide DQ993706_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993707_HBSP_P-B Product feature CHAIN DQ993707_HBSP_P-B of FT:mat_peptide DQ993707_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993708_HBSP_P-B Product feature CHAIN DQ993708_HBSP_P-B of FT:mat_peptide DQ993708_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993709_HBSP_P-B Product feature CHAIN DQ993709_HBSP_P-B of FT:mat_peptide DQ993709_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993710_HBSP_P-B Product feature CHAIN DQ993710_HBSP_P-B of FT:mat_peptide DQ993710_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993711_HBSP_P-B Product feature CHAIN DQ993711_HBSP_P-B of FT:mat_peptide DQ993711_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGTLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995801_HBSP_P-B Product feature CHAIN DQ995801_HBSP_P-B of FT:mat_peptide DQ995801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995802_HBSP_P-B Product feature CHAIN DQ995802_HBSP_P-B of FT:mat_peptide DQ995802_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQQPAPDHAKPAQLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995803_HBSP_P-B Product feature CHAIN DQ995803_HBSP_P-B of FT:mat_peptide DQ995803_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C265-15). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995804_HBSP_P-B Product feature CHAIN DQ995804_HBSP_P-B of FT:mat_peptide DQ995804_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995805_HBSP_P-B Product feature CHAIN DQ995805_HBSP_P-B of FT:mat_peptide DQ995805_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-2.5KB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF134945_HBSP_P-B Product feature CHAIN EF134945_HBSP_P-B of FT:mat_peptide EF134945_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF134946_HBSP_P-B Product feature CHAIN EF134946_HBSP_P-B of FT:mat_peptide EF134946_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473971_HBSP_P-B Product feature CHAIN EF473971_HBSP_P-B of FT:mat_peptide EF473971_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473972_HBSP_P-B Product feature CHAIN EF473972_HBSP_P-B of FT:mat_peptide EF473972_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473973_HBSP_P-B Product feature CHAIN EF473973_HBSP_P-B of FT:mat_peptide EF473973_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRPVADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473974_HBSP_P-B Product feature CHAIN EF473974_HBSP_P-B of FT:mat_peptide EF473974_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EF473975_HBSP_P-B Product feature CHAIN EF473975_HBSP_P-B of FT:mat_peptide EF473975_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|EF473976_HBSP_P-B Product feature CHAIN EF473976_HBSP_P-B of FT:mat_peptide EF473976_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473977_HBSP_P-B Product feature CHAIN EF473977_HBSP_P-B of FT:mat_peptide EF473977_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPAQLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF494380_HBSP_P-B Product feature CHAIN EF494380_HBSP_P-B of FT:mat_peptide EF494380_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF494382_HBSP_P-B Product feature CHAIN EF494382_HBSP_P-B of FT:mat_peptide EF494382_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNHRVAKDLNLGTLNDHQQPARDHAKPARVLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU139543_HBSP_P-B Product feature CHAIN EU139543_HBSP_P-B of FT:mat_peptide EU139543_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|EU158262_HBSP_P-B Product feature CHAIN EU158262_HBSP_P-B of FT:mat_peptide EU158262_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G116). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU158263_HBSP_P-B Product feature CHAIN EU158263_HBSP_P-B of FT:mat_peptide EU158263_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU305547_HBSP_P-B Product feature CHAIN EU305547_HBSP_P-B of FT:mat_peptide EU305547_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU305548_HBSP_P-B Product feature CHAIN EU305548_HBSP_P-B of FT:mat_peptide EU305548_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRRPASDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306677_HBSP_P-B Product feature CHAIN EU306677_HBSP_P-B of FT:mat_peptide EU306677_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306678_HBSP_P-B Product feature CHAIN EU306678_HBSP_P-B of FT:mat_peptide EU306678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306679_HBSP_P-B Product feature CHAIN EU306679_HBSP_P-B of FT:mat_peptide EU306679_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306680_HBSP_P-B Product feature CHAIN EU306680_HBSP_P-B of FT:mat_peptide EU306680_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306681_HBSP_P-B Product feature CHAIN EU306681_HBSP_P-B of FT:mat_peptide EU306681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAHLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306695_HBSP_P-B Product feature CHAIN EU306695_HBSP_P-B of FT:mat_peptide EU306695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306696_HBSP_P-B Product feature CHAIN EU306696_HBSP_P-B of FT:mat_peptide EU306696_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGRGPQSVSLGSVY
>gnl|hbvpro|EU306697_HBSP_P-B Product feature CHAIN EU306697_HBSP_P-B of FT:mat_peptide EU306697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306698_HBSP_P-B Product feature CHAIN EU306698_HBSP_P-B of FT:mat_peptide EU306698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306699_HBSP_P-B Product feature CHAIN EU306699_HBSP_P-B of FT:mat_peptide EU306699_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306700_HBSP_P-B Product feature CHAIN EU306700_HBSP_P-B of FT:mat_peptide EU306700_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306701_HBSP_P-B Product feature CHAIN EU306701_HBSP_P-B of FT:mat_peptide EU306701_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306702_HBSP_P-B Product feature CHAIN EU306702_HBSP_P-B of FT:mat_peptide EU306702_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306703_HBSP_P-B Product feature CHAIN EU306703_HBSP_P-B of FT:mat_peptide EU306703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306704_HBSP_P-B Product feature CHAIN EU306704_HBSP_P-B of FT:mat_peptide EU306704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNAYGSGPQSVSLGSVY
>gnl|hbvpro|EU306705_HBSP_P-B Product feature CHAIN EU306705_HBSP_P-B of FT:mat_peptide EU306705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306706_HBSP_P-B Product feature CHAIN EU306706_HBSP_P-B of FT:mat_peptide EU306706_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306707_HBSP_P-B Product feature CHAIN EU306707_HBSP_P-B of FT:mat_peptide EU306707_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRAAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNAYGSGPQSVSLGSVY
>gnl|hbvpro|EU306708_HBSP_P-B Product feature CHAIN EU306708_HBSP_P-B of FT:mat_peptide EU306708_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306709_HBSP_P-B Product feature CHAIN EU306709_HBSP_P-B of FT:mat_peptide EU306709_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306710_HBSP_P-B Product feature CHAIN EU306710_HBSP_P-B of FT:mat_peptide EU306710_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306711_HBSP_P-B Product feature CHAIN EU306711_HBSP_P-B of FT:mat_peptide EU306711_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306712_HBSP_P-B Product feature CHAIN EU306712_HBSP_P-B of FT:mat_peptide EU306712_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330989_HBSP_P-B Product feature CHAIN EU330989_HBSP_P-B of FT:mat_peptide EU330989_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPRVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330990_HBSP_P-B Product feature CHAIN EU330990_HBSP_P-B of FT:mat_peptide EU330990_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPRVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330992_HBSP_P-B Product feature CHAIN EU330992_HBSP_P-B of FT:mat_peptide EU330992_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330994_HBSP_P-B Product feature CHAIN EU330994_HBSP_P-B of FT:mat_peptide EU330994_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330995_HBSP_P-B Product feature CHAIN EU330995_HBSP_P-B of FT:mat_peptide EU330995_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330996_HBSP_P-B Product feature CHAIN EU330996_HBSP_P-B of FT:mat_peptide EU330996_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330997_HBSP_P-B Product feature CHAIN EU330997_HBSP_P-B of FT:mat_peptide EU330997_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330998_HBSP_P-B Product feature CHAIN EU330998_HBSP_P-B of FT:mat_peptide EU330998_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330999_HBSP_P-B Product feature CHAIN EU330999_HBSP_P-B of FT:mat_peptide EU330999_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU331000_HBSP_P-B Product feature CHAIN EU331000_HBSP_P-B of FT:mat_peptide EU331000_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU331001_HBSP_P-B Product feature CHAIN EU331001_HBSP_P-B of FT:mat_peptide EU331001_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU350409_HBSP_P-B Product feature CHAIN EU350409_HBSP_P-B of FT:mat_peptide EU350409_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439018_HBSP_P-B Product feature CHAIN EU439018_HBSP_P-B of FT:mat_peptide EU439018_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439020_HBSP_P-B Product feature CHAIN EU439020_HBSP_P-B of FT:mat_peptide EU439020_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439021_HBSP_P-B Product feature CHAIN EU439021_HBSP_P-B of FT:mat_peptide EU439021_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439022_HBSP_P-B Product feature CHAIN EU439022_HBSP_P-B of FT:mat_peptide EU439022_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439023_HBSP_P-B Product feature CHAIN EU439023_HBSP_P-B of FT:mat_peptide EU439023_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU487256_HBSP_P-B Product feature CHAIN EU487256_HBSP_P-B of FT:mat_peptide EU487256_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU487257_HBSP_P-B Product feature CHAIN EU487257_HBSP_P-B of FT:mat_peptide EU487257_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522066_HBSP_P-B Product feature CHAIN EU522066_HBSP_P-B of FT:mat_peptide EU522066_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4N). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522067_HBSP_P-B Product feature CHAIN EU522067_HBSP_P-B of FT:mat_peptide EU522067_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522072_HBSP_P-B Product feature CHAIN EU522072_HBSP_P-B of FT:mat_peptide EU522072_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU522073_HBSP_P-B Product feature CHAIN EU522073_HBSP_P-B of FT:mat_peptide EU522073_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU522074_HBSP_P-B Product feature CHAIN EU522074_HBSP_P-B of FT:mat_peptide EU522074_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522075_HBSP_P-B Product feature CHAIN EU522075_HBSP_P-B of FT:mat_peptide EU522075_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU547563_HBSP_P-B Product feature CHAIN EU547563_HBSP_P-B of FT:mat_peptide EU547563_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564822_HBSP_P-B Product feature CHAIN EU564822_HBSP_P-B of FT:mat_peptide EU564822_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564823_HBSP_P-B Product feature CHAIN EU564823_HBSP_P-B of FT:mat_peptide EU564823_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564824_HBSP_P-B Product feature CHAIN EU564824_HBSP_P-B of FT:mat_peptide EU564824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564825_HBSP_P-B Product feature CHAIN EU564825_HBSP_P-B of FT:mat_peptide EU564825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11T). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564826_HBSP_P-B Product feature CHAIN EU564826_HBSP_P-B of FT:mat_peptide EU564826_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570069_HBSP_P-B Product feature CHAIN EU570069_HBSP_P-B of FT:mat_peptide EU570069_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
GTAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570070_HBSP_P-B Product feature CHAIN EU570070_HBSP_P-B of FT:mat_peptide EU570070_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570071_HBSP_P-B Product feature CHAIN EU570071_HBSP_P-B of FT:mat_peptide EU570071_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570075_HBSP_P-B Product feature CHAIN EU570075_HBSP_P-B of FT:mat_peptide EU570075_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU579441_HBSP_P-B Product feature CHAIN EU579441_HBSP_P-B of FT:mat_peptide EU579441_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU589335_HBSP_P-B Product feature CHAIN EU589335_HBSP_P-B of FT:mat_peptide EU589335_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU595031_HBSP_P-B Product feature CHAIN EU595031_HBSP_P-B of FT:mat_peptide EU595031_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU660224_HBSP_P-B Product feature CHAIN EU660224_HBSP_P-B of FT:mat_peptide EU660224_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Non-functional genomic sequence. [Hepadnaviridae] (length=110 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNQTEPAPDHAKPAQLLLKEPLCFPHVAVPNLRTE
TAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU660230_HBSP_P-B Product feature CHAIN EU660230_HBSP_P-B of FT:mat_peptide EU660230_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU660231_HBSP_P-B Product feature CHAIN EU660231_HBSP_P-B of FT:mat_peptide EU660231_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796066_HBSP_P-B Product feature CHAIN EU796066_HBSP_P-B of FT:mat_peptide EU796066_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796067_HBSP_P-B Product feature CHAIN EU796067_HBSP_P-B of FT:mat_peptide EU796067_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796068_HBSP_P-B Product feature CHAIN EU796068_HBSP_P-B of FT:mat_peptide EU796068_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796071_HBSP_P-B Product feature CHAIN EU796071_HBSP_P-B of FT:mat_peptide EU796071_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU881997_HBSP_P-B Product feature CHAIN EU881997_HBSP_P-B of FT:mat_peptide EU881997_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU881998_HBSP_P-B Product feature CHAIN EU881998_HBSP_P-B of FT:mat_peptide EU881998_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU882002_HBSP_P-B Product feature CHAIN EU882002_HBSP_P-B of FT:mat_peptide EU882002_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU882004_HBSP_P-B Product feature CHAIN EU882004_HBSP_P-B of FT:mat_peptide EU882004_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU919171_HBSP_P-B Product feature CHAIN EU919171_HBSP_P-B of FT:mat_peptide EU919171_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU919172_HBSP_P-B Product feature CHAIN EU919172_HBSP_P-B of FT:mat_peptide EU919172_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSHNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU919173_HBSP_P-B Product feature CHAIN EU919173_HBSP_P-B of FT:mat_peptide EU919173_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU919175_HBSP_P-B Product feature CHAIN EU919175_HBSP_P-B of FT:mat_peptide EU919175_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU919176_HBSP_P-B Product feature CHAIN EU919176_HBSP_P-B of FT:mat_peptide EU919176_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939559_HBSP_P-B Product feature CHAIN EU939559_HBSP_P-B of FT:mat_peptide EU939559_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939633_HBSP_P-B Product feature CHAIN EU939633_HBSP_P-B of FT:mat_peptide EU939633_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939634_HBSP_P-B Product feature CHAIN EU939634_HBSP_P-B of FT:mat_peptide EU939634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939635_HBSP_P-B Product feature CHAIN EU939635_HBSP_P-B of FT:mat_peptide EU939635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B125). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939636_HBSP_P-B Product feature CHAIN EU939636_HBSP_P-B of FT:mat_peptide EU939636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939637_HBSP_P-B Product feature CHAIN EU939637_HBSP_P-B of FT:mat_peptide EU939637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKSAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939638_HBSP_P-B Product feature CHAIN EU939638_HBSP_P-B of FT:mat_peptide EU939638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLYFPHVAVQNLRT
ATAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939639_HBSP_P-B Product feature CHAIN EU939639_HBSP_P-B of FT:mat_peptide EU939639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939660_HBSP_P-B Product feature CHAIN EU939660_HBSP_P-B of FT:mat_peptide EU939660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C34). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939661_HBSP_P-B Product feature CHAIN EU939661_HBSP_P-B of FT:mat_peptide EU939661_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVADELNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939663_HBSP_P-B Product feature CHAIN EU939663_HBSP_P-B of FT:mat_peptide EU939663_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939664_HBSP_P-B Product feature CHAIN EU939664_HBSP_P-B of FT:mat_peptide EU939664_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939665_HBSP_P-B Product feature CHAIN EU939665_HBSP_P-B of FT:mat_peptide EU939665_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939666_HBSP_P-B Product feature CHAIN EU939666_HBSP_P-B of FT:mat_peptide EU939666_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939667_HBSP_P-B Product feature CHAIN EU939667_HBSP_P-B of FT:mat_peptide EU939667_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939669_HBSP_P-B Product feature CHAIN EU939669_HBSP_P-B of FT:mat_peptide EU939669_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939670_HBSP_P-B Product feature CHAIN EU939670_HBSP_P-B of FT:mat_peptide EU939670_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939672_HBSP_P-B Product feature CHAIN EU939672_HBSP_P-B of FT:mat_peptide EU939672_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939673_HBSP_P-B Product feature CHAIN EU939673_HBSP_P-B of FT:mat_peptide EU939673_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARHAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939674_HBSP_P-B Product feature CHAIN EU939674_HBSP_P-B of FT:mat_peptide EU939674_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVH
>gnl|hbvpro|EU939675_HBSP_P-B Product feature CHAIN EU939675_HBSP_P-B of FT:mat_peptide EU939675_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939676_HBSP_P-B Product feature CHAIN EU939676_HBSP_P-B of FT:mat_peptide EU939676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939677_HBSP_P-B Product feature CHAIN EU939677_HBSP_P-B of FT:mat_peptide EU939677_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHPQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939678_HBSP_P-B Product feature CHAIN EU939678_HBSP_P-B of FT:mat_peptide EU939678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023631_HBSP_P-B Product feature CHAIN FJ023631_HBSP_P-B of FT:mat_peptide FJ023631_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKLARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023632_HBSP_P-B Product feature CHAIN FJ023632_HBSP_P-B of FT:mat_peptide FJ023632_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023633_HBSP_P-B Product feature CHAIN FJ023633_HBSP_P-B of FT:mat_peptide FJ023633_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023634_HBSP_P-B Product feature CHAIN FJ023634_HBSP_P-B of FT:mat_peptide FJ023634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023635_HBSP_P-B Product feature CHAIN FJ023635_HBSP_P-B of FT:mat_peptide FJ023635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023636_HBSP_P-B Product feature CHAIN FJ023636_HBSP_P-B of FT:mat_peptide FJ023636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023637_HBSP_P-B Product feature CHAIN FJ023637_HBSP_P-B of FT:mat_peptide FJ023637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023638_HBSP_P-B Product feature CHAIN FJ023638_HBSP_P-B of FT:mat_peptide FJ023638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032342_HBSP_P-B Product feature CHAIN FJ032342_HBSP_P-B of FT:mat_peptide FJ032342_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKETLRYPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032344_HBSP_P-B Product feature CHAIN FJ032344_HBSP_P-B of FT:mat_peptide FJ032344_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDHQQPAPDHAKPARLLLKETLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032349_HBSP_P-B Product feature CHAIN FJ032349_HBSP_P-B of FT:mat_peptide FJ032349_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FJ032352_HBSP_P-B Product feature CHAIN FJ032352_HBSP_P-B of FT:mat_peptide FJ032352_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHRLGLSQNIYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032353_HBSP_P-B Product feature CHAIN FJ032353_HBSP_P-B of FT:mat_peptide FJ032353_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032354_HBSP_P-B Product feature CHAIN FJ032354_HBSP_P-B of FT:mat_peptide FJ032354_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032357_HBSP_P-B Product feature CHAIN FJ032357_HBSP_P-B of FT:mat_peptide FJ032357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032358_HBSP_P-B Product feature CHAIN FJ032358_HBSP_P-B of FT:mat_peptide FJ032358_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|FJ349236_HBSP_P-B Product feature CHAIN FJ349236_HBSP_P-B of FT:mat_peptide FJ349236_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386582_HBSP_P-B Product feature CHAIN FJ386582_HBSP_P-B of FT:mat_peptide FJ386582_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386583_HBSP_P-B Product feature CHAIN FJ386583_HBSP_P-B of FT:mat_peptide FJ386583_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386584_HBSP_P-B Product feature CHAIN FJ386584_HBSP_P-B of FT:mat_peptide FJ386584_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386600_HBSP_P-B Product feature CHAIN FJ386600_HBSP_P-B of FT:mat_peptide FJ386600_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|FJ386608_HBSP_P-B Product feature CHAIN FJ386608_HBSP_P-B of FT:mat_peptide FJ386608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHRQPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386610_HBSP_P-B Product feature CHAIN FJ386610_HBSP_P-B of FT:mat_peptide FJ386610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386615_HBSP_P-B Product feature CHAIN FJ386615_HBSP_P-B of FT:mat_peptide FJ386615_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386634_HBSP_P-B Product feature CHAIN FJ386634_HBSP_P-B of FT:mat_peptide FJ386634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386636_HBSP_P-B Product feature CHAIN FJ386636_HBSP_P-B of FT:mat_peptide FJ386636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386642_HBSP_P-B Product feature CHAIN FJ386642_HBSP_P-B of FT:mat_peptide FJ386642_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386648_HBSP_P-B Product feature CHAIN FJ386648_HBSP_P-B of FT:mat_peptide FJ386648_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGILNEHQLPARDPAKPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDTYGSGPQSVSLRSIY
>gnl|hbvpro|FJ386654_HBSP_P-B Product feature CHAIN FJ386654_HBSP_P-B of FT:mat_peptide FJ386654_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386655_HBSP_P-B Product feature CHAIN FJ386655_HBSP_P-B of FT:mat_peptide FJ386655_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|FJ386656_HBSP_P-B Product feature CHAIN FJ386656_HBSP_P-B of FT:mat_peptide FJ386656_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386658_HBSP_P-B Product feature CHAIN FJ386658_HBSP_P-B of FT:mat_peptide FJ386658_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386660_HBSP_P-B Product feature CHAIN FJ386660_HBSP_P-B of FT:mat_peptide FJ386660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386666_HBSP_P-B Product feature CHAIN FJ386666_HBSP_P-B of FT:mat_peptide FJ386666_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386668_HBSP_P-B Product feature CHAIN FJ386668_HBSP_P-B of FT:mat_peptide FJ386668_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386669_HBSP_P-B Product feature CHAIN FJ386669_HBSP_P-B of FT:mat_peptide FJ386669_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386675_HBSP_P-B Product feature CHAIN FJ386675_HBSP_P-B of FT:mat_peptide FJ386675_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FJ386676_HBSP_P-B Product feature CHAIN FJ386676_HBSP_P-B of FT:mat_peptide FJ386676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386681_HBSP_P-B Product feature CHAIN FJ386681_HBSP_P-B of FT:mat_peptide FJ386681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386682_HBSP_P-B Product feature CHAIN FJ386682_HBSP_P-B of FT:mat_peptide FJ386682_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386683_HBSP_P-B Product feature CHAIN FJ386683_HBSP_P-B of FT:mat_peptide FJ386683_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386684_HBSP_P-B Product feature CHAIN FJ386684_HBSP_P-B of FT:mat_peptide FJ386684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386688_HBSP_P-B Product feature CHAIN FJ386688_HBSP_P-B of FT:mat_peptide FJ386688_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ518811_HBSP_P-B Product feature CHAIN FJ518811_HBSP_P-B of FT:mat_peptide FJ518811_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLRLSQNTYGSGPQSVSLDSVY
>gnl|hbvpro|FJ518812_HBSP_P-B Product feature CHAIN FJ518812_HBSP_P-B of FT:mat_peptide FJ518812_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLVSVY
>gnl|hbvpro|FJ562219_HBSP_P-B Product feature CHAIN FJ562219_HBSP_P-B of FT:mat_peptide FJ562219_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562222_HBSP_P-B Product feature CHAIN FJ562222_HBSP_P-B of FT:mat_peptide FJ562222_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562224_HBSP_P-B Product feature CHAIN FJ562224_HBSP_P-B of FT:mat_peptide FJ562224_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|FJ562231_HBSP_P-B Product feature CHAIN FJ562231_HBSP_P-B of FT:mat_peptide FJ562231_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562234_HBSP_P-B Product feature CHAIN FJ562234_HBSP_P-B of FT:mat_peptide FJ562234_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562236_HBSP_P-B Product feature CHAIN FJ562236_HBSP_P-B of FT:mat_peptide FJ562236_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562237_HBSP_P-B Product feature CHAIN FJ562237_HBSP_P-B of FT:mat_peptide FJ562237_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562240_HBSP_P-B Product feature CHAIN FJ562240_HBSP_P-B of FT:mat_peptide FJ562240_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRLPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562246_HBSP_P-B Product feature CHAIN FJ562246_HBSP_P-B of FT:mat_peptide FJ562246_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562253_HBSP_P-B Product feature CHAIN FJ562253_HBSP_P-B of FT:mat_peptide FJ562253_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562254_HBSP_P-B Product feature CHAIN FJ562254_HBSP_P-B of FT:mat_peptide FJ562254_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562257_HBSP_P-B Product feature CHAIN FJ562257_HBSP_P-B of FT:mat_peptide FJ562257_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPASDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562259_HBSP_P-B Product feature CHAIN FJ562259_HBSP_P-B of FT:mat_peptide FJ562259_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562260_HBSP_P-B Product feature CHAIN FJ562260_HBSP_P-B of FT:mat_peptide FJ562260_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562262_HBSP_P-B Product feature CHAIN FJ562262_HBSP_P-B of FT:mat_peptide FJ562262_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I111). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562289_HBSP_P-B Product feature CHAIN FJ562289_HBSP_P-B of FT:mat_peptide FJ562289_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562296_HBSP_P-B Product feature CHAIN FJ562296_HBSP_P-B of FT:mat_peptide FJ562296_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562303_HBSP_P-B Product feature CHAIN FJ562303_HBSP_P-B of FT:mat_peptide FJ562303_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFHHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562311_HBSP_P-B Product feature CHAIN FJ562311_HBSP_P-B of FT:mat_peptide FJ562311_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEGDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562312_HBSP_P-B Product feature CHAIN FJ562312_HBSP_P-B of FT:mat_peptide FJ562312_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562316_HBSP_P-B Product feature CHAIN FJ562316_HBSP_P-B of FT:mat_peptide FJ562316_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562322_HBSP_P-B Product feature CHAIN FJ562322_HBSP_P-B of FT:mat_peptide FJ562322_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ787444_HBSP_P-B Product feature CHAIN FJ787444_HBSP_P-B of FT:mat_peptide FJ787444_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ787475_HBSP_P-B Product feature CHAIN FJ787475_HBSP_P-B of FT:mat_peptide FJ787475_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|FJ787476_HBSP_P-B Product feature CHAIN FJ787476_HBSP_P-B of FT:mat_peptide FJ787476_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|FJ787477_HBSP_P-B Product feature CHAIN FJ787477_HBSP_P-B of FT:mat_peptide FJ787477_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899779_HBSP_P-B Product feature CHAIN FJ899779_HBSP_P-B of FT:mat_peptide FJ899779_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPPVAVQNLRT
ETALVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899784_HBSP_P-B Product feature CHAIN FJ899784_HBSP_P-B of FT:mat_peptide FJ899784_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899785_HBSP_P-B Product feature CHAIN FJ899785_HBSP_P-B of FT:mat_peptide FJ899785_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899786_HBSP_P-B Product feature CHAIN FJ899786_HBSP_P-B of FT:mat_peptide FJ899786_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899787_HBSP_P-B Product feature CHAIN FJ899787_HBSP_P-B of FT:mat_peptide FJ899787_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLSLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899790_HBSP_P-B Product feature CHAIN FJ899790_HBSP_P-B of FT:mat_peptide FJ899790_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVH
>gnl|hbvpro|FJ899791_HBSP_P-B Product feature CHAIN FJ899791_HBSP_P-B of FT:mat_peptide FJ899791_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVH
>gnl|hbvpro|GQ358136_HBSP_P-B Product feature CHAIN GQ358136_HBSP_P-B of FT:mat_peptide GQ358136_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPPPAPDHAKPARLLLKEPLCSPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358137_HBSP_P-B Product feature CHAIN GQ358137_HBSP_P-B of FT:mat_peptide GQ358137_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGINRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358138_HBSP_P-B Product feature CHAIN GQ358138_HBSP_P-B of FT:mat_peptide GQ358138_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358139_HBSP_P-B Product feature CHAIN GQ358139_HBSP_P-B of FT:mat_peptide GQ358139_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT032). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDFNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358140_HBSP_P-B Product feature CHAIN GQ358140_HBSP_P-B of FT:mat_peptide GQ358140_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358141_HBSP_P-B Product feature CHAIN GQ358141_HBSP_P-B of FT:mat_peptide GQ358141_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ358142_HBSP_P-B Product feature CHAIN GQ358142_HBSP_P-B of FT:mat_peptide GQ358142_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPPPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358143_HBSP_P-B Product feature CHAIN GQ358143_HBSP_P-B of FT:mat_peptide GQ358143_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358145_HBSP_P-B Product feature CHAIN GQ358145_HBSP_P-B of FT:mat_peptide GQ358145_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358146_HBSP_P-B Product feature CHAIN GQ358146_HBSP_P-B of FT:mat_peptide GQ358146_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358147_HBSP_P-B Product feature CHAIN GQ358147_HBSP_P-B of FT:mat_peptide GQ358147_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGNLNDHQPPAPDHAEPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358148_HBSP_P-B Product feature CHAIN GQ358148_HBSP_P-B of FT:mat_peptide GQ358148_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLFYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358149_HBSP_P-B Product feature CHAIN GQ358149_HBSP_P-B of FT:mat_peptide GQ358149_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358150_HBSP_P-B Product feature CHAIN GQ358150_HBSP_P-B of FT:mat_peptide GQ358150_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358151_HBSP_P-B Product feature CHAIN GQ358151_HBSP_P-B of FT:mat_peptide GQ358151_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358152_HBSP_P-B Product feature CHAIN GQ358152_HBSP_P-B of FT:mat_peptide GQ358152_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377519_HBSP_P-B Product feature CHAIN GQ377519_HBSP_P-B of FT:mat_peptide GQ377519_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377525_HBSP_P-B Product feature CHAIN GQ377525_HBSP_P-B of FT:mat_peptide GQ377525_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377537_HBSP_P-B Product feature CHAIN GQ377537_HBSP_P-B of FT:mat_peptide GQ377537_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377542_HBSP_P-B Product feature CHAIN GQ377542_HBSP_P-B of FT:mat_peptide GQ377542_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377547_HBSP_P-B Product feature CHAIN GQ377547_HBSP_P-B of FT:mat_peptide GQ377547_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377550_HBSP_P-B Product feature CHAIN GQ377550_HBSP_P-B of FT:mat_peptide GQ377550_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J81). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377558_HBSP_P-B Product feature CHAIN GQ377558_HBSP_P-B of FT:mat_peptide GQ377558_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377561_HBSP_P-B Product feature CHAIN GQ377561_HBSP_P-B of FT:mat_peptide GQ377561_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377566_HBSP_P-B Product feature CHAIN GQ377566_HBSP_P-B of FT:mat_peptide GQ377566_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377567_HBSP_P-B Product feature CHAIN GQ377567_HBSP_P-B of FT:mat_peptide GQ377567_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPPPDHAKPAQFLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQDTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377568_HBSP_P-B Product feature CHAIN GQ377568_HBSP_P-B of FT:mat_peptide GQ377568_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377569_HBSP_P-B Product feature CHAIN GQ377569_HBSP_P-B of FT:mat_peptide GQ377569_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377582_HBSP_P-B Product feature CHAIN GQ377582_HBSP_P-B of FT:mat_peptide GQ377582_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377587_HBSP_P-B Product feature CHAIN GQ377587_HBSP_P-B of FT:mat_peptide GQ377587_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|GQ377588_HBSP_P-B Product feature CHAIN GQ377588_HBSP_P-B of FT:mat_peptide GQ377588_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377606_HBSP_P-B Product feature CHAIN GQ377606_HBSP_P-B of FT:mat_peptide GQ377606_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377610_HBSP_P-B Product feature CHAIN GQ377610_HBSP_P-B of FT:mat_peptide GQ377610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377612_HBSP_P-B Product feature CHAIN GQ377612_HBSP_P-B of FT:mat_peptide GQ377612_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377622_HBSP_P-B Product feature CHAIN GQ377622_HBSP_P-B of FT:mat_peptide GQ377622_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377625_HBSP_P-B Product feature CHAIN GQ377625_HBSP_P-B of FT:mat_peptide GQ377625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377629_HBSP_P-B Product feature CHAIN GQ377629_HBSP_P-B of FT:mat_peptide GQ377629_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377638_HBSP_P-B Product feature CHAIN GQ377638_HBSP_P-B of FT:mat_peptide GQ377638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377639_HBSP_P-B Product feature CHAIN GQ377639_HBSP_P-B of FT:mat_peptide GQ377639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377641_HBSP_P-B Product feature CHAIN GQ377641_HBSP_P-B of FT:mat_peptide GQ377641_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377643_HBSP_P-B Product feature CHAIN GQ377643_HBSP_P-B of FT:mat_peptide GQ377643_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377644_HBSP_P-B Product feature CHAIN GQ377644_HBSP_P-B of FT:mat_peptide GQ377644_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELHHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSWPQPVSLGSVH
>gnl|hbvpro|GQ475340_HBSP_P-B Product feature CHAIN GQ475340_HBSP_P-B of FT:mat_peptide GQ475340_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924603_HBSP_P-B Product feature CHAIN GQ924603_HBSP_P-B of FT:mat_peptide GQ924603_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924605_HBSP_P-B Product feature CHAIN GQ924605_HBSP_P-B of FT:mat_peptide GQ924605_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPXLAXEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924607_HBSP_P-B Product feature CHAIN GQ924607_HBSP_P-B of FT:mat_peptide GQ924607_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNGRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924608_HBSP_P-B Product feature CHAIN GQ924608_HBSP_P-B of FT:mat_peptide GQ924608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924610_HBSP_P-B Product feature CHAIN GQ924610_HBSP_P-B of FT:mat_peptide GQ924610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924611_HBSP_P-B Product feature CHAIN GQ924611_HBSP_P-B of FT:mat_peptide GQ924611_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924617_HBSP_P-B Product feature CHAIN GQ924617_HBSP_P-B of FT:mat_peptide GQ924617_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDHQPPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924621_HBSP_P-B Product feature CHAIN GQ924621_HBSP_P-B of FT:mat_peptide GQ924621_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924624_HBSP_P-B Product feature CHAIN GQ924624_HBSP_P-B of FT:mat_peptide GQ924624_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPLFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924625_HBSP_P-B Product feature CHAIN GQ924625_HBSP_P-B of FT:mat_peptide GQ924625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924626_HBSP_P-B Product feature CHAIN GQ924626_HBSP_P-B of FT:mat_peptide GQ924626_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPEHAEHARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924627_HBSP_P-B Product feature CHAIN GQ924627_HBSP_P-B of FT:mat_peptide GQ924627_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924628_HBSP_P-B Product feature CHAIN GQ924628_HBSP_P-B of FT:mat_peptide GQ924628_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924630_HBSP_P-B Product feature CHAIN GQ924630_HBSP_P-B of FT:mat_peptide GQ924630_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924631_HBSP_P-B Product feature CHAIN GQ924631_HBSP_P-B of FT:mat_peptide GQ924631_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924632_HBSP_P-B Product feature CHAIN GQ924632_HBSP_P-B of FT:mat_peptide GQ924632_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924634_HBSP_P-B Product feature CHAIN GQ924634_HBSP_P-B of FT:mat_peptide GQ924634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924635_HBSP_P-B Product feature CHAIN GQ924635_HBSP_P-B of FT:mat_peptide GQ924635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDFNVGNVNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924637_HBSP_P-B Product feature CHAIN GQ924637_HBSP_P-B of FT:mat_peptide GQ924637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924638_HBSP_P-B Product feature CHAIN GQ924638_HBSP_P-B of FT:mat_peptide GQ924638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLEDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSFGSVY
>gnl|hbvpro|GQ924639_HBSP_P-B Product feature CHAIN GQ924639_HBSP_P-B of FT:mat_peptide GQ924639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSFGSVY
>gnl|hbvpro|GQ924640_HBSP_P-B Product feature CHAIN GQ924640_HBSP_P-B of FT:mat_peptide GQ924640_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924644_HBSP_P-B Product feature CHAIN GQ924644_HBSP_P-B of FT:mat_peptide GQ924644_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M79). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924645_HBSP_P-B Product feature CHAIN GQ924645_HBSP_P-B of FT:mat_peptide GQ924645_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHPPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924646_HBSP_P-B Product feature CHAIN GQ924646_HBSP_P-B of FT:mat_peptide GQ924646_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARHLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924647_HBSP_P-B Product feature CHAIN GQ924647_HBSP_P-B of FT:mat_peptide GQ924647_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924648_HBSP_P-B Product feature CHAIN GQ924648_HBSP_P-B of FT:mat_peptide GQ924648_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924651_HBSP_P-B Product feature CHAIN GQ924651_HBSP_P-B of FT:mat_peptide GQ924651_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924653_HBSP_P-B Product feature CHAIN GQ924653_HBSP_P-B of FT:mat_peptide GQ924653_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924654_HBSP_P-B Product feature CHAIN GQ924654_HBSP_P-B of FT:mat_peptide GQ924654_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924656_HBSP_P-B Product feature CHAIN GQ924656_HBSP_P-B of FT:mat_peptide GQ924656_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924660_HBSP_P-B Product feature CHAIN GQ924660_HBSP_P-B of FT:mat_peptide GQ924660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M74). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU332695_HBSP_P-B Product feature CHAIN GU332695_HBSP_P-B of FT:mat_peptide GU332695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMD74). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPEHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|GU434372_HBSP_P-B Product feature CHAIN GU434372_HBSP_P-B of FT:mat_peptide GU434372_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU434373_HBSP_P-B Product feature CHAIN GU434373_HBSP_P-B of FT:mat_peptide GU434373_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU451682_HBSP_P-B Product feature CHAIN GU451682_HBSP_P-B of FT:mat_peptide GU451682_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815548_HBSP_P-B Product feature CHAIN GU815548_HBSP_P-B of FT:mat_peptide GU815548_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815549_HBSP_P-B Product feature CHAIN GU815549_HBSP_P-B of FT:mat_peptide GU815549_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815550_HBSP_P-B Product feature CHAIN GU815550_HBSP_P-B of FT:mat_peptide GU815550_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNPGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815551_HBSP_P-B Product feature CHAIN GU815551_HBSP_P-B of FT:mat_peptide GU815551_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815552_HBSP_P-B Product feature CHAIN GU815552_HBSP_P-B of FT:mat_peptide GU815552_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815553_HBSP_P-B Product feature CHAIN GU815553_HBSP_P-B of FT:mat_peptide GU815553_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815554_HBSP_P-B Product feature CHAIN GU815554_HBSP_P-B of FT:mat_peptide GU815554_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815555_HBSP_P-B Product feature CHAIN GU815555_HBSP_P-B of FT:mat_peptide GU815555_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815556_HBSP_P-B Product feature CHAIN GU815556_HBSP_P-B of FT:mat_peptide GU815556_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815557_HBSP_P-B Product feature CHAIN GU815557_HBSP_P-B of FT:mat_peptide GU815557_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815558_HBSP_P-B Product feature CHAIN GU815558_HBSP_P-B of FT:mat_peptide GU815558_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815559_HBSP_P-B Product feature CHAIN GU815559_HBSP_P-B of FT:mat_peptide GU815559_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815560_HBSP_P-B Product feature CHAIN GU815560_HBSP_P-B of FT:mat_peptide GU815560_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815561_HBSP_P-B Product feature CHAIN GU815561_HBSP_P-B of FT:mat_peptide GU815561_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815562_HBSP_P-B Product feature CHAIN GU815562_HBSP_P-B of FT:mat_peptide GU815562_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815563_HBSP_P-B Product feature CHAIN GU815563_HBSP_P-B of FT:mat_peptide GU815563_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815564_HBSP_P-B Product feature CHAIN GU815564_HBSP_P-B of FT:mat_peptide GU815564_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815565_HBSP_P-B Product feature CHAIN GU815565_HBSP_P-B of FT:mat_peptide GU815565_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815566_HBSP_P-B Product feature CHAIN GU815566_HBSP_P-B of FT:mat_peptide GU815566_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815567_HBSP_P-B Product feature CHAIN GU815567_HBSP_P-B of FT:mat_peptide GU815567_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815568_HBSP_P-B Product feature CHAIN GU815568_HBSP_P-B of FT:mat_peptide GU815568_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815569_HBSP_P-B Product feature CHAIN GU815569_HBSP_P-B of FT:mat_peptide GU815569_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815570_HBSP_P-B Product feature CHAIN GU815570_HBSP_P-B of FT:mat_peptide GU815570_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815571_HBSP_P-B Product feature CHAIN GU815571_HBSP_P-B of FT:mat_peptide GU815571_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GU815572_HBSP_P-B Product feature CHAIN GU815572_HBSP_P-B of FT:mat_peptide GU815572_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815573_HBSP_P-B Product feature CHAIN GU815573_HBSP_P-B of FT:mat_peptide GU815573_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNYPQQPAPDHAKPAQLLLKKPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815574_HBSP_P-B Product feature CHAIN GU815574_HBSP_P-B of FT:mat_peptide GU815574_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHARPAQLLLKEPPCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815575_HBSP_P-B Product feature CHAIN GU815575_HBSP_P-B of FT:mat_peptide GU815575_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815576_HBSP_P-B Product feature CHAIN GU815576_HBSP_P-B of FT:mat_peptide GU815576_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815577_HBSP_P-B Product feature CHAIN GU815577_HBSP_P-B of FT:mat_peptide GU815577_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHARPAQLLLKEPPCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815578_HBSP_P-B Product feature CHAIN GU815578_HBSP_P-B of FT:mat_peptide GU815578_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815579_HBSP_P-B Product feature CHAIN GU815579_HBSP_P-B of FT:mat_peptide GU815579_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815581_HBSP_P-B Product feature CHAIN GU815581_HBSP_P-B of FT:mat_peptide GU815581_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815583_HBSP_P-B Product feature CHAIN GU815583_HBSP_P-B of FT:mat_peptide GU815583_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815584_HBSP_P-B Product feature CHAIN GU815584_HBSP_P-B of FT:mat_peptide GU815584_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815585_HBSP_P-B Product feature CHAIN GU815585_HBSP_P-B of FT:mat_peptide GU815585_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815586_HBSP_P-B Product feature CHAIN GU815586_HBSP_P-B of FT:mat_peptide GU815586_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815587_HBSP_P-B Product feature CHAIN GU815587_HBSP_P-B of FT:mat_peptide GU815587_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815588_HBSP_P-B Product feature CHAIN GU815588_HBSP_P-B of FT:mat_peptide GU815588_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815589_HBSP_P-B Product feature CHAIN GU815589_HBSP_P-B of FT:mat_peptide GU815589_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815590_HBSP_P-B Product feature CHAIN GU815590_HBSP_P-B of FT:mat_peptide GU815590_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815591_HBSP_P-B Product feature CHAIN GU815591_HBSP_P-B of FT:mat_peptide GU815591_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815593_HBSP_P-B Product feature CHAIN GU815593_HBSP_P-B of FT:mat_peptide GU815593_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815594_HBSP_P-B Product feature CHAIN GU815594_HBSP_P-B of FT:mat_peptide GU815594_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815595_HBSP_P-B Product feature CHAIN GU815595_HBSP_P-B of FT:mat_peptide GU815595_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815596_HBSP_P-B Product feature CHAIN GU815596_HBSP_P-B of FT:mat_peptide GU815596_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815597_HBSP_P-B Product feature CHAIN GU815597_HBSP_P-B of FT:mat_peptide GU815597_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815598_HBSP_P-B Product feature CHAIN GU815598_HBSP_P-B of FT:mat_peptide GU815598_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815599_HBSP_P-B Product feature CHAIN GU815599_HBSP_P-B of FT:mat_peptide GU815599_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815600_HBSP_P-B Product feature CHAIN GU815600_HBSP_P-B of FT:mat_peptide GU815600_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815601_HBSP_P-B Product feature CHAIN GU815601_HBSP_P-B of FT:mat_peptide GU815601_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815602_HBSP_P-B Product feature CHAIN GU815602_HBSP_P-B of FT:mat_peptide GU815602_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815603_HBSP_P-B Product feature CHAIN GU815603_HBSP_P-B of FT:mat_peptide GU815603_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815604_HBSP_P-B Product feature CHAIN GU815604_HBSP_P-B of FT:mat_peptide GU815604_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815605_HBSP_P-B Product feature CHAIN GU815605_HBSP_P-B of FT:mat_peptide GU815605_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815606_HBSP_P-B Product feature CHAIN GU815606_HBSP_P-B of FT:mat_peptide GU815606_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815607_HBSP_P-B Product feature CHAIN GU815607_HBSP_P-B of FT:mat_peptide GU815607_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815608_HBSP_P-B Product feature CHAIN GU815608_HBSP_P-B of FT:mat_peptide GU815608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815609_HBSP_P-B Product feature CHAIN GU815609_HBSP_P-B of FT:mat_peptide GU815609_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815610_HBSP_P-B Product feature CHAIN GU815610_HBSP_P-B of FT:mat_peptide GU815610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815611_HBSP_P-B Product feature CHAIN GU815611_HBSP_P-B of FT:mat_peptide GU815611_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815612_HBSP_P-B Product feature CHAIN GU815612_HBSP_P-B of FT:mat_peptide GU815612_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815613_HBSP_P-B Product feature CHAIN GU815613_HBSP_P-B of FT:mat_peptide GU815613_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815614_HBSP_P-B Product feature CHAIN GU815614_HBSP_P-B of FT:mat_peptide GU815614_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815616_HBSP_P-B Product feature CHAIN GU815616_HBSP_P-B of FT:mat_peptide GU815616_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815617_HBSP_P-B Product feature CHAIN GU815617_HBSP_P-B of FT:mat_peptide GU815617_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815618_HBSP_P-B Product feature CHAIN GU815618_HBSP_P-B of FT:mat_peptide GU815618_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815619_HBSP_P-B Product feature CHAIN GU815619_HBSP_P-B of FT:mat_peptide GU815619_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815620_HBSP_P-B Product feature CHAIN GU815620_HBSP_P-B of FT:mat_peptide GU815620_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815621_HBSP_P-B Product feature CHAIN GU815621_HBSP_P-B of FT:mat_peptide GU815621_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815622_HBSP_P-B Product feature CHAIN GU815622_HBSP_P-B of FT:mat_peptide GU815622_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815623_HBSP_P-B Product feature CHAIN GU815623_HBSP_P-B of FT:mat_peptide GU815623_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815624_HBSP_P-B Product feature CHAIN GU815624_HBSP_P-B of FT:mat_peptide GU815624_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815625_HBSP_P-B Product feature CHAIN GU815625_HBSP_P-B of FT:mat_peptide GU815625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815626_HBSP_P-B Product feature CHAIN GU815626_HBSP_P-B of FT:mat_peptide GU815626_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815627_HBSP_P-B Product feature CHAIN GU815627_HBSP_P-B of FT:mat_peptide GU815627_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815628_HBSP_P-B Product feature CHAIN GU815628_HBSP_P-B of FT:mat_peptide GU815628_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815629_HBSP_P-B Product feature CHAIN GU815629_HBSP_P-B of FT:mat_peptide GU815629_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815630_HBSP_P-B Product feature CHAIN GU815630_HBSP_P-B of FT:mat_peptide GU815630_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815631_HBSP_P-B Product feature CHAIN GU815631_HBSP_P-B of FT:mat_peptide GU815631_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815632_HBSP_P-B Product feature CHAIN GU815632_HBSP_P-B of FT:mat_peptide GU815632_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815633_HBSP_P-B Product feature CHAIN GU815633_HBSP_P-B of FT:mat_peptide GU815633_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815634_HBSP_P-B Product feature CHAIN GU815634_HBSP_P-B of FT:mat_peptide GU815634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-10). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815635_HBSP_P-B Product feature CHAIN GU815635_HBSP_P-B of FT:mat_peptide GU815635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815636_HBSP_P-B Product feature CHAIN GU815636_HBSP_P-B of FT:mat_peptide GU815636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815637_HBSP_P-B Product feature CHAIN GU815637_HBSP_P-B of FT:mat_peptide GU815637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815638_HBSP_P-B Product feature CHAIN GU815638_HBSP_P-B of FT:mat_peptide GU815638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815639_HBSP_P-B Product feature CHAIN GU815639_HBSP_P-B of FT:mat_peptide GU815639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815640_HBSP_P-B Product feature CHAIN GU815640_HBSP_P-B of FT:mat_peptide GU815640_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815641_HBSP_P-B Product feature CHAIN GU815641_HBSP_P-B of FT:mat_peptide GU815641_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815642_HBSP_P-B Product feature CHAIN GU815642_HBSP_P-B of FT:mat_peptide GU815642_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815643_HBSP_P-B Product feature CHAIN GU815643_HBSP_P-B of FT:mat_peptide GU815643_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815644_HBSP_P-B Product feature CHAIN GU815644_HBSP_P-B of FT:mat_peptide GU815644_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815645_HBSP_P-B Product feature CHAIN GU815645_HBSP_P-B of FT:mat_peptide GU815645_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815646_HBSP_P-B Product feature CHAIN GU815646_HBSP_P-B of FT:mat_peptide GU815646_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815647_HBSP_P-B Product feature CHAIN GU815647_HBSP_P-B of FT:mat_peptide GU815647_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815648_HBSP_P-B Product feature CHAIN GU815648_HBSP_P-B of FT:mat_peptide GU815648_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815649_HBSP_P-B Product feature CHAIN GU815649_HBSP_P-B of FT:mat_peptide GU815649_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815650_HBSP_P-B Product feature CHAIN GU815650_HBSP_P-B of FT:mat_peptide GU815650_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815651_HBSP_P-B Product feature CHAIN GU815651_HBSP_P-B of FT:mat_peptide GU815651_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815652_HBSP_P-B Product feature CHAIN GU815652_HBSP_P-B of FT:mat_peptide GU815652_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815653_HBSP_P-B Product feature CHAIN GU815653_HBSP_P-B of FT:mat_peptide GU815653_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815654_HBSP_P-B Product feature CHAIN GU815654_HBSP_P-B of FT:mat_peptide GU815654_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815656_HBSP_P-B Product feature CHAIN GU815656_HBSP_P-B of FT:mat_peptide GU815656_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815657_HBSP_P-B Product feature CHAIN GU815657_HBSP_P-B of FT:mat_peptide GU815657_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815658_HBSP_P-B Product feature CHAIN GU815658_HBSP_P-B of FT:mat_peptide GU815658_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815659_HBSP_P-B Product feature CHAIN GU815659_HBSP_P-B of FT:mat_peptide GU815659_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815660_HBSP_P-B Product feature CHAIN GU815660_HBSP_P-B of FT:mat_peptide GU815660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815661_HBSP_P-B Product feature CHAIN GU815661_HBSP_P-B of FT:mat_peptide GU815661_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815662_HBSP_P-B Product feature CHAIN GU815662_HBSP_P-B of FT:mat_peptide GU815662_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815663_HBSP_P-B Product feature CHAIN GU815663_HBSP_P-B of FT:mat_peptide GU815663_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815664_HBSP_P-B Product feature CHAIN GU815664_HBSP_P-B of FT:mat_peptide GU815664_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815665_HBSP_P-B Product feature CHAIN GU815665_HBSP_P-B of FT:mat_peptide GU815665_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815666_HBSP_P-B Product feature CHAIN GU815666_HBSP_P-B of FT:mat_peptide GU815666_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815667_HBSP_P-B Product feature CHAIN GU815667_HBSP_P-B of FT:mat_peptide GU815667_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815668_HBSP_P-B Product feature CHAIN GU815668_HBSP_P-B of FT:mat_peptide GU815668_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815669_HBSP_P-B Product feature CHAIN GU815669_HBSP_P-B of FT:mat_peptide GU815669_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815670_HBSP_P-B Product feature CHAIN GU815670_HBSP_P-B of FT:mat_peptide GU815670_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815672_HBSP_P-B Product feature CHAIN GU815672_HBSP_P-B of FT:mat_peptide GU815672_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815673_HBSP_P-B Product feature CHAIN GU815673_HBSP_P-B of FT:mat_peptide GU815673_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLGEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815674_HBSP_P-B Product feature CHAIN GU815674_HBSP_P-B of FT:mat_peptide GU815674_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815675_HBSP_P-B Product feature CHAIN GU815675_HBSP_P-B of FT:mat_peptide GU815675_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815676_HBSP_P-B Product feature CHAIN GU815676_HBSP_P-B of FT:mat_peptide GU815676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815677_HBSP_P-B Product feature CHAIN GU815677_HBSP_P-B of FT:mat_peptide GU815677_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815678_HBSP_P-B Product feature CHAIN GU815678_HBSP_P-B of FT:mat_peptide GU815678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815679_HBSP_P-B Product feature CHAIN GU815679_HBSP_P-B of FT:mat_peptide GU815679_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815680_HBSP_P-B Product feature CHAIN GU815680_HBSP_P-B of FT:mat_peptide GU815680_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815681_HBSP_P-B Product feature CHAIN GU815681_HBSP_P-B of FT:mat_peptide GU815681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815683_HBSP_P-B Product feature CHAIN GU815683_HBSP_P-B of FT:mat_peptide GU815683_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815684_HBSP_P-B Product feature CHAIN GU815684_HBSP_P-B of FT:mat_peptide GU815684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815685_HBSP_P-B Product feature CHAIN GU815685_HBSP_P-B of FT:mat_peptide GU815685_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815686_HBSP_P-B Product feature CHAIN GU815686_HBSP_P-B of FT:mat_peptide GU815686_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815687_HBSP_P-B Product feature CHAIN GU815687_HBSP_P-B of FT:mat_peptide GU815687_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815688_HBSP_P-B Product feature CHAIN GU815688_HBSP_P-B of FT:mat_peptide GU815688_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815689_HBSP_P-B Product feature CHAIN GU815689_HBSP_P-B of FT:mat_peptide GU815689_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815691_HBSP_P-B Product feature CHAIN GU815691_HBSP_P-B of FT:mat_peptide GU815691_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815692_HBSP_P-B Product feature CHAIN GU815692_HBSP_P-B of FT:mat_peptide GU815692_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815693_HBSP_P-B Product feature CHAIN GU815693_HBSP_P-B of FT:mat_peptide GU815693_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815694_HBSP_P-B Product feature CHAIN GU815694_HBSP_P-B of FT:mat_peptide GU815694_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815695_HBSP_P-B Product feature CHAIN GU815695_HBSP_P-B of FT:mat_peptide GU815695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815696_HBSP_P-B Product feature CHAIN GU815696_HBSP_P-B of FT:mat_peptide GU815696_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815697_HBSP_P-B Product feature CHAIN GU815697_HBSP_P-B of FT:mat_peptide GU815697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815698_HBSP_P-B Product feature CHAIN GU815698_HBSP_P-B of FT:mat_peptide GU815698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815699_HBSP_P-B Product feature CHAIN GU815699_HBSP_P-B of FT:mat_peptide GU815699_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815700_HBSP_P-B Product feature CHAIN GU815700_HBSP_P-B of FT:mat_peptide GU815700_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815701_HBSP_P-B Product feature CHAIN GU815701_HBSP_P-B of FT:mat_peptide GU815701_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815702_HBSP_P-B Product feature CHAIN GU815702_HBSP_P-B of FT:mat_peptide GU815702_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815703_HBSP_P-B Product feature CHAIN GU815703_HBSP_P-B of FT:mat_peptide GU815703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815704_HBSP_P-B Product feature CHAIN GU815704_HBSP_P-B of FT:mat_peptide GU815704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815705_HBSP_P-B Product feature CHAIN GU815705_HBSP_P-B of FT:mat_peptide GU815705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815706_HBSP_P-B Product feature CHAIN GU815706_HBSP_P-B of FT:mat_peptide GU815706_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815707_HBSP_P-B Product feature CHAIN GU815707_HBSP_P-B of FT:mat_peptide GU815707_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815708_HBSP_P-B Product feature CHAIN GU815708_HBSP_P-B of FT:mat_peptide GU815708_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815709_HBSP_P-B Product feature CHAIN GU815709_HBSP_P-B of FT:mat_peptide GU815709_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815710_HBSP_P-B Product feature CHAIN GU815710_HBSP_P-B of FT:mat_peptide GU815710_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815711_HBSP_P-B Product feature CHAIN GU815711_HBSP_P-B of FT:mat_peptide GU815711_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815712_HBSP_P-B Product feature CHAIN GU815712_HBSP_P-B of FT:mat_peptide GU815712_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
IPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815713_HBSP_P-B Product feature CHAIN GU815713_HBSP_P-B of FT:mat_peptide GU815713_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815715_HBSP_P-B Product feature CHAIN GU815715_HBSP_P-B of FT:mat_peptide GU815715_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815716_HBSP_P-B Product feature CHAIN GU815716_HBSP_P-B of FT:mat_peptide GU815716_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815717_HBSP_P-B Product feature CHAIN GU815717_HBSP_P-B of FT:mat_peptide GU815717_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815718_HBSP_P-B Product feature CHAIN GU815718_HBSP_P-B of FT:mat_peptide GU815718_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815719_HBSP_P-B Product feature CHAIN GU815719_HBSP_P-B of FT:mat_peptide GU815719_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815720_HBSP_P-B Product feature CHAIN GU815720_HBSP_P-B of FT:mat_peptide GU815720_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815721_HBSP_P-B Product feature CHAIN GU815721_HBSP_P-B of FT:mat_peptide GU815721_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815722_HBSP_P-B Product feature CHAIN GU815722_HBSP_P-B of FT:mat_peptide GU815722_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815723_HBSP_P-B Product feature CHAIN GU815723_HBSP_P-B of FT:mat_peptide GU815723_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNNHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815724_HBSP_P-B Product feature CHAIN GU815724_HBSP_P-B of FT:mat_peptide GU815724_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815725_HBSP_P-B Product feature CHAIN GU815725_HBSP_P-B of FT:mat_peptide GU815725_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815726_HBSP_P-B Product feature CHAIN GU815726_HBSP_P-B of FT:mat_peptide GU815726_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815727_HBSP_P-B Product feature CHAIN GU815727_HBSP_P-B of FT:mat_peptide GU815727_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGNGPQSVSLGSVY
>gnl|hbvpro|GU815728_HBSP_P-B Product feature CHAIN GU815728_HBSP_P-B of FT:mat_peptide GU815728_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815729_HBSP_P-B Product feature CHAIN GU815729_HBSP_P-B of FT:mat_peptide GU815729_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815730_HBSP_P-B Product feature CHAIN GU815730_HBSP_P-B of FT:mat_peptide GU815730_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815731_HBSP_P-B Product feature CHAIN GU815731_HBSP_P-B of FT:mat_peptide GU815731_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815732_HBSP_P-B Product feature CHAIN GU815732_HBSP_P-B of FT:mat_peptide GU815732_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815733_HBSP_P-B Product feature CHAIN GU815733_HBSP_P-B of FT:mat_peptide GU815733_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815734_HBSP_P-B Product feature CHAIN GU815734_HBSP_P-B of FT:mat_peptide GU815734_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815735_HBSP_P-B Product feature CHAIN GU815735_HBSP_P-B of FT:mat_peptide GU815735_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815736_HBSP_P-B Product feature CHAIN GU815736_HBSP_P-B of FT:mat_peptide GU815736_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815737_HBSP_P-B Product feature CHAIN GU815737_HBSP_P-B of FT:mat_peptide GU815737_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815738_HBSP_P-B Product feature CHAIN GU815738_HBSP_P-B of FT:mat_peptide GU815738_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815739_HBSP_P-B Product feature CHAIN GU815739_HBSP_P-B of FT:mat_peptide GU815739_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815740_HBSP_P-B Product feature CHAIN GU815740_HBSP_P-B of FT:mat_peptide GU815740_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815741_HBSP_P-B Product feature CHAIN GU815741_HBSP_P-B of FT:mat_peptide GU815741_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLRLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815742_HBSP_P-B Product feature CHAIN GU815742_HBSP_P-B of FT:mat_peptide GU815742_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815744_HBSP_P-B Product feature CHAIN GU815744_HBSP_P-B of FT:mat_peptide GU815744_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815745_HBSP_P-B Product feature CHAIN GU815745_HBSP_P-B of FT:mat_peptide GU815745_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815746_HBSP_P-B Product feature CHAIN GU815746_HBSP_P-B of FT:mat_peptide GU815746_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815747_HBSP_P-B Product feature CHAIN GU815747_HBSP_P-B of FT:mat_peptide GU815747_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815748_HBSP_P-B Product feature CHAIN GU815748_HBSP_P-B of FT:mat_peptide GU815748_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815749_HBSP_P-B Product feature CHAIN GU815749_HBSP_P-B of FT:mat_peptide GU815749_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815750_HBSP_P-B Product feature CHAIN GU815750_HBSP_P-B of FT:mat_peptide GU815750_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815751_HBSP_P-B Product feature CHAIN GU815751_HBSP_P-B of FT:mat_peptide GU815751_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815752_HBSP_P-B Product feature CHAIN GU815752_HBSP_P-B of FT:mat_peptide GU815752_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815753_HBSP_P-B Product feature CHAIN GU815753_HBSP_P-B of FT:mat_peptide GU815753_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815754_HBSP_P-B Product feature CHAIN GU815754_HBSP_P-B of FT:mat_peptide GU815754_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815755_HBSP_P-B Product feature CHAIN GU815755_HBSP_P-B of FT:mat_peptide GU815755_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815756_HBSP_P-B Product feature CHAIN GU815756_HBSP_P-B of FT:mat_peptide GU815756_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|GU815757_HBSP_P-B Product feature CHAIN GU815757_HBSP_P-B of FT:mat_peptide GU815757_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815759_HBSP_P-B Product feature CHAIN GU815759_HBSP_P-B of FT:mat_peptide GU815759_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815760_HBSP_P-B Product feature CHAIN GU815760_HBSP_P-B of FT:mat_peptide GU815760_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFLHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815761_HBSP_P-B Product feature CHAIN GU815761_HBSP_P-B of FT:mat_peptide GU815761_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815762_HBSP_P-B Product feature CHAIN GU815762_HBSP_P-B of FT:mat_peptide GU815762_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815764_HBSP_P-B Product feature CHAIN GU815764_HBSP_P-B of FT:mat_peptide GU815764_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815765_HBSP_P-B Product feature CHAIN GU815765_HBSP_P-B of FT:mat_peptide GU815765_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815766_HBSP_P-B Product feature CHAIN GU815766_HBSP_P-B of FT:mat_peptide GU815766_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815767_HBSP_P-B Product feature CHAIN GU815767_HBSP_P-B of FT:mat_peptide GU815767_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815768_HBSP_P-B Product feature CHAIN GU815768_HBSP_P-B of FT:mat_peptide GU815768_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815769_HBSP_P-B Product feature CHAIN GU815769_HBSP_P-B of FT:mat_peptide GU815769_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815770_HBSP_P-B Product feature CHAIN GU815770_HBSP_P-B of FT:mat_peptide GU815770_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815771_HBSP_P-B Product feature CHAIN GU815771_HBSP_P-B of FT:mat_peptide GU815771_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815772_HBSP_P-B Product feature CHAIN GU815772_HBSP_P-B of FT:mat_peptide GU815772_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGSQSVSLGSVY
>gnl|hbvpro|GU815773_HBSP_P-B Product feature CHAIN GU815773_HBSP_P-B of FT:mat_peptide GU815773_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815774_HBSP_P-B Product feature CHAIN GU815774_HBSP_P-B of FT:mat_peptide GU815774_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815775_HBSP_P-B Product feature CHAIN GU815775_HBSP_P-B of FT:mat_peptide GU815775_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815776_HBSP_P-B Product feature CHAIN GU815776_HBSP_P-B of FT:mat_peptide GU815776_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815777_HBSP_P-B Product feature CHAIN GU815777_HBSP_P-B of FT:mat_peptide GU815777_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815778_HBSP_P-B Product feature CHAIN GU815778_HBSP_P-B of FT:mat_peptide GU815778_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815779_HBSP_P-B Product feature CHAIN GU815779_HBSP_P-B of FT:mat_peptide GU815779_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815780_HBSP_P-B Product feature CHAIN GU815780_HBSP_P-B of FT:mat_peptide GU815780_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815781_HBSP_P-B Product feature CHAIN GU815781_HBSP_P-B of FT:mat_peptide GU815781_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815782_HBSP_P-B Product feature CHAIN GU815782_HBSP_P-B of FT:mat_peptide GU815782_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815783_HBSP_P-B Product feature CHAIN GU815783_HBSP_P-B of FT:mat_peptide GU815783_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011466_HBSP_P-B Product feature CHAIN HM011466_HBSP_P-B of FT:mat_peptide HM011466_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQQARDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011467_HBSP_P-B Product feature CHAIN HM011467_HBSP_P-B of FT:mat_peptide HM011467_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=110 residues).
MPLSYQHFRKLLLLEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTE
TAPVFPSHHLGXSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|HM011469_HBSP_P-B Product feature CHAIN HM011469_HBSP_P-B of FT:mat_peptide HM011469_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011470_HBSP_P-B Product feature CHAIN HM011470_HBSP_P-B of FT:mat_peptide HM011470_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011471_HBSP_P-B Product feature CHAIN HM011471_HBSP_P-B of FT:mat_peptide HM011471_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAPLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011473_HBSP_P-B Product feature CHAIN HM011473_HBSP_P-B of FT:mat_peptide HM011473_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011474_HBSP_P-B Product feature CHAIN HM011474_HBSP_P-B of FT:mat_peptide HM011474_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAXDLXLGNXNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011475_HBSP_P-B Product feature CHAIN HM011475_HBSP_P-B of FT:mat_peptide HM011475_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKXLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011476_HBSP_P-B Product feature CHAIN HM011476_HBSP_P-B of FT:mat_peptide HM011476_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKXARLLLKEPLCFPHVAVQNLRT
EXAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011478_HBSP_P-B Product feature CHAIN HM011478_HBSP_P-B of FT:mat_peptide HM011478_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAXDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHXLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011480_HBSP_P-B Product feature CHAIN HM011480_HBSP_P-B of FT:mat_peptide HM011480_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011482_HBSP_P-B Product feature CHAIN HM011482_HBSP_P-B of FT:mat_peptide HM011482_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011483_HBSP_P-B Product feature CHAIN HM011483_HBSP_P-B of FT:mat_peptide HM011483_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011484_HBSP_P-B Product feature CHAIN HM011484_HBSP_P-B of FT:mat_peptide HM011484_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011487_HBSP_P-B Product feature CHAIN HM011487_HBSP_P-B of FT:mat_peptide HM011487_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDAAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLXETLRFPHVAVQNLRT
QTAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011490_HBSP_P-B Product feature CHAIN HM011490_HBSP_P-B of FT:mat_peptide HM011490_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011492_HBSP_P-B Product feature CHAIN HM011492_HBSP_P-B of FT:mat_peptide HM011492_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011494_HBSP_P-B Product feature CHAIN HM011494_HBSP_P-B of FT:mat_peptide HM011494_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAXPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011496_HBSP_P-B Product feature CHAIN HM011496_HBSP_P-B of FT:mat_peptide HM011496_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQPPAXDHAEPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011499_HBSP_P-B Product feature CHAIN HM011499_HBSP_P-B of FT:mat_peptide HM011499_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDBEAGPLEEELPRLADEGLNRRVAEDLNLGBPXDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011503_HBSP_P-B Product feature CHAIN HM011503_HBSP_P-B of FT:mat_peptide HM011503_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLXLDEGAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQXPAXDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011504_HBSP_P-B Product feature CHAIN HM011504_HBSP_P-B of FT:mat_peptide HM011504_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLVLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|HQ700546_HBSP_P-B Product feature CHAIN HQ700546_HBSP_P-B of FT:mat_peptide HQ700546_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HQ700548_HBSP_P-B Product feature CHAIN HQ700548_HBSP_P-B of FT:mat_peptide HQ700548_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|HQ700549_HBSP_P-B Product feature CHAIN HQ700549_HBSP_P-B of FT:mat_peptide HQ700549_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF412801_HBSP_P-B Product feature CHAIN JF412801_HBSP_P-B of FT:mat_peptide JF412801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF899335_HBSP_P-B Product feature CHAIN JF899335_HBSP_P-B of FT:mat_peptide JF899335_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN406371_HBSP_P-B Product feature CHAIN JN406371_HBSP_P-B of FT:mat_peptide JN406371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792893_HBSP_P-B Product feature CHAIN JN792893_HBSP_P-B of FT:mat_peptide JN792893_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2004). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQPPAPDHAKLARLLLKEPLCFPHVVVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792894_HBSP_P-B Product feature CHAIN JN792894_HBSP_P-B of FT:mat_peptide JN792894_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARLARLLLKEPLCFPHVVVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792895_HBSP_P-B Product feature CHAIN JN792895_HBSP_P-B of FT:mat_peptide JN792895_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792896_HBSP_P-B Product feature CHAIN JN792896_HBSP_P-B of FT:mat_peptide JN792896_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792897_HBSP_P-B Product feature CHAIN JN792897_HBSP_P-B of FT:mat_peptide JN792897_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792898_HBSP_P-B Product feature CHAIN JN792898_HBSP_P-B of FT:mat_peptide JN792898_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792899_HBSP_P-B Product feature CHAIN JN792899_HBSP_P-B of FT:mat_peptide JN792899_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792900_HBSP_P-B Product feature CHAIN JN792900_HBSP_P-B of FT:mat_peptide JN792900_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792901_HBSP_P-B Product feature CHAIN JN792901_HBSP_P-B of FT:mat_peptide JN792901_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNDHQPPAPDHARPARLLLKTALRFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JN792902_HBSP_P-B Product feature CHAIN JN792902_HBSP_P-B of FT:mat_peptide JN792902_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNDHQPPAPXHARPARLLLKATLRFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JN827419_HBSP_P-B Product feature CHAIN JN827419_HBSP_P-B of FT:mat_peptide JN827419_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPAQLLLKGPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ027311_HBSP_P-B Product feature CHAIN JQ027311_HBSP_P-B of FT:mat_peptide JQ027311_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEXGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027312_HBSP_P-B Product feature CHAIN JQ027312_HBSP_P-B of FT:mat_peptide JQ027312_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAXPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027313_HBSP_P-B Product feature CHAIN JQ027313_HBSP_P-B of FT:mat_peptide JQ027313_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADDDLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLXFPHVAVQNLRT
ETAPVFPSHXLGLXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027315_HBSP_P-B Product feature CHAIN JQ027315_HBSP_P-B of FT:mat_peptide JQ027315_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027316_HBSP_P-B Product feature CHAIN JQ027316_HBSP_P-B of FT:mat_peptide JQ027316_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027325_HBSP_P-B Product feature CHAIN JQ027325_HBSP_P-B of FT:mat_peptide JQ027325_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLTEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027329_HBSP_P-B Product feature CHAIN JQ027329_HBSP_P-B of FT:mat_peptide JQ027329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQQPAPDHAKPAQLLLXXPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027330_HBSP_P-B Product feature CHAIN JQ027330_HBSP_P-B of FT:mat_peptide JQ027330_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKATLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027331_HBSP_P-B Product feature CHAIN JQ027331_HBSP_P-B of FT:mat_peptide JQ027331_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKATLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027334_HBSP_P-B Product feature CHAIN JQ027334_HBSP_P-B of FT:mat_peptide JQ027334_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040125_HBSP_P-B Product feature CHAIN JQ040125_HBSP_P-B of FT:mat_peptide JQ040125_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRIAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040128_HBSP_P-B Product feature CHAIN JQ040128_HBSP_P-B of FT:mat_peptide JQ040128_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040138_HBSP_P-B Product feature CHAIN JQ040138_HBSP_P-B of FT:mat_peptide JQ040138_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040147_HBSP_P-B Product feature CHAIN JQ040147_HBSP_P-B of FT:mat_peptide JQ040147_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040157_HBSP_P-B Product feature CHAIN JQ040157_HBSP_P-B of FT:mat_peptide JQ040157_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNXHQLPARDHARPARFLLKAPLCFXHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040169_HBSP_P-B Product feature CHAIN JQ040169_HBSP_P-B of FT:mat_peptide JQ040169_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G237). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040170_HBSP_P-B Product feature CHAIN JQ040170_HBSP_P-B of FT:mat_peptide JQ040170_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQXTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040171_HBSP_P-B Product feature CHAIN JQ040171_HBSP_P-B of FT:mat_peptide JQ040171_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040173_HBSP_P-B Product feature CHAIN JQ040173_HBSP_P-B of FT:mat_peptide JQ040173_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341549_HBSP_P-B Product feature CHAIN JQ341549_HBSP_P-B of FT:mat_peptide JQ341549_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341550_HBSP_P-B Product feature CHAIN JQ341550_HBSP_P-B of FT:mat_peptide JQ341550_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341551_HBSP_P-B Product feature CHAIN JQ341551_HBSP_P-B of FT:mat_peptide JQ341551_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEXLXFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGXGPQSVSLGSVY
>gnl|hbvpro|JQ341552_HBSP_P-B Product feature CHAIN JQ341552_HBSP_P-B of FT:mat_peptide JQ341552_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHAAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341553_HBSP_P-B Product feature CHAIN JQ341553_HBSP_P-B of FT:mat_peptide JQ341553_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLXFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341554_HBSP_P-B Product feature CHAIN JQ341554_HBSP_P-B of FT:mat_peptide JQ341554_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLXLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341555_HBSP_P-B Product feature CHAIN JQ341555_HBSP_P-B of FT:mat_peptide JQ341555_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341556_HBSP_P-B Product feature CHAIN JQ341556_HBSP_P-B of FT:mat_peptide JQ341556_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQXPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341557_HBSP_P-B Product feature CHAIN JQ341557_HBSP_P-B of FT:mat_peptide JQ341557_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno09). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPXHAXPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341558_HBSP_P-B Product feature CHAIN JQ341558_HBSP_P-B of FT:mat_peptide JQ341558_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341559_HBSP_P-B Product feature CHAIN JQ341559_HBSP_P-B of FT:mat_peptide JQ341559_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAXPAQLLLKEPLCFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341560_HBSP_P-B Product feature CHAIN JQ341560_HBSP_P-B of FT:mat_peptide JQ341560_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341561_HBSP_P-B Product feature CHAIN JQ341561_HBSP_P-B of FT:mat_peptide JQ341561_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno13). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQQPARDHAKPARLLLXXPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341562_HBSP_P-B Product feature CHAIN JQ341562_HBSP_P-B of FT:mat_peptide JQ341562_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQYFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341563_HBSP_P-B Product feature CHAIN JQ341563_HBSP_P-B of FT:mat_peptide JQ341563_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341564_HBSP_P-B Product feature CHAIN JQ341564_HBSP_P-B of FT:mat_peptide JQ341564_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341565_HBSP_P-B Product feature CHAIN JQ341565_HBSP_P-B of FT:mat_peptide JQ341565_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341566_HBSP_P-B Product feature CHAIN JQ341566_HBSP_P-B of FT:mat_peptide JQ341566_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341567_HBSP_P-B Product feature CHAIN JQ341567_HBSP_P-B of FT:mat_peptide JQ341567_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341568_HBSP_P-B Product feature CHAIN JQ341568_HBSP_P-B of FT:mat_peptide JQ341568_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341569_HBSP_P-B Product feature CHAIN JQ341569_HBSP_P-B of FT:mat_peptide JQ341569_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341570_HBSP_P-B Product feature CHAIN JQ341570_HBSP_P-B of FT:mat_peptide JQ341570_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341571_HBSP_P-B Product feature CHAIN JQ341571_HBSP_P-B of FT:mat_peptide JQ341571_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYXHFRKLLLLEDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341572_HBSP_P-B Product feature CHAIN JQ341572_HBSP_P-B of FT:mat_peptide JQ341572_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341573_HBSP_P-B Product feature CHAIN JQ341573_HBSP_P-B of FT:mat_peptide JQ341573_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341574_HBSP_P-B Product feature CHAIN JQ341574_HBSP_P-B of FT:mat_peptide JQ341574_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341575_HBSP_P-B Product feature CHAIN JQ341575_HBSP_P-B of FT:mat_peptide JQ341575_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341576_HBSP_P-B Product feature CHAIN JQ341576_HBSP_P-B of FT:mat_peptide JQ341576_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341577_HBSP_P-B Product feature CHAIN JQ341577_HBSP_P-B of FT:mat_peptide JQ341577_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341578_HBSP_P-B Product feature CHAIN JQ341578_HBSP_P-B of FT:mat_peptide JQ341578_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKLAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341579_HBSP_P-B Product feature CHAIN JQ341579_HBSP_P-B of FT:mat_peptide JQ341579_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341580_HBSP_P-B Product feature CHAIN JQ341580_HBSP_P-B of FT:mat_peptide JQ341580_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341581_HBSP_P-B Product feature CHAIN JQ341581_HBSP_P-B of FT:mat_peptide JQ341581_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341582_HBSP_P-B Product feature CHAIN JQ341582_HBSP_P-B of FT:mat_peptide JQ341582_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSXGSVY
>gnl|hbvpro|JQ341583_HBSP_P-B Product feature CHAIN JQ341583_HBSP_P-B of FT:mat_peptide JQ341583_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341584_HBSP_P-B Product feature CHAIN JQ341584_HBSP_P-B of FT:mat_peptide JQ341584_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341585_HBSP_P-B Product feature CHAIN JQ341585_HBSP_P-B of FT:mat_peptide JQ341585_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno37). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQPPAPDHAEPARLLLKEPLCFPHAAVQNLRT
ETAHVFPSHHLGLSQNTYGSGPQXVSLGSVY
>gnl|hbvpro|JQ341586_HBSP_P-B Product feature CHAIN JQ341586_HBSP_P-B of FT:mat_peptide JQ341586_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341587_HBSP_P-B Product feature CHAIN JQ341587_HBSP_P-B of FT:mat_peptide JQ341587_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNINDHQXPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341588_HBSP_P-B Product feature CHAIN JQ341588_HBSP_P-B of FT:mat_peptide JQ341588_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEELNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341589_HBSP_P-B Product feature CHAIN JQ341589_HBSP_P-B of FT:mat_peptide JQ341589_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGDLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341590_HBSP_P-B Product feature CHAIN JQ341590_HBSP_P-B of FT:mat_peptide JQ341590_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341591_HBSP_P-B Product feature CHAIN JQ341591_HBSP_P-B of FT:mat_peptide JQ341591_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341592_HBSP_P-B Product feature CHAIN JQ341592_HBSP_P-B of FT:mat_peptide JQ341592_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno44). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLHLGNINDHQRPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341593_HBSP_P-B Product feature CHAIN JQ341593_HBSP_P-B of FT:mat_peptide JQ341593_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341594_HBSP_P-B Product feature CHAIN JQ341594_HBSP_P-B of FT:mat_peptide JQ341594_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLXXEAGPLEEELPRLADEGLNRRVAEDLXLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVVVQNLRT
ETAPVFPSXHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341595_HBSP_P-B Product feature CHAIN JQ341595_HBSP_P-B of FT:mat_peptide JQ341595_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAXDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAXVFPSHHLGLXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341596_HBSP_P-B Product feature CHAIN JQ341596_HBSP_P-B of FT:mat_peptide JQ341596_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341597_HBSP_P-B Product feature CHAIN JQ341597_HBSP_P-B of FT:mat_peptide JQ341597_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341598_HBSP_P-B Product feature CHAIN JQ341598_HBSP_P-B of FT:mat_peptide JQ341598_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341599_HBSP_P-B Product feature CHAIN JQ341599_HBSP_P-B of FT:mat_peptide JQ341599_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341600_HBSP_P-B Product feature CHAIN JQ341600_HBSP_P-B of FT:mat_peptide JQ341600_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQCFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKDPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341601_HBSP_P-B Product feature CHAIN JQ341601_HBSP_P-B of FT:mat_peptide JQ341601_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341603_HBSP_P-B Product feature CHAIN JQ341603_HBSP_P-B of FT:mat_peptide JQ341603_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341604_HBSP_P-B Product feature CHAIN JQ341604_HBSP_P-B of FT:mat_peptide JQ341604_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341605_HBSP_P-B Product feature CHAIN JQ341605_HBSP_P-B of FT:mat_peptide JQ341605_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno57). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341606_HBSP_P-B Product feature CHAIN JQ341606_HBSP_P-B of FT:mat_peptide JQ341606_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno58). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQQPAPDHAKXARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341607_HBSP_P-B Product feature CHAIN JQ341607_HBSP_P-B of FT:mat_peptide JQ341607_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno59). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKGPLCFPHVAVQNLRT
ETAPVFPSHXLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341608_HBSP_P-B Product feature CHAIN JQ341608_HBSP_P-B of FT:mat_peptide JQ341608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341609_HBSP_P-B Product feature CHAIN JQ341609_HBSP_P-B of FT:mat_peptide JQ341609_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429079_HBSP_P-B Product feature CHAIN JQ429079_HBSP_P-B of FT:mat_peptide JQ429079_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08.10.002). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHANPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429080_HBSP_P-B Product feature CHAIN JQ429080_HBSP_P-B of FT:mat_peptide JQ429080_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.40.033). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQPPAPDHAKPARLLLKEPLCLPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429081_HBSP_P-B Product feature CHAIN JQ429081_HBSP_P-B of FT:mat_peptide JQ429081_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429082_HBSP_P-B Product feature CHAIN JQ429082_HBSP_P-B of FT:mat_peptide JQ429082_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.41.591). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ688405_HBSP_P-B Product feature CHAIN JQ688405_HBSP_P-B of FT:mat_peptide JQ688405_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707734_HBSP_P-B Product feature CHAIN JQ707734_HBSP_P-B of FT:mat_peptide JQ707734_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707735_HBSP_P-B Product feature CHAIN JQ707735_HBSP_P-B of FT:mat_peptide JQ707735_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707737_HBSP_P-B Product feature CHAIN JQ707737_HBSP_P-B of FT:mat_peptide JQ707737_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707738_HBSP_P-B Product feature CHAIN JQ707738_HBSP_P-B of FT:mat_peptide JQ707738_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707739_HBSP_P-B Product feature CHAIN JQ707739_HBSP_P-B of FT:mat_peptide JQ707739_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707740_HBSP_P-B Product feature CHAIN JQ707740_HBSP_P-B of FT:mat_peptide JQ707740_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNNHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGHQSVSHGSVY
>gnl|hbvpro|JQ707742_HBSP_P-B Product feature CHAIN JQ707742_HBSP_P-B of FT:mat_peptide JQ707742_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707743_HBSP_P-B Product feature CHAIN JQ707743_HBSP_P-B of FT:mat_peptide JQ707743_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707744_HBSP_P-B Product feature CHAIN JQ707744_HBSP_P-B of FT:mat_peptide JQ707744_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707745_HBSP_P-B Product feature CHAIN JQ707745_HBSP_P-B of FT:mat_peptide JQ707745_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAQDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707746_HBSP_P-B Product feature CHAIN JQ707746_HBSP_P-B of FT:mat_peptide JQ707746_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_24-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707747_HBSP_P-B Product feature CHAIN JQ707747_HBSP_P-B of FT:mat_peptide JQ707747_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARILLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707749_HBSP_P-B Product feature CHAIN JQ707749_HBSP_P-B of FT:mat_peptide JQ707749_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707750_HBSP_P-B Product feature CHAIN JQ707750_HBSP_P-B of FT:mat_peptide JQ707750_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDRQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707753_HBSP_P-B Product feature CHAIN JQ707753_HBSP_P-B of FT:mat_peptide JQ707753_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707755_HBSP_P-B Product feature CHAIN JQ707755_HBSP_P-B of FT:mat_peptide JQ707755_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707758_HBSP_P-B Product feature CHAIN JQ707758_HBSP_P-B of FT:mat_peptide JQ707758_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707759_HBSP_P-B Product feature CHAIN JQ707759_HBSP_P-B of FT:mat_peptide JQ707759_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707762_HBSP_P-B Product feature CHAIN JQ707762_HBSP_P-B of FT:mat_peptide JQ707762_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707763_HBSP_P-B Product feature CHAIN JQ707763_HBSP_P-B of FT:mat_peptide JQ707763_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707764_HBSP_P-B Product feature CHAIN JQ707764_HBSP_P-B of FT:mat_peptide JQ707764_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707765_HBSP_P-B Product feature CHAIN JQ707765_HBSP_P-B of FT:mat_peptide JQ707765_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707766_HBSP_P-B Product feature CHAIN JQ707766_HBSP_P-B of FT:mat_peptide JQ707766_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707767_HBSP_P-B Product feature CHAIN JQ707767_HBSP_P-B of FT:mat_peptide JQ707767_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801471_HBSP_P-B Product feature CHAIN JQ801471_HBSP_P-B of FT:mat_peptide JQ801471_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801474_HBSP_P-B Product feature CHAIN JQ801474_HBSP_P-B of FT:mat_peptide JQ801474_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801479_HBSP_P-B Product feature CHAIN JQ801479_HBSP_P-B of FT:mat_peptide JQ801479_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801485_HBSP_P-B Product feature CHAIN JQ801485_HBSP_P-B of FT:mat_peptide JQ801485_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801494_HBSP_P-B Product feature CHAIN JQ801494_HBSP_P-B of FT:mat_peptide JQ801494_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801506_HBSP_P-B Product feature CHAIN JQ801506_HBSP_P-B of FT:mat_peptide JQ801506_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801507_HBSP_P-B Product feature CHAIN JQ801507_HBSP_P-B of FT:mat_peptide JQ801507_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801512_HBSP_P-B Product feature CHAIN JQ801512_HBSP_P-B of FT:mat_peptide JQ801512_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801514_HBSP_P-B Product feature CHAIN JQ801514_HBSP_P-B of FT:mat_peptide JQ801514_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801516_HBSP_P-B Product feature CHAIN JQ801516_HBSP_P-B of FT:mat_peptide JQ801516_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPVPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801524_HBSP_P-B Product feature CHAIN JQ801524_HBSP_P-B of FT:mat_peptide JQ801524_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JX026879_HBSP_P-B Product feature CHAIN JX026879_HBSP_P-B of FT:mat_peptide JX026879_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
DTAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JX026881_HBSP_P-B Product feature CHAIN JX026881_HBSP_P-B of FT:mat_peptide JX026881_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVHNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX026883_HBSP_P-B Product feature CHAIN JX026883_HBSP_P-B of FT:mat_peptide JX026883_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-50). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX026886_HBSP_P-B Product feature CHAIN JX026886_HBSP_P-B of FT:mat_peptide JX026886_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-73). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPAPDPAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429897_HBSP_P-B Product feature CHAIN JX429897_HBSP_P-B of FT:mat_peptide JX429897_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429899_HBSP_P-B Product feature CHAIN JX429899_HBSP_P-B of FT:mat_peptide JX429899_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429900_HBSP_P-B Product feature CHAIN JX429900_HBSP_P-B of FT:mat_peptide JX429900_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429901_HBSP_P-B Product feature CHAIN JX429901_HBSP_P-B of FT:mat_peptide JX429901_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-33). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JX429902_HBSP_P-B Product feature CHAIN JX429902_HBSP_P-B of FT:mat_peptide JX429902_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429908_HBSP_P-B Product feature CHAIN JX429908_HBSP_P-B of FT:mat_peptide JX429908_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNFNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429910_HBSP_P-B Product feature CHAIN JX429910_HBSP_P-B of FT:mat_peptide JX429910_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGILNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429911_HBSP_P-B Product feature CHAIN JX429911_HBSP_P-B of FT:mat_peptide JX429911_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-45). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNCRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|JX504531_HBSP_P-B Product feature CHAIN JX504531_HBSP_P-B of FT:mat_peptide JX504531_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX504532_HBSP_P-B Product feature CHAIN JX504532_HBSP_P-B of FT:mat_peptide JX504532_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX504533_HBSP_P-B Product feature CHAIN JX504533_HBSP_P-B of FT:mat_peptide JX504533_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX504538_HBSP_P-B Product feature CHAIN JX504538_HBSP_P-B of FT:mat_peptide JX504538_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX504543_HBSP_P-B Product feature CHAIN JX504543_HBSP_P-B of FT:mat_peptide JX504543_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NNJ-19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX507210_HBSP_P-B Product feature CHAIN JX507210_HBSP_P-B of FT:mat_peptide JX507210_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX507213_HBSP_P-B Product feature CHAIN JX507213_HBSP_P-B of FT:mat_peptide JX507213_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPARDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JX507215_HBSP_P-B Product feature CHAIN JX507215_HBSP_P-B of FT:mat_peptide JX507215_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 310). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661470_HBSP_P-B Product feature CHAIN JX661470_HBSP_P-B of FT:mat_peptide JX661470_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1221-B12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661471_HBSP_P-B Product feature CHAIN JX661471_HBSP_P-B of FT:mat_peptide JX661471_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1202-B1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661472_HBSP_P-B Product feature CHAIN JX661472_HBSP_P-B of FT:mat_peptide JX661472_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1224-B13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661473_HBSP_P-B Product feature CHAIN JX661473_HBSP_P-B of FT:mat_peptide JX661473_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1220-B11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661474_HBSP_P-B Product feature CHAIN JX661474_HBSP_P-B of FT:mat_peptide JX661474_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1229-B15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661475_HBSP_P-B Product feature CHAIN JX661475_HBSP_P-B of FT:mat_peptide JX661475_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1216-B9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661476_HBSP_P-B Product feature CHAIN JX661476_HBSP_P-B of FT:mat_peptide JX661476_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1227-B14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661477_HBSP_P-B Product feature CHAIN JX661477_HBSP_P-B of FT:mat_peptide JX661477_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1209-B5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661478_HBSP_P-B Product feature CHAIN JX661478_HBSP_P-B of FT:mat_peptide JX661478_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1211-B7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JX661479_HBSP_P-B Product feature CHAIN JX661479_HBSP_P-B of FT:mat_peptide JX661479_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1219-B10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661480_HBSP_P-B Product feature CHAIN JX661480_HBSP_P-B of FT:mat_peptide JX661480_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1210-B6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661481_HBSP_P-B Product feature CHAIN JX661481_HBSP_P-B of FT:mat_peptide JX661481_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1214-B8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661482_HBSP_P-B Product feature CHAIN JX661482_HBSP_P-B of FT:mat_peptide JX661482_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1204-B2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661483_HBSP_P-B Product feature CHAIN JX661483_HBSP_P-B of FT:mat_peptide JX661483_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1205-B3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX661484_HBSP_P-B Product feature CHAIN JX661484_HBSP_P-B of FT:mat_peptide JX661484_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1206-B4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX869998_HBSP_P-B Product feature CHAIN JX869998_HBSP_P-B of FT:mat_peptide JX869998_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 317). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX869999_HBSP_P-B Product feature CHAIN JX869999_HBSP_P-B of FT:mat_peptide JX869999_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX870001_HBSP_P-B Product feature CHAIN JX870001_HBSP_P-B of FT:mat_peptide JX870001_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 90). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX978431_HBSP_P-B Product feature CHAIN JX978431_HBSP_P-B of FT:mat_peptide JX978431_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate X02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC492739_HBSP_P-B Product feature CHAIN KC492739_HBSP_P-B of FT:mat_peptide KC492739_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MT). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC492740_HBSP_P-B Product feature CHAIN KC492740_HBSP_P-B of FT:mat_peptide KC492740_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Del). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EAAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510641_HBSP_P-B Product feature CHAIN KC510641_HBSP_P-B of FT:mat_peptide KC510641_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510642_HBSP_P-B Product feature CHAIN KC510642_HBSP_P-B of FT:mat_peptide KC510642_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510643_HBSP_P-B Product feature CHAIN KC510643_HBSP_P-B of FT:mat_peptide KC510643_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510644_HBSP_P-B Product feature CHAIN KC510644_HBSP_P-B of FT:mat_peptide KC510644_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510646_HBSP_P-B Product feature CHAIN KC510646_HBSP_P-B of FT:mat_peptide KC510646_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
QTAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KC510647_HBSP_P-B Product feature CHAIN KC510647_HBSP_P-B of FT:mat_peptide KC510647_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510648_HBSP_P-B Product feature CHAIN KC510648_HBSP_P-B of FT:mat_peptide KC510648_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510649_HBSP_P-B Product feature CHAIN KC510649_HBSP_P-B of FT:mat_peptide KC510649_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510650_HBSP_P-B Product feature CHAIN KC510650_HBSP_P-B of FT:mat_peptide KC510650_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510651_HBSP_P-B Product feature CHAIN KC510651_HBSP_P-B of FT:mat_peptide KC510651_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KC510652_HBSP_P-B Product feature CHAIN KC510652_HBSP_P-B of FT:mat_peptide KC510652_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510653_HBSP_P-B Product feature CHAIN KC510653_HBSP_P-B of FT:mat_peptide KC510653_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510654_HBSP_P-B Product feature CHAIN KC510654_HBSP_P-B of FT:mat_peptide KC510654_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510655_HBSP_P-B Product feature CHAIN KC510655_HBSP_P-B of FT:mat_peptide KC510655_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510656_HBSP_P-B Product feature CHAIN KC510656_HBSP_P-B of FT:mat_peptide KC510656_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510657_HBSP_P-B Product feature CHAIN KC510657_HBSP_P-B of FT:mat_peptide KC510657_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510658_HBSP_P-B Product feature CHAIN KC510658_HBSP_P-B of FT:mat_peptide KC510658_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510659_HBSP_P-B Product feature CHAIN KC510659_HBSP_P-B of FT:mat_peptide KC510659_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC510660_HBSP_P-B Product feature CHAIN KC510660_HBSP_P-B of FT:mat_peptide KC510660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774362_HBSP_P-B Product feature CHAIN KC774362_HBSP_P-B of FT:mat_peptide KC774362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz1107). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774363_HBSP_P-B Product feature CHAIN KC774363_HBSP_P-B of FT:mat_peptide KC774363_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2022). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774365_HBSP_P-B Product feature CHAIN KC774365_HBSP_P-B of FT:mat_peptide KC774365_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2113). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774366_HBSP_P-B Product feature CHAIN KC774366_HBSP_P-B of FT:mat_peptide KC774366_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2116). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774367_HBSP_P-B Product feature CHAIN KC774367_HBSP_P-B of FT:mat_peptide KC774367_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2147). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774368_HBSP_P-B Product feature CHAIN KC774368_HBSP_P-B of FT:mat_peptide KC774368_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1012). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774369_HBSP_P-B Product feature CHAIN KC774369_HBSP_P-B of FT:mat_peptide KC774369_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1013). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774370_HBSP_P-B Product feature CHAIN KC774370_HBSP_P-B of FT:mat_peptide KC774370_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1014). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLILGNLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774371_HBSP_P-B Product feature CHAIN KC774371_HBSP_P-B of FT:mat_peptide KC774371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1036). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774372_HBSP_P-B Product feature CHAIN KC774372_HBSP_P-B of FT:mat_peptide KC774372_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1040). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774373_HBSP_P-B Product feature CHAIN KC774373_HBSP_P-B of FT:mat_peptide KC774373_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1044). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774374_HBSP_P-B Product feature CHAIN KC774374_HBSP_P-B of FT:mat_peptide KC774374_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1053). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774375_HBSP_P-B Product feature CHAIN KC774375_HBSP_P-B of FT:mat_peptide KC774375_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774376_HBSP_P-B Product feature CHAIN KC774376_HBSP_P-B of FT:mat_peptide KC774376_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1056). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774377_HBSP_P-B Product feature CHAIN KC774377_HBSP_P-B of FT:mat_peptide KC774377_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1064). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774378_HBSP_P-B Product feature CHAIN KC774378_HBSP_P-B of FT:mat_peptide KC774378_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1015). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774379_HBSP_P-B Product feature CHAIN KC774379_HBSP_P-B of FT:mat_peptide KC774379_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1023). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774380_HBSP_P-B Product feature CHAIN KC774380_HBSP_P-B of FT:mat_peptide KC774380_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1033). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
QTAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774381_HBSP_P-B Product feature CHAIN KC774381_HBSP_P-B of FT:mat_peptide KC774381_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1062). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774382_HBSP_P-B Product feature CHAIN KC774382_HBSP_P-B of FT:mat_peptide KC774382_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1063). Complete genome. [Hepadnaviridae] (length=111 residues).
MHLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774383_HBSP_P-B Product feature CHAIN KC774383_HBSP_P-B of FT:mat_peptide KC774383_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1081). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774384_HBSP_P-B Product feature CHAIN KC774384_HBSP_P-B of FT:mat_peptide KC774384_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1091). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774385_HBSP_P-B Product feature CHAIN KC774385_HBSP_P-B of FT:mat_peptide KC774385_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1099). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774386_HBSP_P-B Product feature CHAIN KC774386_HBSP_P-B of FT:mat_peptide KC774386_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1101). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774387_HBSP_P-B Product feature CHAIN KC774387_HBSP_P-B of FT:mat_peptide KC774387_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1104). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774388_HBSP_P-B Product feature CHAIN KC774388_HBSP_P-B of FT:mat_peptide KC774388_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1116). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774389_HBSP_P-B Product feature CHAIN KC774389_HBSP_P-B of FT:mat_peptide KC774389_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1121). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774390_HBSP_P-B Product feature CHAIN KC774390_HBSP_P-B of FT:mat_peptide KC774390_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2158). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGHQSVSLGSVY
>gnl|hbvpro|KC774391_HBSP_P-B Product feature CHAIN KC774391_HBSP_P-B of FT:mat_peptide KC774391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2163). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774392_HBSP_P-B Product feature CHAIN KC774392_HBSP_P-B of FT:mat_peptide KC774392_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2169). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774393_HBSP_P-B Product feature CHAIN KC774393_HBSP_P-B of FT:mat_peptide KC774393_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1068). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774394_HBSP_P-B Product feature CHAIN KC774394_HBSP_P-B of FT:mat_peptide KC774394_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1070). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774395_HBSP_P-B Product feature CHAIN KC774395_HBSP_P-B of FT:mat_peptide KC774395_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1073). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774396_HBSP_P-B Product feature CHAIN KC774396_HBSP_P-B of FT:mat_peptide KC774396_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1182). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774397_HBSP_P-B Product feature CHAIN KC774397_HBSP_P-B of FT:mat_peptide KC774397_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1185). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKILLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774398_HBSP_P-B Product feature CHAIN KC774398_HBSP_P-B of FT:mat_peptide KC774398_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1202). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KC774399_HBSP_P-B Product feature CHAIN KC774399_HBSP_P-B of FT:mat_peptide KC774399_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1556). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774400_HBSP_P-B Product feature CHAIN KC774400_HBSP_P-B of FT:mat_peptide KC774400_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1585). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774401_HBSP_P-B Product feature CHAIN KC774401_HBSP_P-B of FT:mat_peptide KC774401_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1663). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774402_HBSP_P-B Product feature CHAIN KC774402_HBSP_P-B of FT:mat_peptide KC774402_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1670). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774403_HBSP_P-B Product feature CHAIN KC774403_HBSP_P-B of FT:mat_peptide KC774403_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774404_HBSP_P-B Product feature CHAIN KC774404_HBSP_P-B of FT:mat_peptide KC774404_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774405_HBSP_P-B Product feature CHAIN KC774405_HBSP_P-B of FT:mat_peptide KC774405_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2005). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774406_HBSP_P-B Product feature CHAIN KC774406_HBSP_P-B of FT:mat_peptide KC774406_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774407_HBSP_P-B Product feature CHAIN KC774407_HBSP_P-B of FT:mat_peptide KC774407_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2011). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGLLEEELPRLADDGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774408_HBSP_P-B Product feature CHAIN KC774408_HBSP_P-B of FT:mat_peptide KC774408_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2012). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774409_HBSP_P-B Product feature CHAIN KC774409_HBSP_P-B of FT:mat_peptide KC774409_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2013). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774410_HBSP_P-B Product feature CHAIN KC774410_HBSP_P-B of FT:mat_peptide KC774410_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2018). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774411_HBSP_P-B Product feature CHAIN KC774411_HBSP_P-B of FT:mat_peptide KC774411_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2025). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774412_HBSP_P-B Product feature CHAIN KC774412_HBSP_P-B of FT:mat_peptide KC774412_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2034). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|KC774413_HBSP_P-B Product feature CHAIN KC774413_HBSP_P-B of FT:mat_peptide KC774413_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2037). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774415_HBSP_P-B Product feature CHAIN KC774415_HBSP_P-B of FT:mat_peptide KC774415_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2064). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774416_HBSP_P-B Product feature CHAIN KC774416_HBSP_P-B of FT:mat_peptide KC774416_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1016). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774417_HBSP_P-B Product feature CHAIN KC774417_HBSP_P-B of FT:mat_peptide KC774417_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1028). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPVHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774418_HBSP_P-B Product feature CHAIN KC774418_HBSP_P-B of FT:mat_peptide KC774418_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774419_HBSP_P-B Product feature CHAIN KC774419_HBSP_P-B of FT:mat_peptide KC774419_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1083). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792652_HBSP_P-B Product feature CHAIN KC792652_HBSP_P-B of FT:mat_peptide KC792652_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQDARPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKXAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVX
>gnl|hbvpro|KC792667_HBSP_P-B Product feature CHAIN KC792667_HBSP_P-B of FT:mat_peptide KC792667_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0020). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792674_HBSP_P-B Product feature CHAIN KC792674_HBSP_P-B of FT:mat_peptide KC792674_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0027). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|KC792701_HBSP_P-B Product feature CHAIN KC792701_HBSP_P-B of FT:mat_peptide KC792701_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0054). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EXAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792712_HBSP_P-B Product feature CHAIN KC792712_HBSP_P-B of FT:mat_peptide KC792712_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0065). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KC792717_HBSP_P-B Product feature CHAIN KC792717_HBSP_P-B of FT:mat_peptide KC792717_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0070). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792719_HBSP_P-B Product feature CHAIN KC792719_HBSP_P-B of FT:mat_peptide KC792719_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0072). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792734_HBSP_P-B Product feature CHAIN KC792734_HBSP_P-B of FT:mat_peptide KC792734_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0087). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQXPAPDHAKLAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792742_HBSP_P-B Product feature CHAIN KC792742_HBSP_P-B of FT:mat_peptide KC792742_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0095). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KC792745_HBSP_P-B Product feature CHAIN KC792745_HBSP_P-B of FT:mat_peptide KC792745_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792748_HBSP_P-B Product feature CHAIN KC792748_HBSP_P-B of FT:mat_peptide KC792748_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0101). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQQPAPDHAKPARLLLKEPLCFPHVXVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792756_HBSP_P-B Product feature CHAIN KC792756_HBSP_P-B of FT:mat_peptide KC792756_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792765_HBSP_P-B Product feature CHAIN KC792765_HBSP_P-B of FT:mat_peptide KC792765_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0118). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792767_HBSP_P-B Product feature CHAIN KC792767_HBSP_P-B of FT:mat_peptide KC792767_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0120). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792777_HBSP_P-B Product feature CHAIN KC792777_HBSP_P-B of FT:mat_peptide KC792777_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0130). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSCQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLGLGTLNDQQLPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|KC792779_HBSP_P-B Product feature CHAIN KC792779_HBSP_P-B of FT:mat_peptide KC792779_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0132). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792780_HBSP_P-B Product feature CHAIN KC792780_HBSP_P-B of FT:mat_peptide KC792780_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0133). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQQPAXDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792786_HBSP_P-B Product feature CHAIN KC792786_HBSP_P-B of FT:mat_peptide KC792786_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0139). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEESGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792798_HBSP_P-B Product feature CHAIN KC792798_HBSP_P-B of FT:mat_peptide KC792798_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0151). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792800_HBSP_P-B Product feature CHAIN KC792800_HBSP_P-B of FT:mat_peptide KC792800_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0153). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAXDHAKPAXLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792801_HBSP_P-B Product feature CHAIN KC792801_HBSP_P-B of FT:mat_peptide KC792801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0154). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDXQQPAPDHAXPARLLLKEPLXFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792811_HBSP_P-B Product feature CHAIN KC792811_HBSP_P-B of FT:mat_peptide KC792811_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPARDHAKPAQLLLKGPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792843_HBSP_P-B Product feature CHAIN KC792843_HBSP_P-B of FT:mat_peptide KC792843_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0196). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792859_HBSP_P-B Product feature CHAIN KC792859_HBSP_P-B of FT:mat_peptide KC792859_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0212). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792860_HBSP_P-B Product feature CHAIN KC792860_HBSP_P-B of FT:mat_peptide KC792860_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0213). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792885_HBSP_P-B Product feature CHAIN KC792885_HBSP_P-B of FT:mat_peptide KC792885_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0238). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQYFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792889_HBSP_P-B Product feature CHAIN KC792889_HBSP_P-B of FT:mat_peptide KC792889_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0242). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAXDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792896_HBSP_P-B Product feature CHAIN KC792896_HBSP_P-B of FT:mat_peptide KC792896_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0249). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792897_HBSP_P-B Product feature CHAIN KC792897_HBSP_P-B of FT:mat_peptide KC792897_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0250). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792901_HBSP_P-B Product feature CHAIN KC792901_HBSP_P-B of FT:mat_peptide KC792901_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0254). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRK
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792904_HBSP_P-B Product feature CHAIN KC792904_HBSP_P-B of FT:mat_peptide KC792904_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0257). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNXNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792920_HBSP_P-B Product feature CHAIN KC792920_HBSP_P-B of FT:mat_peptide KC792920_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0273). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792935_HBSP_P-B Product feature CHAIN KC792935_HBSP_P-B of FT:mat_peptide KC792935_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0288). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|KC792936_HBSP_P-B Product feature CHAIN KC792936_HBSP_P-B of FT:mat_peptide KC792936_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0289). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLXLGBLNDHQQPAPDHAKPAXXLLKEPLCFPHVXVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KC792938_HBSP_P-B Product feature CHAIN KC792938_HBSP_P-B of FT:mat_peptide KC792938_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792939_HBSP_P-B Product feature CHAIN KC792939_HBSP_P-B of FT:mat_peptide KC792939_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0292). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTET
ALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792945_HBSP_P-B Product feature CHAIN KC792945_HBSP_P-B of FT:mat_peptide KC792945_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0298). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792947_HBSP_P-B Product feature CHAIN KC792947_HBSP_P-B of FT:mat_peptide KC792947_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0300). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQRPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGXXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792948_HBSP_P-B Product feature CHAIN KC792948_HBSP_P-B of FT:mat_peptide KC792948_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0301). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KC792949_HBSP_P-B Product feature CHAIN KC792949_HBSP_P-B of FT:mat_peptide KC792949_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0302). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEXLNRRVAXELNLGNXNXHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792951_HBSP_P-B Product feature CHAIN KC792951_HBSP_P-B of FT:mat_peptide KC792951_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0304). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792955_HBSP_P-B Product feature CHAIN KC792955_HBSP_P-B of FT:mat_peptide KC792955_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLHLGNLNDHQQPAXDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792970_HBSP_P-B Product feature CHAIN KC792970_HBSP_P-B of FT:mat_peptide KC792970_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792973_HBSP_P-B Product feature CHAIN KC792973_HBSP_P-B of FT:mat_peptide KC792973_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0326). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQQPAPDHAXXARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792974_HBSP_P-B Product feature CHAIN KC792974_HBSP_P-B of FT:mat_peptide KC792974_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0327). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792976_HBSP_P-B Product feature CHAIN KC792976_HBSP_P-B of FT:mat_peptide KC792976_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0329). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLSLGXLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792982_HBSP_P-B Product feature CHAIN KC792982_HBSP_P-B of FT:mat_peptide KC792982_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0335). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792985_HBSP_P-B Product feature CHAIN KC792985_HBSP_P-B of FT:mat_peptide KC792985_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0338). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC792994_HBSP_P-B Product feature CHAIN KC792994_HBSP_P-B of FT:mat_peptide KC792994_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0347). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793004_HBSP_P-B Product feature CHAIN KC793004_HBSP_P-B of FT:mat_peptide KC793004_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0357). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793006_HBSP_P-B Product feature CHAIN KC793006_HBSP_P-B of FT:mat_peptide KC793006_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDPAKPAXLLLKEPLCFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793030_HBSP_P-B Product feature CHAIN KC793030_HBSP_P-B of FT:mat_peptide KC793030_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0383). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQQFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793042_HBSP_P-B Product feature CHAIN KC793042_HBSP_P-B of FT:mat_peptide KC793042_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0395). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|KC793061_HBSP_P-B Product feature CHAIN KC793061_HBSP_P-B of FT:mat_peptide KC793061_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPEHAKPARLLLKEPLCFPHVAVPNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793064_HBSP_P-B Product feature CHAIN KC793064_HBSP_P-B of FT:mat_peptide KC793064_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0417). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793069_HBSP_P-B Product feature CHAIN KC793069_HBSP_P-B of FT:mat_peptide KC793069_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQLPAPDHAKPARLLLKEPLCFPHVAVPNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793076_HBSP_P-B Product feature CHAIN KC793076_HBSP_P-B of FT:mat_peptide KC793076_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0429). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEXLNXRVABDLXLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793125_HBSP_P-B Product feature CHAIN KC793125_HBSP_P-B of FT:mat_peptide KC793125_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0478). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVVVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793132_HBSP_P-B Product feature CHAIN KC793132_HBSP_P-B of FT:mat_peptide KC793132_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793139_HBSP_P-B Product feature CHAIN KC793139_HBSP_P-B of FT:mat_peptide KC793139_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0492). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793141_HBSP_P-B Product feature CHAIN KC793141_HBSP_P-B of FT:mat_peptide KC793141_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0494). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793168_HBSP_P-B Product feature CHAIN KC793168_HBSP_P-B of FT:mat_peptide KC793168_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0521). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEI
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793180_HBSP_P-B Product feature CHAIN KC793180_HBSP_P-B of FT:mat_peptide KC793180_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0533). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDZEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC793189_HBSP_P-B Product feature CHAIN KC793189_HBSP_P-B of FT:mat_peptide KC793189_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0542). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=110 residues).
PLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNHRVAEDLHLGNLNDHRQPAPDHAKPAQLLLKEPLCFLHVAVQNLRTE
TAPVFPSHRPGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KC793199_HBSP_P-B Product feature CHAIN KC793199_HBSP_P-B of FT:mat_peptide KC793199_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0552). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=109 residues).
LSYQRFRXLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVPNLRTET
APVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053159_HBSP_P-B Product feature CHAIN KF053159_HBSP_P-B of FT:mat_peptide KF053159_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY155693). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLDSVY
>gnl|hbvpro|KF053162_HBSP_P-B Product feature CHAIN KF053162_HBSP_P-B of FT:mat_peptide KF053162_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY247131). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053163_HBSP_P-B Product feature CHAIN KF053163_HBSP_P-B of FT:mat_peptide KF053163_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727495). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053165_HBSP_P-B Product feature CHAIN KF053165_HBSP_P-B of FT:mat_peptide KF053165_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY484998). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053171_HBSP_P-B Product feature CHAIN KF053171_HBSP_P-B of FT:mat_peptide KF053171_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY43147). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053174_HBSP_P-B Product feature CHAIN KF053174_HBSP_P-B of FT:mat_peptide KF053174_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY495063). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053180_HBSP_P-B Product feature CHAIN KF053180_HBSP_P-B of FT:mat_peptide KF053180_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KF053182_HBSP_P-B Product feature CHAIN KF053182_HBSP_P-B of FT:mat_peptide KF053182_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY741196). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KF053189_HBSP_P-B Product feature CHAIN KF053189_HBSP_P-B of FT:mat_peptide KF053189_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY266289). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053190_HBSP_P-B Product feature CHAIN KF053190_HBSP_P-B of FT:mat_peptide KF053190_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY781114). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053192_HBSP_P-B Product feature CHAIN KF053192_HBSP_P-B of FT:mat_peptide KF053192_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY790800). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF053194_HBSP_P-B Product feature CHAIN KF053194_HBSP_P-B of FT:mat_peptide KF053194_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY799421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173297_HBSP_P-B Product feature CHAIN KJ173297_HBSP_P-B of FT:mat_peptide KJ173297_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008C(e46n)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173298_HBSP_P-B Product feature CHAIN KJ173298_HBSP_P-B of FT:mat_peptide KJ173298_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008M(e47)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKDPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173339_HBSP_P-B Product feature CHAIN KJ173339_HBSP_P-B of FT:mat_peptide KJ173339_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001C(e201)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173340_HBSP_P-B Product feature CHAIN KJ173340_HBSP_P-B of FT:mat_peptide KJ173340_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001M(e202)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173341_HBSP_P-B Product feature CHAIN KJ173341_HBSP_P-B of FT:mat_peptide KJ173341_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003C(e204)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173342_HBSP_P-B Product feature CHAIN KJ173342_HBSP_P-B of FT:mat_peptide KJ173342_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003M(e205)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173345_HBSP_P-B Product feature CHAIN KJ173345_HBSP_P-B of FT:mat_peptide KJ173345_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX008C(e214)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173347_HBSP_P-B Product feature CHAIN KJ173347_HBSP_P-B of FT:mat_peptide KJ173347_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012C(e220)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173348_HBSP_P-B Product feature CHAIN KJ173348_HBSP_P-B of FT:mat_peptide KJ173348_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012M(e221)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173351_HBSP_P-B Product feature CHAIN KJ173351_HBSP_P-B of FT:mat_peptide KJ173351_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025C(e234)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173352_HBSP_P-B Product feature CHAIN KJ173352_HBSP_P-B of FT:mat_peptide KJ173352_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025M(e235n)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173353_HBSP_P-B Product feature CHAIN KJ173353_HBSP_P-B of FT:mat_peptide KJ173353_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027C(e237)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173354_HBSP_P-B Product feature CHAIN KJ173354_HBSP_P-B of FT:mat_peptide KJ173354_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027M(e235n)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173355_HBSP_P-B Product feature CHAIN KJ173355_HBSP_P-B of FT:mat_peptide KJ173355_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032C(e247n)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173356_HBSP_P-B Product feature CHAIN KJ173356_HBSP_P-B of FT:mat_peptide KJ173356_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032M(e248n)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173357_HBSP_P-B Product feature CHAIN KJ173357_HBSP_P-B of FT:mat_peptide KJ173357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX065C(e313)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173359_HBSP_P-B Product feature CHAIN KJ173359_HBSP_P-B of FT:mat_peptide KJ173359_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161C(m162)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173360_HBSP_P-B Product feature CHAIN KJ173360_HBSP_P-B of FT:mat_peptide KJ173360_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161M(m161)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTNGSGPQSVSLGSVY
>gnl|hbvpro|KJ173361_HBSP_P-B Product feature CHAIN KJ173361_HBSP_P-B of FT:mat_peptide KJ173361_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041C(m42)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173362_HBSP_P-B Product feature CHAIN KJ173362_HBSP_P-B of FT:mat_peptide KJ173362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041M(m41)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173363_HBSP_P-B Product feature CHAIN KJ173363_HBSP_P-B of FT:mat_peptide KJ173363_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-C(006)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173364_HBSP_P-B Product feature CHAIN KJ173364_HBSP_P-B of FT:mat_peptide KJ173364_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-M(007)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173365_HBSP_P-B Product feature CHAIN KJ173365_HBSP_P-B of FT:mat_peptide KJ173365_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-C(009)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173366_HBSP_P-B Product feature CHAIN KJ173366_HBSP_P-B of FT:mat_peptide KJ173366_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-M(011)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173367_HBSP_P-B Product feature CHAIN KJ173367_HBSP_P-B of FT:mat_peptide KJ173367_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-C(B1)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173368_HBSP_P-B Product feature CHAIN KJ173368_HBSP_P-B of FT:mat_peptide KJ173368_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-M(B3)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173369_HBSP_P-B Product feature CHAIN KJ173369_HBSP_P-B of FT:mat_peptide KJ173369_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-C(B37)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173370_HBSP_P-B Product feature CHAIN KJ173370_HBSP_P-B of FT:mat_peptide KJ173370_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-M(B39)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173371_HBSP_P-B Product feature CHAIN KJ173371_HBSP_P-B of FT:mat_peptide KJ173371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P009-C(B135)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173372_HBSP_P-B Product feature CHAIN KJ173372_HBSP_P-B of FT:mat_peptide KJ173372_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P009-M2(B137)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173373_HBSP_P-B Product feature CHAIN KJ173373_HBSP_P-B of FT:mat_peptide KJ173373_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-C1(147a)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173374_HBSP_P-B Product feature CHAIN KJ173374_HBSP_P-B of FT:mat_peptide KJ173374_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-M(B149)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173375_HBSP_P-B Product feature CHAIN KJ173375_HBSP_P-B of FT:mat_peptide KJ173375_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004C(e107)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173376_HBSP_P-B Product feature CHAIN KJ173376_HBSP_P-B of FT:mat_peptide KJ173376_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004M(e108)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173377_HBSP_P-B Product feature CHAIN KJ173377_HBSP_P-B of FT:mat_peptide KJ173377_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY014C(e115)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173378_HBSP_P-B Product feature CHAIN KJ173378_HBSP_P-B of FT:mat_peptide KJ173378_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY014M(e116)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLRNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173380_HBSP_P-B Product feature CHAIN KJ173380_HBSP_P-B of FT:mat_peptide KJ173380_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019M(e122)). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173381_HBSP_P-B Product feature CHAIN KJ173381_HBSP_P-B of FT:mat_peptide KJ173381_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-C(FY137Cn).fas). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173382_HBSP_P-B Product feature CHAIN KJ173382_HBSP_P-B of FT:mat_peptide KJ173382_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137An).fas). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173385_HBSP_P-B Product feature CHAIN KJ173385_HBSP_P-B of FT:mat_peptide KJ173385_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-M(m603)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MRLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173386_HBSP_P-B Product feature CHAIN KJ173386_HBSP_P-B of FT:mat_peptide KJ173386_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-C(m604)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173387_HBSP_P-B Product feature CHAIN KJ173387_HBSP_P-B of FT:mat_peptide KJ173387_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-M(m607)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KJ173388_HBSP_P-B Product feature CHAIN KJ173388_HBSP_P-B of FT:mat_peptide KJ173388_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-C(m608)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KJ173389_HBSP_P-B Product feature CHAIN KJ173389_HBSP_P-B of FT:mat_peptide KJ173389_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-M(m617)). Complete genome. [Hepadnaviridae] (length=111 residues).
MHLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173390_HBSP_P-B Product feature CHAIN KJ173390_HBSP_P-B of FT:mat_peptide KJ173390_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-C(m618)). Complete genome. [Hepadnaviridae] (length=111 residues).
MHLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173397_HBSP_P-B Product feature CHAIN KJ173397_HBSP_P-B of FT:mat_peptide KJ173397_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-M(134A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173398_HBSP_P-B Product feature CHAIN KJ173398_HBSP_P-B of FT:mat_peptide KJ173398_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-C(134B)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173399_HBSP_P-B Product feature CHAIN KJ173399_HBSP_P-B of FT:mat_peptide KJ173399_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-M(4161A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173400_HBSP_P-B Product feature CHAIN KJ173400_HBSP_P-B of FT:mat_peptide KJ173400_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-C(4230B)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173401_HBSP_P-B Product feature CHAIN KJ173401_HBSP_P-B of FT:mat_peptide KJ173401_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-M(6720A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173402_HBSP_P-B Product feature CHAIN KJ173402_HBSP_P-B of FT:mat_peptide KJ173402_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-C(3733B)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173403_HBSP_P-B Product feature CHAIN KJ173403_HBSP_P-B of FT:mat_peptide KJ173403_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-M(6641M)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
QTAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173404_HBSP_P-B Product feature CHAIN KJ173404_HBSP_P-B of FT:mat_peptide KJ173404_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-C(3953B)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
QTAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173405_HBSP_P-B Product feature CHAIN KJ173405_HBSP_P-B of FT:mat_peptide KJ173405_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-M(6642A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173406_HBSP_P-B Product feature CHAIN KJ173406_HBSP_P-B of FT:mat_peptide KJ173406_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-C(3965B)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173407_HBSP_P-B Product feature CHAIN KJ173407_HBSP_P-B of FT:mat_peptide KJ173407_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-M(6650A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173408_HBSP_P-B Product feature CHAIN KJ173408_HBSP_P-B of FT:mat_peptide KJ173408_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-C(4198B)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173409_HBSP_P-B Product feature CHAIN KJ173409_HBSP_P-B of FT:mat_peptide KJ173409_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-M(6692A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173410_HBSP_P-B Product feature CHAIN KJ173410_HBSP_P-B of FT:mat_peptide KJ173410_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-C(4171B)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173411_HBSP_P-B Product feature CHAIN KJ173411_HBSP_P-B of FT:mat_peptide KJ173411_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-M(6579A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173412_HBSP_P-B Product feature CHAIN KJ173412_HBSP_P-B of FT:mat_peptide KJ173412_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-C(4159b)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173413_HBSP_P-B Product feature CHAIN KJ173413_HBSP_P-B of FT:mat_peptide KJ173413_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137A)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173414_HBSP_P-B Product feature CHAIN KJ173414_HBSP_P-B of FT:mat_peptide KJ173414_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_C(FY137B)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173415_HBSP_P-B Product feature CHAIN KJ173415_HBSP_P-B of FT:mat_peptide KJ173415_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-V(FY137C)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173416_HBSP_P-B Product feature CHAIN KJ173416_HBSP_P-B of FT:mat_peptide KJ173416_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201M(e401)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173417_HBSP_P-B Product feature CHAIN KJ173417_HBSP_P-B of FT:mat_peptide KJ173417_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201C(e402)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173418_HBSP_P-B Product feature CHAIN KJ173418_HBSP_P-B of FT:mat_peptide KJ173418_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N202M(e403)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173419_HBSP_P-B Product feature CHAIN KJ173419_HBSP_P-B of FT:mat_peptide KJ173419_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N202C(e404)). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173420_HBSP_P-B Product feature CHAIN KJ173420_HBSP_P-B of FT:mat_peptide KJ173420_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203M(e405)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173421_HBSP_P-B Product feature CHAIN KJ173421_HBSP_P-B of FT:mat_peptide KJ173421_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203C(e406)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173422_HBSP_P-B Product feature CHAIN KJ173422_HBSP_P-B of FT:mat_peptide KJ173422_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204M(e407)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173423_HBSP_P-B Product feature CHAIN KJ173423_HBSP_P-B of FT:mat_peptide KJ173423_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204C(e408)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173424_HBSP_P-B Product feature CHAIN KJ173424_HBSP_P-B of FT:mat_peptide KJ173424_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205M(e409)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ173425_HBSP_P-B Product feature CHAIN KJ173425_HBSP_P-B of FT:mat_peptide KJ173425_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205C(e410)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ410490_HBSP_P-B Product feature CHAIN KJ410490_HBSP_P-B of FT:mat_peptide KJ410490_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HK_1329). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ410500_HBSP_P-B Product feature CHAIN KJ410500_HBSP_P-B of FT:mat_peptide KJ410500_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK321). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ410502_HBSP_P-B Product feature CHAIN KJ410502_HBSP_P-B of FT:mat_peptide KJ410502_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK318). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ410507_HBSP_P-B Product feature CHAIN KJ410507_HBSP_P-B of FT:mat_peptide KJ410507_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK6840). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ410516_HBSP_P-B Product feature CHAIN KJ410516_HBSP_P-B of FT:mat_peptide KJ410516_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4777). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ410517_HBSP_P-B Product feature CHAIN KJ410517_HBSP_P-B of FT:mat_peptide KJ410517_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4901). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717792_HBSP_P-B Product feature CHAIN KJ717792_HBSP_P-B of FT:mat_peptide KJ717792_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY853571). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717795_HBSP_P-B Product feature CHAIN KJ717795_HBSP_P-B of FT:mat_peptide KJ717795_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY303852). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717796_HBSP_P-B Product feature CHAIN KJ717796_HBSP_P-B of FT:mat_peptide KJ717796_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY298487). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717798_HBSP_P-B Product feature CHAIN KJ717798_HBSP_P-B of FT:mat_peptide KJ717798_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY811794). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717801_HBSP_P-B Product feature CHAIN KJ717801_HBSP_P-B of FT:mat_peptide KJ717801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY717979). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPARLLLQEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTHGSGPQSVSLGSVY
>gnl|hbvpro|KJ717805_HBSP_P-B Product feature CHAIN KJ717805_HBSP_P-B of FT:mat_peptide KJ717805_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY493880). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717806_HBSP_P-B Product feature CHAIN KJ717806_HBSP_P-B of FT:mat_peptide KJ717806_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY789421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717807_HBSP_P-B Product feature CHAIN KJ717807_HBSP_P-B of FT:mat_peptide KJ717807_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY711763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717808_HBSP_P-B Product feature CHAIN KJ717808_HBSP_P-B of FT:mat_peptide KJ717808_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY775775). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRFADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717813_HBSP_P-B Product feature CHAIN KJ717813_HBSP_P-B of FT:mat_peptide KJ717813_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY445015). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ATAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717817_HBSP_P-B Product feature CHAIN KJ717817_HBSP_P-B of FT:mat_peptide KJ717817_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY491666). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717818_HBSP_P-B Product feature CHAIN KJ717818_HBSP_P-B of FT:mat_peptide KJ717818_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY081577). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDQEAGPLEEELPRLADEGLNRRVAENLHLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717820_HBSP_P-B Product feature CHAIN KJ717820_HBSP_P-B of FT:mat_peptide KJ717820_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY571290). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEDELPRLADEGLNRRVAEDLTLGNLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ATAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717829_HBSP_P-B Product feature CHAIN KJ717829_HBSP_P-B of FT:mat_peptide KJ717829_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY540630). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRFAEDLNLGTLNDHRQQARDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717830_HBSP_P-B Product feature CHAIN KJ717830_HBSP_P-B of FT:mat_peptide KJ717830_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY501356). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717831_HBSP_P-B Product feature CHAIN KJ717831_HBSP_P-B of FT:mat_peptide KJ717831_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY241913). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717835_HBSP_P-B Product feature CHAIN KJ717835_HBSP_P-B of FT:mat_peptide KJ717835_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY131767). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717836_HBSP_P-B Product feature CHAIN KJ717836_HBSP_P-B of FT:mat_peptide KJ717836_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY081397). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717837_HBSP_P-B Product feature CHAIN KJ717837_HBSP_P-B of FT:mat_peptide KJ717837_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY500621). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDTDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDRAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717840_HBSP_P-B Product feature CHAIN KJ717840_HBSP_P-B of FT:mat_peptide KJ717840_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY502457). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLFDNAAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717841_HBSP_P-B Product feature CHAIN KJ717841_HBSP_P-B of FT:mat_peptide KJ717841_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY331455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717842_HBSP_P-B Product feature CHAIN KJ717842_HBSP_P-B of FT:mat_peptide KJ717842_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY201308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717843_HBSP_P-B Product feature CHAIN KJ717843_HBSP_P-B of FT:mat_peptide KJ717843_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY381508). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ790200_HBSP_P-B Product feature CHAIN KJ790200_HBSP_P-B of FT:mat_peptide KJ790200_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803752_HBSP_P-B Product feature CHAIN KJ803752_HBSP_P-B of FT:mat_peptide KJ803752_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY155693). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803755_HBSP_P-B Product feature CHAIN KJ803755_HBSP_P-B of FT:mat_peptide KJ803755_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY247131). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803756_HBSP_P-B Product feature CHAIN KJ803756_HBSP_P-B of FT:mat_peptide KJ803756_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727495). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803758_HBSP_P-B Product feature CHAIN KJ803758_HBSP_P-B of FT:mat_peptide KJ803758_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY484998). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803763_HBSP_P-B Product feature CHAIN KJ803763_HBSP_P-B of FT:mat_peptide KJ803763_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY790800). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803764_HBSP_P-B Product feature CHAIN KJ803764_HBSP_P-B of FT:mat_peptide KJ803764_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY043147). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803768_HBSP_P-B Product feature CHAIN KJ803768_HBSP_P-B of FT:mat_peptide KJ803768_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY495063). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803773_HBSP_P-B Product feature CHAIN KJ803773_HBSP_P-B of FT:mat_peptide KJ803773_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727093). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803775_HBSP_P-B Product feature CHAIN KJ803775_HBSP_P-B of FT:mat_peptide KJ803775_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY741196). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803781_HBSP_P-B Product feature CHAIN KJ803781_HBSP_P-B of FT:mat_peptide KJ803781_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY799421). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803783_HBSP_P-B Product feature CHAIN KJ803783_HBSP_P-B of FT:mat_peptide KJ803783_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY266289). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803784_HBSP_P-B Product feature CHAIN KJ803784_HBSP_P-B of FT:mat_peptide KJ803784_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY781114). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803787_HBSP_P-B Product feature CHAIN KJ803787_HBSP_P-B of FT:mat_peptide KJ803787_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY853571). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803789_HBSP_P-B Product feature CHAIN KJ803789_HBSP_P-B of FT:mat_peptide KJ803789_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY303852). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803795_HBSP_P-B Product feature CHAIN KJ803795_HBSP_P-B of FT:mat_peptide KJ803795_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY789421). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803796_HBSP_P-B Product feature CHAIN KJ803796_HBSP_P-B of FT:mat_peptide KJ803796_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY711763). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803797_HBSP_P-B Product feature CHAIN KJ803797_HBSP_P-B of FT:mat_peptide KJ803797_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY775775). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRFADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803801_HBSP_P-B Product feature CHAIN KJ803801_HBSP_P-B of FT:mat_peptide KJ803801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY035746). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ATAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803805_HBSP_P-B Product feature CHAIN KJ803805_HBSP_P-B of FT:mat_peptide KJ803805_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY491666). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803808_HBSP_P-B Product feature CHAIN KJ803808_HBSP_P-B of FT:mat_peptide KJ803808_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY571290). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEDELPRLADEGLNRRVAEDLTLGNLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ATAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803816_HBSP_P-B Product feature CHAIN KJ803816_HBSP_P-B of FT:mat_peptide KJ803816_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY540630). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRFAEDLNLGTLNDHRQQARDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803817_HBSP_P-B Product feature CHAIN KJ803817_HBSP_P-B of FT:mat_peptide KJ803817_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY241913). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803819_HBSP_P-B Product feature CHAIN KJ803819_HBSP_P-B of FT:mat_peptide KJ803819_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY131767). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803820_HBSP_P-B Product feature CHAIN KJ803820_HBSP_P-B of FT:mat_peptide KJ803820_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY081397). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803821_HBSP_P-B Product feature CHAIN KJ803821_HBSP_P-B of FT:mat_peptide KJ803821_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY500621). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDTDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDRAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803824_HBSP_P-B Product feature CHAIN KJ803824_HBSP_P-B of FT:mat_peptide KJ803824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY502457). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLFDNAAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803825_HBSP_P-B Product feature CHAIN KJ803825_HBSP_P-B of FT:mat_peptide KJ803825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY381508). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843165_HBSP_P-B Product feature CHAIN KJ843165_HBSP_P-B of FT:mat_peptide KJ843165_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ag03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|KM213032_HBSP_P-B Product feature CHAIN KM213032_HBSP_P-B of FT:mat_peptide KM213032_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LRF-k1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM213034_HBSP_P-B Product feature CHAIN KM213034_HBSP_P-B of FT:mat_peptide KM213034_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYG-k1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KM213035_HBSP_P-B Product feature CHAIN KM213035_HBSP_P-B of FT:mat_peptide KM213035_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MRG-k1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDPARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM213036_HBSP_P-B Product feature CHAIN KM213036_HBSP_P-B of FT:mat_peptide KM213036_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CSW-k1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVC
>gnl|hbvpro|KM359440_HBSP_P-B Product feature CHAIN KM359440_HBSP_P-B of FT:mat_peptide KM359440_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FF3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM392072_HBSP_P-B Product feature CHAIN KM392072_HBSP_P-B of FT:mat_peptide KM392072_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM392083_HBSP_P-B Product feature CHAIN KM392083_HBSP_P-B of FT:mat_peptide KM392083_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM392084_HBSP_P-B Product feature CHAIN KM392084_HBSP_P-B of FT:mat_peptide KM392084_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V42). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAXDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM875416_HBSP_P-B Product feature CHAIN KM875416_HBSP_P-B of FT:mat_peptide KM875416_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt9N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM875417_HBSP_P-B Product feature CHAIN KM875417_HBSP_P-B of FT:mat_peptide KM875417_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt9T). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM875420_HBSP_P-B Product feature CHAIN KM875420_HBSP_P-B of FT:mat_peptide KM875420_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt11N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM875421_HBSP_P-B Product feature CHAIN KM875421_HBSP_P-B of FT:mat_peptide KM875421_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt11T). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP036970_HBSP_P-B Product feature CHAIN KP036970_HBSP_P-B of FT:mat_peptide KP036970_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-YA). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148314_HBSP_P-B Product feature CHAIN KP148314_HBSP_P-B of FT:mat_peptide KP148314_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148317_HBSP_P-B Product feature CHAIN KP148317_HBSP_P-B of FT:mat_peptide KP148317_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148318_HBSP_P-B Product feature CHAIN KP148318_HBSP_P-B of FT:mat_peptide KP148318_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148319_HBSP_P-B Product feature CHAIN KP148319_HBSP_P-B of FT:mat_peptide KP148319_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148320_HBSP_P-B Product feature CHAIN KP148320_HBSP_P-B of FT:mat_peptide KP148320_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148321_HBSP_P-B Product feature CHAIN KP148321_HBSP_P-B of FT:mat_peptide KP148321_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148322_HBSP_P-B Product feature CHAIN KP148322_HBSP_P-B of FT:mat_peptide KP148322_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148323_HBSP_P-B Product feature CHAIN KP148323_HBSP_P-B of FT:mat_peptide KP148323_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148324_HBSP_P-B Product feature CHAIN KP148324_HBSP_P-B of FT:mat_peptide KP148324_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148325_HBSP_P-B Product feature CHAIN KP148325_HBSP_P-B of FT:mat_peptide KP148325_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148326_HBSP_P-B Product feature CHAIN KP148326_HBSP_P-B of FT:mat_peptide KP148326_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148327_HBSP_P-B Product feature CHAIN KP148327_HBSP_P-B of FT:mat_peptide KP148327_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148328_HBSP_P-B Product feature CHAIN KP148328_HBSP_P-B of FT:mat_peptide KP148328_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-94). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKSAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148329_HBSP_P-B Product feature CHAIN KP148329_HBSP_P-B of FT:mat_peptide KP148329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-99). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148330_HBSP_P-B Product feature CHAIN KP148330_HBSP_P-B of FT:mat_peptide KP148330_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-104). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148331_HBSP_P-B Product feature CHAIN KP148331_HBSP_P-B of FT:mat_peptide KP148331_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-109). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148332_HBSP_P-B Product feature CHAIN KP148332_HBSP_P-B of FT:mat_peptide KP148332_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-122). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148333_HBSP_P-B Product feature CHAIN KP148333_HBSP_P-B of FT:mat_peptide KP148333_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-124). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148334_HBSP_P-B Product feature CHAIN KP148334_HBSP_P-B of FT:mat_peptide KP148334_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-126). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148335_HBSP_P-B Product feature CHAIN KP148335_HBSP_P-B of FT:mat_peptide KP148335_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-130). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFWKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148336_HBSP_P-B Product feature CHAIN KP148336_HBSP_P-B of FT:mat_peptide KP148336_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148338_HBSP_P-B Product feature CHAIN KP148338_HBSP_P-B of FT:mat_peptide KP148338_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148339_HBSP_P-B Product feature CHAIN KP148339_HBSP_P-B of FT:mat_peptide KP148339_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148340_HBSP_P-B Product feature CHAIN KP148340_HBSP_P-B of FT:mat_peptide KP148340_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148341_HBSP_P-B Product feature CHAIN KP148341_HBSP_P-B of FT:mat_peptide KP148341_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLPLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148342_HBSP_P-B Product feature CHAIN KP148342_HBSP_P-B of FT:mat_peptide KP148342_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148343_HBSP_P-B Product feature CHAIN KP148343_HBSP_P-B of FT:mat_peptide KP148343_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148344_HBSP_P-B Product feature CHAIN KP148344_HBSP_P-B of FT:mat_peptide KP148344_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148345_HBSP_P-B Product feature CHAIN KP148345_HBSP_P-B of FT:mat_peptide KP148345_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148346_HBSP_P-B Product feature CHAIN KP148346_HBSP_P-B of FT:mat_peptide KP148346_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148347_HBSP_P-B Product feature CHAIN KP148347_HBSP_P-B of FT:mat_peptide KP148347_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148348_HBSP_P-B Product feature CHAIN KP148348_HBSP_P-B of FT:mat_peptide KP148348_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148349_HBSP_P-B Product feature CHAIN KP148349_HBSP_P-B of FT:mat_peptide KP148349_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148356_HBSP_P-B Product feature CHAIN KP148356_HBSP_P-B of FT:mat_peptide KP148356_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNAYGSGPQSVSLGSVY
>gnl|hbvpro|KP148357_HBSP_P-B Product feature CHAIN KP148357_HBSP_P-B of FT:mat_peptide KP148357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148359_HBSP_P-B Product feature CHAIN KP148359_HBSP_P-B of FT:mat_peptide KP148359_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148360_HBSP_P-B Product feature CHAIN KP148360_HBSP_P-B of FT:mat_peptide KP148360_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148361_HBSP_P-B Product feature CHAIN KP148361_HBSP_P-B of FT:mat_peptide KP148361_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148362_HBSP_P-B Product feature CHAIN KP148362_HBSP_P-B of FT:mat_peptide KP148362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-73). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148363_HBSP_P-B Product feature CHAIN KP148363_HBSP_P-B of FT:mat_peptide KP148363_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-86). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148364_HBSP_P-B Product feature CHAIN KP148364_HBSP_P-B of FT:mat_peptide KP148364_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-101). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148365_HBSP_P-B Product feature CHAIN KP148365_HBSP_P-B of FT:mat_peptide KP148365_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-106). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148366_HBSP_P-B Product feature CHAIN KP148366_HBSP_P-B of FT:mat_peptide KP148366_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-110). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148367_HBSP_P-B Product feature CHAIN KP148367_HBSP_P-B of FT:mat_peptide KP148367_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148368_HBSP_P-B Product feature CHAIN KP148368_HBSP_P-B of FT:mat_peptide KP148368_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148369_HBSP_P-B Product feature CHAIN KP148369_HBSP_P-B of FT:mat_peptide KP148369_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148370_HBSP_P-B Product feature CHAIN KP148370_HBSP_P-B of FT:mat_peptide KP148370_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148371_HBSP_P-B Product feature CHAIN KP148371_HBSP_P-B of FT:mat_peptide KP148371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148372_HBSP_P-B Product feature CHAIN KP148372_HBSP_P-B of FT:mat_peptide KP148372_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148373_HBSP_P-B Product feature CHAIN KP148373_HBSP_P-B of FT:mat_peptide KP148373_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KP148374_HBSP_P-B Product feature CHAIN KP148374_HBSP_P-B of FT:mat_peptide KP148374_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARPLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148375_HBSP_P-B Product feature CHAIN KP148375_HBSP_P-B of FT:mat_peptide KP148375_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148376_HBSP_P-B Product feature CHAIN KP148376_HBSP_P-B of FT:mat_peptide KP148376_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148377_HBSP_P-B Product feature CHAIN KP148377_HBSP_P-B of FT:mat_peptide KP148377_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPRPPAPDHAEPARPLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148378_HBSP_P-B Product feature CHAIN KP148378_HBSP_P-B of FT:mat_peptide KP148378_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148379_HBSP_P-B Product feature CHAIN KP148379_HBSP_P-B of FT:mat_peptide KP148379_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148380_HBSP_P-B Product feature CHAIN KP148380_HBSP_P-B of FT:mat_peptide KP148380_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148382_HBSP_P-B Product feature CHAIN KP148382_HBSP_P-B of FT:mat_peptide KP148382_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148383_HBSP_P-B Product feature CHAIN KP148383_HBSP_P-B of FT:mat_peptide KP148383_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148384_HBSP_P-B Product feature CHAIN KP148384_HBSP_P-B of FT:mat_peptide KP148384_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148385_HBSP_P-B Product feature CHAIN KP148385_HBSP_P-B of FT:mat_peptide KP148385_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148386_HBSP_P-B Product feature CHAIN KP148386_HBSP_P-B of FT:mat_peptide KP148386_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148387_HBSP_P-B Product feature CHAIN KP148387_HBSP_P-B of FT:mat_peptide KP148387_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPRPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148388_HBSP_P-B Product feature CHAIN KP148388_HBSP_P-B of FT:mat_peptide KP148388_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148389_HBSP_P-B Product feature CHAIN KP148389_HBSP_P-B of FT:mat_peptide KP148389_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148390_HBSP_P-B Product feature CHAIN KP148390_HBSP_P-B of FT:mat_peptide KP148390_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148391_HBSP_P-B Product feature CHAIN KP148391_HBSP_P-B of FT:mat_peptide KP148391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148392_HBSP_P-B Product feature CHAIN KP148392_HBSP_P-B of FT:mat_peptide KP148392_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148394_HBSP_P-B Product feature CHAIN KP148394_HBSP_P-B of FT:mat_peptide KP148394_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-50). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148395_HBSP_P-B Product feature CHAIN KP148395_HBSP_P-B of FT:mat_peptide KP148395_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148396_HBSP_P-B Product feature CHAIN KP148396_HBSP_P-B of FT:mat_peptide KP148396_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-58). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148397_HBSP_P-B Product feature CHAIN KP148397_HBSP_P-B of FT:mat_peptide KP148397_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148398_HBSP_P-B Product feature CHAIN KP148398_HBSP_P-B of FT:mat_peptide KP148398_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-60). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPRPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148399_HBSP_P-B Product feature CHAIN KP148399_HBSP_P-B of FT:mat_peptide KP148399_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-61). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148400_HBSP_P-B Product feature CHAIN KP148400_HBSP_P-B of FT:mat_peptide KP148400_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-65). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148401_HBSP_P-B Product feature CHAIN KP148401_HBSP_P-B of FT:mat_peptide KP148401_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
GTAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148402_HBSP_P-B Product feature CHAIN KP148402_HBSP_P-B of FT:mat_peptide KP148402_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-70). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148403_HBSP_P-B Product feature CHAIN KP148403_HBSP_P-B of FT:mat_peptide KP148403_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-71). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148405_HBSP_P-B Product feature CHAIN KP148405_HBSP_P-B of FT:mat_peptide KP148405_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSDGSGPQSVSLGSVY
>gnl|hbvpro|KP148406_HBSP_P-B Product feature CHAIN KP148406_HBSP_P-B of FT:mat_peptide KP148406_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148407_HBSP_P-B Product feature CHAIN KP148407_HBSP_P-B of FT:mat_peptide KP148407_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148409_HBSP_P-B Product feature CHAIN KP148409_HBSP_P-B of FT:mat_peptide KP148409_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148410_HBSP_P-B Product feature CHAIN KP148410_HBSP_P-B of FT:mat_peptide KP148410_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148411_HBSP_P-B Product feature CHAIN KP148411_HBSP_P-B of FT:mat_peptide KP148411_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-31). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148413_HBSP_P-B Product feature CHAIN KP148413_HBSP_P-B of FT:mat_peptide KP148413_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148414_HBSP_P-B Product feature CHAIN KP148414_HBSP_P-B of FT:mat_peptide KP148414_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148415_HBSP_P-B Product feature CHAIN KP148415_HBSP_P-B of FT:mat_peptide KP148415_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148416_HBSP_P-B Product feature CHAIN KP148416_HBSP_P-B of FT:mat_peptide KP148416_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148418_HBSP_P-B Product feature CHAIN KP148418_HBSP_P-B of FT:mat_peptide KP148418_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-58). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148419_HBSP_P-B Product feature CHAIN KP148419_HBSP_P-B of FT:mat_peptide KP148419_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148420_HBSP_P-B Product feature CHAIN KP148420_HBSP_P-B of FT:mat_peptide KP148420_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-66). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHRGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148421_HBSP_P-B Product feature CHAIN KP148421_HBSP_P-B of FT:mat_peptide KP148421_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-72). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148423_HBSP_P-B Product feature CHAIN KP148423_HBSP_P-B of FT:mat_peptide KP148423_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-86). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148424_HBSP_P-B Product feature CHAIN KP148424_HBSP_P-B of FT:mat_peptide KP148424_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-89). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148425_HBSP_P-B Product feature CHAIN KP148425_HBSP_P-B of FT:mat_peptide KP148425_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-90). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148426_HBSP_P-B Product feature CHAIN KP148426_HBSP_P-B of FT:mat_peptide KP148426_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-92). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSNQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148427_HBSP_P-B Product feature CHAIN KP148427_HBSP_P-B of FT:mat_peptide KP148427_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-94). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148429_HBSP_P-B Product feature CHAIN KP148429_HBSP_P-B of FT:mat_peptide KP148429_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-104). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPRCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148430_HBSP_P-B Product feature CHAIN KP148430_HBSP_P-B of FT:mat_peptide KP148430_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-105). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148432_HBSP_P-B Product feature CHAIN KP148432_HBSP_P-B of FT:mat_peptide KP148432_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-80). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148433_HBSP_P-B Product feature CHAIN KP148433_HBSP_P-B of FT:mat_peptide KP148433_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148435_HBSP_P-B Product feature CHAIN KP148435_HBSP_P-B of FT:mat_peptide KP148435_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148437_HBSP_P-B Product feature CHAIN KP148437_HBSP_P-B of FT:mat_peptide KP148437_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148438_HBSP_P-B Product feature CHAIN KP148438_HBSP_P-B of FT:mat_peptide KP148438_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDHNLGNLDDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148439_HBSP_P-B Product feature CHAIN KP148439_HBSP_P-B of FT:mat_peptide KP148439_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148440_HBSP_P-B Product feature CHAIN KP148440_HBSP_P-B of FT:mat_peptide KP148440_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP148451_HBSP_P-B Product feature CHAIN KP148451_HBSP_P-B of FT:mat_peptide KP148451_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y147-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148452_HBSP_P-B Product feature CHAIN KP148452_HBSP_P-B of FT:mat_peptide KP148452_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148453_HBSP_P-B Product feature CHAIN KP148453_HBSP_P-B of FT:mat_peptide KP148453_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-20). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNRRVAEDLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148455_HBSP_P-B Product feature CHAIN KP148455_HBSP_P-B of FT:mat_peptide KP148455_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148456_HBSP_P-B Product feature CHAIN KP148456_HBSP_P-B of FT:mat_peptide KP148456_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148457_HBSP_P-B Product feature CHAIN KP148457_HBSP_P-B of FT:mat_peptide KP148457_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148458_HBSP_P-B Product feature CHAIN KP148458_HBSP_P-B of FT:mat_peptide KP148458_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148459_HBSP_P-B Product feature CHAIN KP148459_HBSP_P-B of FT:mat_peptide KP148459_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAENLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148460_HBSP_P-B Product feature CHAIN KP148460_HBSP_P-B of FT:mat_peptide KP148460_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-20). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148461_HBSP_P-B Product feature CHAIN KP148461_HBSP_P-B of FT:mat_peptide KP148461_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQTPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148579_HBSP_P-B Product feature CHAIN KP148579_HBSP_P-B of FT:mat_peptide KP148579_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148580_HBSP_P-B Product feature CHAIN KP148580_HBSP_P-B of FT:mat_peptide KP148580_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148581_HBSP_P-B Product feature CHAIN KP148581_HBSP_P-B of FT:mat_peptide KP148581_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDLAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148582_HBSP_P-B Product feature CHAIN KP148582_HBSP_P-B of FT:mat_peptide KP148582_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148583_HBSP_P-B Product feature CHAIN KP148583_HBSP_P-B of FT:mat_peptide KP148583_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406162_HBSP_P-B Product feature CHAIN KP406162_HBSP_P-B of FT:mat_peptide KP406162_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406163_HBSP_P-B Product feature CHAIN KP406163_HBSP_P-B of FT:mat_peptide KP406163_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406164_HBSP_P-B Product feature CHAIN KP406164_HBSP_P-B of FT:mat_peptide KP406164_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRK
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSFY
>gnl|hbvpro|KP406165_HBSP_P-B Product feature CHAIN KP406165_HBSP_P-B of FT:mat_peptide KP406165_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406166_HBSP_P-B Product feature CHAIN KP406166_HBSP_P-B of FT:mat_peptide KP406166_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406167_HBSP_P-B Product feature CHAIN KP406167_HBSP_P-B of FT:mat_peptide KP406167_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQFVSLGSVY
>gnl|hbvpro|KP406168_HBSP_P-B Product feature CHAIN KP406168_HBSP_P-B of FT:mat_peptide KP406168_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406169_HBSP_P-B Product feature CHAIN KP406169_HBSP_P-B of FT:mat_peptide KP406169_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406170_HBSP_P-B Product feature CHAIN KP406170_HBSP_P-B of FT:mat_peptide KP406170_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSEPQSVSLGSVY
>gnl|hbvpro|KP406171_HBSP_P-B Product feature CHAIN KP406171_HBSP_P-B of FT:mat_peptide KP406171_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406172_HBSP_P-B Product feature CHAIN KP406172_HBSP_P-B of FT:mat_peptide KP406172_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406173_HBSP_P-B Product feature CHAIN KP406173_HBSP_P-B of FT:mat_peptide KP406173_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406174_HBSP_P-B Product feature CHAIN KP406174_HBSP_P-B of FT:mat_peptide KP406174_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_8). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRK
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406175_HBSP_P-B Product feature CHAIN KP406175_HBSP_P-B of FT:mat_peptide KP406175_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_9). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406220_HBSP_P-B Product feature CHAIN KP406220_HBSP_P-B of FT:mat_peptide KP406220_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406221_HBSP_P-B Product feature CHAIN KP406221_HBSP_P-B of FT:mat_peptide KP406221_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406222_HBSP_P-B Product feature CHAIN KP406222_HBSP_P-B of FT:mat_peptide KP406222_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406223_HBSP_P-B Product feature CHAIN KP406223_HBSP_P-B of FT:mat_peptide KP406223_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406224_HBSP_P-B Product feature CHAIN KP406224_HBSP_P-B of FT:mat_peptide KP406224_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406225_HBSP_P-B Product feature CHAIN KP406225_HBSP_P-B of FT:mat_peptide KP406225_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406226_HBSP_P-B Product feature CHAIN KP406226_HBSP_P-B of FT:mat_peptide KP406226_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406227_HBSP_P-B Product feature CHAIN KP406227_HBSP_P-B of FT:mat_peptide KP406227_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406228_HBSP_P-B Product feature CHAIN KP406228_HBSP_P-B of FT:mat_peptide KP406228_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406229_HBSP_P-B Product feature CHAIN KP406229_HBSP_P-B of FT:mat_peptide KP406229_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406230_HBSP_P-B Product feature CHAIN KP406230_HBSP_P-B of FT:mat_peptide KP406230_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406231_HBSP_P-B Product feature CHAIN KP406231_HBSP_P-B of FT:mat_peptide KP406231_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406232_HBSP_P-B Product feature CHAIN KP406232_HBSP_P-B of FT:mat_peptide KP406232_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406233_HBSP_P-B Product feature CHAIN KP406233_HBSP_P-B of FT:mat_peptide KP406233_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406234_HBSP_P-B Product feature CHAIN KP406234_HBSP_P-B of FT:mat_peptide KP406234_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406235_HBSP_P-B Product feature CHAIN KP406235_HBSP_P-B of FT:mat_peptide KP406235_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406236_HBSP_P-B Product feature CHAIN KP406236_HBSP_P-B of FT:mat_peptide KP406236_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406237_HBSP_P-B Product feature CHAIN KP406237_HBSP_P-B of FT:mat_peptide KP406237_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406238_HBSP_P-B Product feature CHAIN KP406238_HBSP_P-B of FT:mat_peptide KP406238_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406239_HBSP_P-B Product feature CHAIN KP406239_HBSP_P-B of FT:mat_peptide KP406239_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406240_HBSP_P-B Product feature CHAIN KP406240_HBSP_P-B of FT:mat_peptide KP406240_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406241_HBSP_P-B Product feature CHAIN KP406241_HBSP_P-B of FT:mat_peptide KP406241_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406242_HBSP_P-B Product feature CHAIN KP406242_HBSP_P-B of FT:mat_peptide KP406242_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406243_HBSP_P-B Product feature CHAIN KP406243_HBSP_P-B of FT:mat_peptide KP406243_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406244_HBSP_P-B Product feature CHAIN KP406244_HBSP_P-B of FT:mat_peptide KP406244_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406245_HBSP_P-B Product feature CHAIN KP406245_HBSP_P-B of FT:mat_peptide KP406245_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406246_HBSP_P-B Product feature CHAIN KP406246_HBSP_P-B of FT:mat_peptide KP406246_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406247_HBSP_P-B Product feature CHAIN KP406247_HBSP_P-B of FT:mat_peptide KP406247_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406248_HBSP_P-B Product feature CHAIN KP406248_HBSP_P-B of FT:mat_peptide KP406248_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406249_HBSP_P-B Product feature CHAIN KP406249_HBSP_P-B of FT:mat_peptide KP406249_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406250_HBSP_P-B Product feature CHAIN KP406250_HBSP_P-B of FT:mat_peptide KP406250_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406251_HBSP_P-B Product feature CHAIN KP406251_HBSP_P-B of FT:mat_peptide KP406251_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406252_HBSP_P-B Product feature CHAIN KP406252_HBSP_P-B of FT:mat_peptide KP406252_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406253_HBSP_P-B Product feature CHAIN KP406253_HBSP_P-B of FT:mat_peptide KP406253_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406254_HBSP_P-B Product feature CHAIN KP406254_HBSP_P-B of FT:mat_peptide KP406254_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406255_HBSP_P-B Product feature CHAIN KP406255_HBSP_P-B of FT:mat_peptide KP406255_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|KP406256_HBSP_P-B Product feature CHAIN KP406256_HBSP_P-B of FT:mat_peptide KP406256_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406257_HBSP_P-B Product feature CHAIN KP406257_HBSP_P-B of FT:mat_peptide KP406257_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406258_HBSP_P-B Product feature CHAIN KP406258_HBSP_P-B of FT:mat_peptide KP406258_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|KP406259_HBSP_P-B Product feature CHAIN KP406259_HBSP_P-B of FT:mat_peptide KP406259_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406260_HBSP_P-B Product feature CHAIN KP406260_HBSP_P-B of FT:mat_peptide KP406260_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406261_HBSP_P-B Product feature CHAIN KP406261_HBSP_P-B of FT:mat_peptide KP406261_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406262_HBSP_P-B Product feature CHAIN KP406262_HBSP_P-B of FT:mat_peptide KP406262_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406263_HBSP_P-B Product feature CHAIN KP406263_HBSP_P-B of FT:mat_peptide KP406263_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406264_HBSP_P-B Product feature CHAIN KP406264_HBSP_P-B of FT:mat_peptide KP406264_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|KP406265_HBSP_P-B Product feature CHAIN KP406265_HBSP_P-B of FT:mat_peptide KP406265_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSWPQSVSLGSVY
>gnl|hbvpro|KP406266_HBSP_P-B Product feature CHAIN KP406266_HBSP_P-B of FT:mat_peptide KP406266_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406267_HBSP_P-B Product feature CHAIN KP406267_HBSP_P-B of FT:mat_peptide KP406267_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406268_HBSP_P-B Product feature CHAIN KP406268_HBSP_P-B of FT:mat_peptide KP406268_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
KTALVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406269_HBSP_P-B Product feature CHAIN KP406269_HBSP_P-B of FT:mat_peptide KP406269_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_15). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406270_HBSP_P-B Product feature CHAIN KP406270_HBSP_P-B of FT:mat_peptide KP406270_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_16). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|KP406271_HBSP_P-B Product feature CHAIN KP406271_HBSP_P-B of FT:mat_peptide KP406271_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_17). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406272_HBSP_P-B Product feature CHAIN KP406272_HBSP_P-B of FT:mat_peptide KP406272_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406273_HBSP_P-B Product feature CHAIN KP406273_HBSP_P-B of FT:mat_peptide KP406273_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406274_HBSP_P-B Product feature CHAIN KP406274_HBSP_P-B of FT:mat_peptide KP406274_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_20). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSGPQSVSLGPVY
>gnl|hbvpro|KP406275_HBSP_P-B Product feature CHAIN KP406275_HBSP_P-B of FT:mat_peptide KP406275_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_21). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406276_HBSP_P-B Product feature CHAIN KP406276_HBSP_P-B of FT:mat_peptide KP406276_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_22). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406277_HBSP_P-B Product feature CHAIN KP406277_HBSP_P-B of FT:mat_peptide KP406277_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_23). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406278_HBSP_P-B Product feature CHAIN KP406278_HBSP_P-B of FT:mat_peptide KP406278_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|KP406280_HBSP_P-B Product feature CHAIN KP406280_HBSP_P-B of FT:mat_peptide KP406280_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|KP406281_HBSP_P-B Product feature CHAIN KP406281_HBSP_P-B of FT:mat_peptide KP406281_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406282_HBSP_P-B Product feature CHAIN KP406282_HBSP_P-B of FT:mat_peptide KP406282_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406283_HBSP_P-B Product feature CHAIN KP406283_HBSP_P-B of FT:mat_peptide KP406283_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406284_HBSP_P-B Product feature CHAIN KP406284_HBSP_P-B of FT:mat_peptide KP406284_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406285_HBSP_P-B Product feature CHAIN KP406285_HBSP_P-B of FT:mat_peptide KP406285_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406286_HBSP_P-B Product feature CHAIN KP406286_HBSP_P-B of FT:mat_peptide KP406286_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406287_HBSP_P-B Product feature CHAIN KP406287_HBSP_P-B of FT:mat_peptide KP406287_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406288_HBSP_P-B Product feature CHAIN KP406288_HBSP_P-B of FT:mat_peptide KP406288_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406289_HBSP_P-B Product feature CHAIN KP406289_HBSP_P-B of FT:mat_peptide KP406289_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406290_HBSP_P-B Product feature CHAIN KP406290_HBSP_P-B of FT:mat_peptide KP406290_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_10). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406291_HBSP_P-B Product feature CHAIN KP406291_HBSP_P-B of FT:mat_peptide KP406291_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_11). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406292_HBSP_P-B Product feature CHAIN KP406292_HBSP_P-B of FT:mat_peptide KP406292_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406293_HBSP_P-B Product feature CHAIN KP406293_HBSP_P-B of FT:mat_peptide KP406293_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406294_HBSP_P-B Product feature CHAIN KP406294_HBSP_P-B of FT:mat_peptide KP406294_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406296_HBSP_P-B Product feature CHAIN KP406296_HBSP_P-B of FT:mat_peptide KP406296_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406297_HBSP_P-B Product feature CHAIN KP406297_HBSP_P-B of FT:mat_peptide KP406297_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406298_HBSP_P-B Product feature CHAIN KP406298_HBSP_P-B of FT:mat_peptide KP406298_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCYPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406299_HBSP_P-B Product feature CHAIN KP406299_HBSP_P-B of FT:mat_peptide KP406299_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406300_HBSP_P-B Product feature CHAIN KP406300_HBSP_P-B of FT:mat_peptide KP406300_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406301_HBSP_P-B Product feature CHAIN KP406301_HBSP_P-B of FT:mat_peptide KP406301_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406302_HBSP_P-B Product feature CHAIN KP406302_HBSP_P-B of FT:mat_peptide KP406302_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406303_HBSP_P-B Product feature CHAIN KP406303_HBSP_P-B of FT:mat_peptide KP406303_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406304_HBSP_P-B Product feature CHAIN KP406304_HBSP_P-B of FT:mat_peptide KP406304_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406305_HBSP_P-B Product feature CHAIN KP406305_HBSP_P-B of FT:mat_peptide KP406305_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406306_HBSP_P-B Product feature CHAIN KP406306_HBSP_P-B of FT:mat_peptide KP406306_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406307_HBSP_P-B Product feature CHAIN KP406307_HBSP_P-B of FT:mat_peptide KP406307_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406308_HBSP_P-B Product feature CHAIN KP406308_HBSP_P-B of FT:mat_peptide KP406308_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406309_HBSP_P-B Product feature CHAIN KP406309_HBSP_P-B of FT:mat_peptide KP406309_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406310_HBSP_P-B Product feature CHAIN KP406310_HBSP_P-B of FT:mat_peptide KP406310_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406311_HBSP_P-B Product feature CHAIN KP406311_HBSP_P-B of FT:mat_peptide KP406311_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406312_HBSP_P-B Product feature CHAIN KP406312_HBSP_P-B of FT:mat_peptide KP406312_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406313_HBSP_P-B Product feature CHAIN KP406313_HBSP_P-B of FT:mat_peptide KP406313_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406314_HBSP_P-B Product feature CHAIN KP406314_HBSP_P-B of FT:mat_peptide KP406314_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP406315_HBSP_P-B Product feature CHAIN KP406315_HBSP_P-B of FT:mat_peptide KP406315_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406316_HBSP_P-B Product feature CHAIN KP406316_HBSP_P-B of FT:mat_peptide KP406316_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406317_HBSP_P-B Product feature CHAIN KP406317_HBSP_P-B of FT:mat_peptide KP406317_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_14). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406318_HBSP_P-B Product feature CHAIN KP406318_HBSP_P-B of FT:mat_peptide KP406318_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406319_HBSP_P-B Product feature CHAIN KP406319_HBSP_P-B of FT:mat_peptide KP406319_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406320_HBSP_P-B Product feature CHAIN KP406320_HBSP_P-B of FT:mat_peptide KP406320_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406321_HBSP_P-B Product feature CHAIN KP406321_HBSP_P-B of FT:mat_peptide KP406321_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406322_HBSP_P-B Product feature CHAIN KP406322_HBSP_P-B of FT:mat_peptide KP406322_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406323_HBSP_P-B Product feature CHAIN KP406323_HBSP_P-B of FT:mat_peptide KP406323_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406324_HBSP_P-B Product feature CHAIN KP406324_HBSP_P-B of FT:mat_peptide KP406324_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406325_HBSP_P-B Product feature CHAIN KP406325_HBSP_P-B of FT:mat_peptide KP406325_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406326_HBSP_P-B Product feature CHAIN KP406326_HBSP_P-B of FT:mat_peptide KP406326_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406327_HBSP_P-B Product feature CHAIN KP406327_HBSP_P-B of FT:mat_peptide KP406327_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406328_HBSP_P-B Product feature CHAIN KP406328_HBSP_P-B of FT:mat_peptide KP406328_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406329_HBSP_P-B Product feature CHAIN KP406329_HBSP_P-B of FT:mat_peptide KP406329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406330_HBSP_P-B Product feature CHAIN KP406330_HBSP_P-B of FT:mat_peptide KP406330_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406331_HBSP_P-B Product feature CHAIN KP406331_HBSP_P-B of FT:mat_peptide KP406331_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAAPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406332_HBSP_P-B Product feature CHAIN KP406332_HBSP_P-B of FT:mat_peptide KP406332_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406333_HBSP_P-B Product feature CHAIN KP406333_HBSP_P-B of FT:mat_peptide KP406333_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406334_HBSP_P-B Product feature CHAIN KP406334_HBSP_P-B of FT:mat_peptide KP406334_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP406335_HBSP_P-B Product feature CHAIN KP406335_HBSP_P-B of FT:mat_peptide KP406335_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659219_HBSP_P-B Product feature CHAIN KP659219_HBSP_P-B of FT:mat_peptide KP659219_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659220_HBSP_P-B Product feature CHAIN KP659220_HBSP_P-B of FT:mat_peptide KP659220_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKXPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659221_HBSP_P-B Product feature CHAIN KP659221_HBSP_P-B of FT:mat_peptide KP659221_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-8). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHAAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659223_HBSP_P-B Product feature CHAIN KP659223_HBSP_P-B of FT:mat_peptide KP659223_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHAAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659224_HBSP_P-B Product feature CHAIN KP659224_HBSP_P-B of FT:mat_peptide KP659224_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659234_HBSP_P-B Product feature CHAIN KP659234_HBSP_P-B of FT:mat_peptide KP659234_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1500). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLKEELPRLANENLNHRVAKNLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659235_HBSP_P-B Product feature CHAIN KP659235_HBSP_P-B of FT:mat_peptide KP659235_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1602). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLXEELPRLADEDLNHRVAXBLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659237_HBSP_P-B Product feature CHAIN KP659237_HBSP_P-B of FT:mat_peptide KP659237_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-2456). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659239_HBSP_P-B Product feature CHAIN KP659239_HBSP_P-B of FT:mat_peptide KP659239_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-3870). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNHRVAEDLNLGNPNDHQPPAPDHAKLARLLLKXPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659240_HBSP_P-B Product feature CHAIN KP659240_HBSP_P-B of FT:mat_peptide KP659240_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-2111_2012). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADXXLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659244_HBSP_P-B Product feature CHAIN KP659244_HBSP_P-B of FT:mat_peptide KP659244_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-621). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLXDEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659245_HBSP_P-B Product feature CHAIN KP659245_HBSP_P-B of FT:mat_peptide KP659245_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-571_2012). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNHRVAEELDLGIPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659246_HBSP_P-B Product feature CHAIN KP659246_HBSP_P-B of FT:mat_peptide KP659246_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-2611). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659247_HBSP_P-B Product feature CHAIN KP659247_HBSP_P-B of FT:mat_peptide KP659247_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-1290). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659248_HBSP_P-B Product feature CHAIN KP659248_HBSP_P-B of FT:mat_peptide KP659248_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU268). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659250_HBSP_P-B Product feature CHAIN KP659250_HBSP_P-B of FT:mat_peptide KP659250_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU2128). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQCFRKLLLLDDVTGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659251_HBSP_P-B Product feature CHAIN KP659251_HBSP_P-B of FT:mat_peptide KP659251_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU75). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPARDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659252_HBSP_P-B Product feature CHAIN KP659252_HBSP_P-B of FT:mat_peptide KP659252_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU795). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQYFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659253_HBSP_P-B Product feature CHAIN KP659253_HBSP_P-B of FT:mat_peptide KP659253_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU817). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQCFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP659255_HBSP_P-B Product feature CHAIN KP659255_HBSP_P-B of FT:mat_peptide KP659255_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU2144). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQPPARDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR152339_HBSP_P-B Product feature CHAIN KR152339_HBSP_P-B of FT:mat_peptide KR152339_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR232337_HBSP_P-B Product feature CHAIN KR232337_HBSP_P-B of FT:mat_peptide KR232337_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749820_HBSP_P-B Product feature CHAIN KT749820_HBSP_P-B of FT:mat_peptide KT749820_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FL22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KU234318_HBSP_P-B Product feature CHAIN KU234318_HBSP_P-B of FT:mat_peptide KU234318_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963799_HBSP_P-B Product feature CHAIN KU963799_HBSP_P-B of FT:mat_peptide KU963799_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963800_HBSP_P-B Product feature CHAIN KU963800_HBSP_P-B of FT:mat_peptide KU963800_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963801_HBSP_P-B Product feature CHAIN KU963801_HBSP_P-B of FT:mat_peptide KU963801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963802_HBSP_P-B Product feature CHAIN KU963802_HBSP_P-B of FT:mat_peptide KU963802_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963803_HBSP_P-B Product feature CHAIN KU963803_HBSP_P-B of FT:mat_peptide KU963803_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963804_HBSP_P-B Product feature CHAIN KU963804_HBSP_P-B of FT:mat_peptide KU963804_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963805_HBSP_P-B Product feature CHAIN KU963805_HBSP_P-B of FT:mat_peptide KU963805_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963806_HBSP_P-B Product feature CHAIN KU963806_HBSP_P-B of FT:mat_peptide KU963806_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963807_HBSP_P-B Product feature CHAIN KU963807_HBSP_P-B of FT:mat_peptide KU963807_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963808_HBSP_P-B Product feature CHAIN KU963808_HBSP_P-B of FT:mat_peptide KU963808_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963809_HBSP_P-B Product feature CHAIN KU963809_HBSP_P-B of FT:mat_peptide KU963809_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963810_HBSP_P-B Product feature CHAIN KU963810_HBSP_P-B of FT:mat_peptide KU963810_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963811_HBSP_P-B Product feature CHAIN KU963811_HBSP_P-B of FT:mat_peptide KU963811_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963812_HBSP_P-B Product feature CHAIN KU963812_HBSP_P-B of FT:mat_peptide KU963812_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963813_HBSP_P-B Product feature CHAIN KU963813_HBSP_P-B of FT:mat_peptide KU963813_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963814_HBSP_P-B Product feature CHAIN KU963814_HBSP_P-B of FT:mat_peptide KU963814_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963815_HBSP_P-B Product feature CHAIN KU963815_HBSP_P-B of FT:mat_peptide KU963815_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNXXXQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963816_HBSP_P-B Product feature CHAIN KU963816_HBSP_P-B of FT:mat_peptide KU963816_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963817_HBSP_P-B Product feature CHAIN KU963817_HBSP_P-B of FT:mat_peptide KU963817_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963818_HBSP_P-B Product feature CHAIN KU963818_HBSP_P-B of FT:mat_peptide KU963818_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963819_HBSP_P-B Product feature CHAIN KU963819_HBSP_P-B of FT:mat_peptide KU963819_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963820_HBSP_P-B Product feature CHAIN KU963820_HBSP_P-B of FT:mat_peptide KU963820_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963821_HBSP_P-B Product feature CHAIN KU963821_HBSP_P-B of FT:mat_peptide KU963821_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963822_HBSP_P-B Product feature CHAIN KU963822_HBSP_P-B of FT:mat_peptide KU963822_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963823_HBSP_P-B Product feature CHAIN KU963823_HBSP_P-B of FT:mat_peptide KU963823_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963824_HBSP_P-B Product feature CHAIN KU963824_HBSP_P-B of FT:mat_peptide KU963824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963825_HBSP_P-B Product feature CHAIN KU963825_HBSP_P-B of FT:mat_peptide KU963825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963826_HBSP_P-B Product feature CHAIN KU963826_HBSP_P-B of FT:mat_peptide KU963826_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963827_HBSP_P-B Product feature CHAIN KU963827_HBSP_P-B of FT:mat_peptide KU963827_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963828_HBSP_P-B Product feature CHAIN KU963828_HBSP_P-B of FT:mat_peptide KU963828_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963829_HBSP_P-B Product feature CHAIN KU963829_HBSP_P-B of FT:mat_peptide KU963829_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963830_HBSP_P-B Product feature CHAIN KU963830_HBSP_P-B of FT:mat_peptide KU963830_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963831_HBSP_P-B Product feature CHAIN KU963831_HBSP_P-B of FT:mat_peptide KU963831_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963832_HBSP_P-B Product feature CHAIN KU963832_HBSP_P-B of FT:mat_peptide KU963832_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963833_HBSP_P-B Product feature CHAIN KU963833_HBSP_P-B of FT:mat_peptide KU963833_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963834_HBSP_P-B Product feature CHAIN KU963834_HBSP_P-B of FT:mat_peptide KU963834_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963835_HBSP_P-B Product feature CHAIN KU963835_HBSP_P-B of FT:mat_peptide KU963835_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963836_HBSP_P-B Product feature CHAIN KU963836_HBSP_P-B of FT:mat_peptide KU963836_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963837_HBSP_P-B Product feature CHAIN KU963837_HBSP_P-B of FT:mat_peptide KU963837_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963838_HBSP_P-B Product feature CHAIN KU963838_HBSP_P-B of FT:mat_peptide KU963838_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963839_HBSP_P-B Product feature CHAIN KU963839_HBSP_P-B of FT:mat_peptide KU963839_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963840_HBSP_P-B Product feature CHAIN KU963840_HBSP_P-B of FT:mat_peptide KU963840_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963841_HBSP_P-B Product feature CHAIN KU963841_HBSP_P-B of FT:mat_peptide KU963841_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963842_HBSP_P-B Product feature CHAIN KU963842_HBSP_P-B of FT:mat_peptide KU963842_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963843_HBSP_P-B Product feature CHAIN KU963843_HBSP_P-B of FT:mat_peptide KU963843_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963844_HBSP_P-B Product feature CHAIN KU963844_HBSP_P-B of FT:mat_peptide KU963844_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963845_HBSP_P-B Product feature CHAIN KU963845_HBSP_P-B of FT:mat_peptide KU963845_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963846_HBSP_P-B Product feature CHAIN KU963846_HBSP_P-B of FT:mat_peptide KU963846_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963847_HBSP_P-B Product feature CHAIN KU963847_HBSP_P-B of FT:mat_peptide KU963847_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963848_HBSP_P-B Product feature CHAIN KU963848_HBSP_P-B of FT:mat_peptide KU963848_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963849_HBSP_P-B Product feature CHAIN KU963849_HBSP_P-B of FT:mat_peptide KU963849_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963850_HBSP_P-B Product feature CHAIN KU963850_HBSP_P-B of FT:mat_peptide KU963850_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963851_HBSP_P-B Product feature CHAIN KU963851_HBSP_P-B of FT:mat_peptide KU963851_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963852_HBSP_P-B Product feature CHAIN KU963852_HBSP_P-B of FT:mat_peptide KU963852_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963853_HBSP_P-B Product feature CHAIN KU963853_HBSP_P-B of FT:mat_peptide KU963853_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963854_HBSP_P-B Product feature CHAIN KU963854_HBSP_P-B of FT:mat_peptide KU963854_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPLPDHAKPAQLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963855_HBSP_P-B Product feature CHAIN KU963855_HBSP_P-B of FT:mat_peptide KU963855_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963945_HBSP_P-B Product feature CHAIN KU963945_HBSP_P-B of FT:mat_peptide KU963945_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963946_HBSP_P-B Product feature CHAIN KU963946_HBSP_P-B of FT:mat_peptide KU963946_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|KU963947_HBSP_P-B Product feature CHAIN KU963947_HBSP_P-B of FT:mat_peptide KU963947_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963949_HBSP_P-B Product feature CHAIN KU963949_HBSP_P-B of FT:mat_peptide KU963949_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963950_HBSP_P-B Product feature CHAIN KU963950_HBSP_P-B of FT:mat_peptide KU963950_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963951_HBSP_P-B Product feature CHAIN KU963951_HBSP_P-B of FT:mat_peptide KU963951_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963952_HBSP_P-B Product feature CHAIN KU963952_HBSP_P-B of FT:mat_peptide KU963952_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963953_HBSP_P-B Product feature CHAIN KU963953_HBSP_P-B of FT:mat_peptide KU963953_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963954_HBSP_P-B Product feature CHAIN KU963954_HBSP_P-B of FT:mat_peptide KU963954_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963956_HBSP_P-B Product feature CHAIN KU963956_HBSP_P-B of FT:mat_peptide KU963956_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963957_HBSP_P-B Product feature CHAIN KU963957_HBSP_P-B of FT:mat_peptide KU963957_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963958_HBSP_P-B Product feature CHAIN KU963958_HBSP_P-B of FT:mat_peptide KU963958_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963959_HBSP_P-B Product feature CHAIN KU963959_HBSP_P-B of FT:mat_peptide KU963959_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963960_HBSP_P-B Product feature CHAIN KU963960_HBSP_P-B of FT:mat_peptide KU963960_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963961_HBSP_P-B Product feature CHAIN KU963961_HBSP_P-B of FT:mat_peptide KU963961_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963962_HBSP_P-B Product feature CHAIN KU963962_HBSP_P-B of FT:mat_peptide KU963962_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963963_HBSP_P-B Product feature CHAIN KU963963_HBSP_P-B of FT:mat_peptide KU963963_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963964_HBSP_P-B Product feature CHAIN KU963964_HBSP_P-B of FT:mat_peptide KU963964_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963965_HBSP_P-B Product feature CHAIN KU963965_HBSP_P-B of FT:mat_peptide KU963965_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963966_HBSP_P-B Product feature CHAIN KU963966_HBSP_P-B of FT:mat_peptide KU963966_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963967_HBSP_P-B Product feature CHAIN KU963967_HBSP_P-B of FT:mat_peptide KU963967_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963968_HBSP_P-B Product feature CHAIN KU963968_HBSP_P-B of FT:mat_peptide KU963968_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963969_HBSP_P-B Product feature CHAIN KU963969_HBSP_P-B of FT:mat_peptide KU963969_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963970_HBSP_P-B Product feature CHAIN KU963970_HBSP_P-B of FT:mat_peptide KU963970_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963971_HBSP_P-B Product feature CHAIN KU963971_HBSP_P-B of FT:mat_peptide KU963971_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963972_HBSP_P-B Product feature CHAIN KU963972_HBSP_P-B of FT:mat_peptide KU963972_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963973_HBSP_P-B Product feature CHAIN KU963973_HBSP_P-B of FT:mat_peptide KU963973_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963974_HBSP_P-B Product feature CHAIN KU963974_HBSP_P-B of FT:mat_peptide KU963974_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963975_HBSP_P-B Product feature CHAIN KU963975_HBSP_P-B of FT:mat_peptide KU963975_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963976_HBSP_P-B Product feature CHAIN KU963976_HBSP_P-B of FT:mat_peptide KU963976_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963977_HBSP_P-B Product feature CHAIN KU963977_HBSP_P-B of FT:mat_peptide KU963977_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963978_HBSP_P-B Product feature CHAIN KU963978_HBSP_P-B of FT:mat_peptide KU963978_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963979_HBSP_P-B Product feature CHAIN KU963979_HBSP_P-B of FT:mat_peptide KU963979_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963980_HBSP_P-B Product feature CHAIN KU963980_HBSP_P-B of FT:mat_peptide KU963980_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963981_HBSP_P-B Product feature CHAIN KU963981_HBSP_P-B of FT:mat_peptide KU963981_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963982_HBSP_P-B Product feature CHAIN KU963982_HBSP_P-B of FT:mat_peptide KU963982_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963983_HBSP_P-B Product feature CHAIN KU963983_HBSP_P-B of FT:mat_peptide KU963983_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963984_HBSP_P-B Product feature CHAIN KU963984_HBSP_P-B of FT:mat_peptide KU963984_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963985_HBSP_P-B Product feature CHAIN KU963985_HBSP_P-B of FT:mat_peptide KU963985_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963986_HBSP_P-B Product feature CHAIN KU963986_HBSP_P-B of FT:mat_peptide KU963986_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963987_HBSP_P-B Product feature CHAIN KU963987_HBSP_P-B of FT:mat_peptide KU963987_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963988_HBSP_P-B Product feature CHAIN KU963988_HBSP_P-B of FT:mat_peptide KU963988_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU963989_HBSP_P-B Product feature CHAIN KU963989_HBSP_P-B of FT:mat_peptide KU963989_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964079_HBSP_P-B Product feature CHAIN KU964079_HBSP_P-B of FT:mat_peptide KU964079_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964080_HBSP_P-B Product feature CHAIN KU964080_HBSP_P-B of FT:mat_peptide KU964080_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964081_HBSP_P-B Product feature CHAIN KU964081_HBSP_P-B of FT:mat_peptide KU964081_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964082_HBSP_P-B Product feature CHAIN KU964082_HBSP_P-B of FT:mat_peptide KU964082_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964083_HBSP_P-B Product feature CHAIN KU964083_HBSP_P-B of FT:mat_peptide KU964083_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964084_HBSP_P-B Product feature CHAIN KU964084_HBSP_P-B of FT:mat_peptide KU964084_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964085_HBSP_P-B Product feature CHAIN KU964085_HBSP_P-B of FT:mat_peptide KU964085_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964086_HBSP_P-B Product feature CHAIN KU964086_HBSP_P-B of FT:mat_peptide KU964086_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964087_HBSP_P-B Product feature CHAIN KU964087_HBSP_P-B of FT:mat_peptide KU964087_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964088_HBSP_P-B Product feature CHAIN KU964088_HBSP_P-B of FT:mat_peptide KU964088_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964089_HBSP_P-B Product feature CHAIN KU964089_HBSP_P-B of FT:mat_peptide KU964089_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964090_HBSP_P-B Product feature CHAIN KU964090_HBSP_P-B of FT:mat_peptide KU964090_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964091_HBSP_P-B Product feature CHAIN KU964091_HBSP_P-B of FT:mat_peptide KU964091_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964092_HBSP_P-B Product feature CHAIN KU964092_HBSP_P-B of FT:mat_peptide KU964092_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964093_HBSP_P-B Product feature CHAIN KU964093_HBSP_P-B of FT:mat_peptide KU964093_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964094_HBSP_P-B Product feature CHAIN KU964094_HBSP_P-B of FT:mat_peptide KU964094_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964095_HBSP_P-B Product feature CHAIN KU964095_HBSP_P-B of FT:mat_peptide KU964095_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964096_HBSP_P-B Product feature CHAIN KU964096_HBSP_P-B of FT:mat_peptide KU964096_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964097_HBSP_P-B Product feature CHAIN KU964097_HBSP_P-B of FT:mat_peptide KU964097_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964099_HBSP_P-B Product feature CHAIN KU964099_HBSP_P-B of FT:mat_peptide KU964099_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964100_HBSP_P-B Product feature CHAIN KU964100_HBSP_P-B of FT:mat_peptide KU964100_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964101_HBSP_P-B Product feature CHAIN KU964101_HBSP_P-B of FT:mat_peptide KU964101_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964102_HBSP_P-B Product feature CHAIN KU964102_HBSP_P-B of FT:mat_peptide KU964102_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964103_HBSP_P-B Product feature CHAIN KU964103_HBSP_P-B of FT:mat_peptide KU964103_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964104_HBSP_P-B Product feature CHAIN KU964104_HBSP_P-B of FT:mat_peptide KU964104_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964105_HBSP_P-B Product feature CHAIN KU964105_HBSP_P-B of FT:mat_peptide KU964105_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964106_HBSP_P-B Product feature CHAIN KU964106_HBSP_P-B of FT:mat_peptide KU964106_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964107_HBSP_P-B Product feature CHAIN KU964107_HBSP_P-B of FT:mat_peptide KU964107_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964108_HBSP_P-B Product feature CHAIN KU964108_HBSP_P-B of FT:mat_peptide KU964108_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964109_HBSP_P-B Product feature CHAIN KU964109_HBSP_P-B of FT:mat_peptide KU964109_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964110_HBSP_P-B Product feature CHAIN KU964110_HBSP_P-B of FT:mat_peptide KU964110_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964111_HBSP_P-B Product feature CHAIN KU964111_HBSP_P-B of FT:mat_peptide KU964111_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964112_HBSP_P-B Product feature CHAIN KU964112_HBSP_P-B of FT:mat_peptide KU964112_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964113_HBSP_P-B Product feature CHAIN KU964113_HBSP_P-B of FT:mat_peptide KU964113_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964114_HBSP_P-B Product feature CHAIN KU964114_HBSP_P-B of FT:mat_peptide KU964114_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964115_HBSP_P-B Product feature CHAIN KU964115_HBSP_P-B of FT:mat_peptide KU964115_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964116_HBSP_P-B Product feature CHAIN KU964116_HBSP_P-B of FT:mat_peptide KU964116_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964117_HBSP_P-B Product feature CHAIN KU964117_HBSP_P-B of FT:mat_peptide KU964117_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_10). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964118_HBSP_P-B Product feature CHAIN KU964118_HBSP_P-B of FT:mat_peptide KU964118_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964119_HBSP_P-B Product feature CHAIN KU964119_HBSP_P-B of FT:mat_peptide KU964119_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964120_HBSP_P-B Product feature CHAIN KU964120_HBSP_P-B of FT:mat_peptide KU964120_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKLARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964121_HBSP_P-B Product feature CHAIN KU964121_HBSP_P-B of FT:mat_peptide KU964121_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964122_HBSP_P-B Product feature CHAIN KU964122_HBSP_P-B of FT:mat_peptide KU964122_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964123_HBSP_P-B Product feature CHAIN KU964123_HBSP_P-B of FT:mat_peptide KU964123_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964124_HBSP_P-B Product feature CHAIN KU964124_HBSP_P-B of FT:mat_peptide KU964124_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964125_HBSP_P-B Product feature CHAIN KU964125_HBSP_P-B of FT:mat_peptide KU964125_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964126_HBSP_P-B Product feature CHAIN KU964126_HBSP_P-B of FT:mat_peptide KU964126_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964127_HBSP_P-B Product feature CHAIN KU964127_HBSP_P-B of FT:mat_peptide KU964127_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964128_HBSP_P-B Product feature CHAIN KU964128_HBSP_P-B of FT:mat_peptide KU964128_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964129_HBSP_P-B Product feature CHAIN KU964129_HBSP_P-B of FT:mat_peptide KU964129_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964130_HBSP_P-B Product feature CHAIN KU964130_HBSP_P-B of FT:mat_peptide KU964130_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964131_HBSP_P-B Product feature CHAIN KU964131_HBSP_P-B of FT:mat_peptide KU964131_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964132_HBSP_P-B Product feature CHAIN KU964132_HBSP_P-B of FT:mat_peptide KU964132_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964133_HBSP_P-B Product feature CHAIN KU964133_HBSP_P-B of FT:mat_peptide KU964133_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964134_HBSP_P-B Product feature CHAIN KU964134_HBSP_P-B of FT:mat_peptide KU964134_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964135_HBSP_P-B Product feature CHAIN KU964135_HBSP_P-B of FT:mat_peptide KU964135_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964136_HBSP_P-B Product feature CHAIN KU964136_HBSP_P-B of FT:mat_peptide KU964136_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964137_HBSP_P-B Product feature CHAIN KU964137_HBSP_P-B of FT:mat_peptide KU964137_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_15). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964138_HBSP_P-B Product feature CHAIN KU964138_HBSP_P-B of FT:mat_peptide KU964138_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964139_HBSP_P-B Product feature CHAIN KU964139_HBSP_P-B of FT:mat_peptide KU964139_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964140_HBSP_P-B Product feature CHAIN KU964140_HBSP_P-B of FT:mat_peptide KU964140_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964141_HBSP_P-B Product feature CHAIN KU964141_HBSP_P-B of FT:mat_peptide KU964141_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLALSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964142_HBSP_P-B Product feature CHAIN KU964142_HBSP_P-B of FT:mat_peptide KU964142_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964143_HBSP_P-B Product feature CHAIN KU964143_HBSP_P-B of FT:mat_peptide KU964143_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964144_HBSP_P-B Product feature CHAIN KU964144_HBSP_P-B of FT:mat_peptide KU964144_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964145_HBSP_P-B Product feature CHAIN KU964145_HBSP_P-B of FT:mat_peptide KU964145_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964146_HBSP_P-B Product feature CHAIN KU964146_HBSP_P-B of FT:mat_peptide KU964146_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964147_HBSP_P-B Product feature CHAIN KU964147_HBSP_P-B of FT:mat_peptide KU964147_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964148_HBSP_P-B Product feature CHAIN KU964148_HBSP_P-B of FT:mat_peptide KU964148_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964149_HBSP_P-B Product feature CHAIN KU964149_HBSP_P-B of FT:mat_peptide KU964149_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964150_HBSP_P-B Product feature CHAIN KU964150_HBSP_P-B of FT:mat_peptide KU964150_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964151_HBSP_P-B Product feature CHAIN KU964151_HBSP_P-B of FT:mat_peptide KU964151_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964152_HBSP_P-B Product feature CHAIN KU964152_HBSP_P-B of FT:mat_peptide KU964152_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964153_HBSP_P-B Product feature CHAIN KU964153_HBSP_P-B of FT:mat_peptide KU964153_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964155_HBSP_P-B Product feature CHAIN KU964155_HBSP_P-B of FT:mat_peptide KU964155_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|KU964156_HBSP_P-B Product feature CHAIN KU964156_HBSP_P-B of FT:mat_peptide KU964156_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964157_HBSP_P-B Product feature CHAIN KU964157_HBSP_P-B of FT:mat_peptide KU964157_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARHAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964158_HBSP_P-B Product feature CHAIN KU964158_HBSP_P-B of FT:mat_peptide KU964158_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964159_HBSP_P-B Product feature CHAIN KU964159_HBSP_P-B of FT:mat_peptide KU964159_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964160_HBSP_P-B Product feature CHAIN KU964160_HBSP_P-B of FT:mat_peptide KU964160_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964161_HBSP_P-B Product feature CHAIN KU964161_HBSP_P-B of FT:mat_peptide KU964161_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964162_HBSP_P-B Product feature CHAIN KU964162_HBSP_P-B of FT:mat_peptide KU964162_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|KU964163_HBSP_P-B Product feature CHAIN KU964163_HBSP_P-B of FT:mat_peptide KU964163_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964164_HBSP_P-B Product feature CHAIN KU964164_HBSP_P-B of FT:mat_peptide KU964164_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964165_HBSP_P-B Product feature CHAIN KU964165_HBSP_P-B of FT:mat_peptide KU964165_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLKLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964166_HBSP_P-B Product feature CHAIN KU964166_HBSP_P-B of FT:mat_peptide KU964166_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964167_HBSP_P-B Product feature CHAIN KU964167_HBSP_P-B of FT:mat_peptide KU964167_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|KU964168_HBSP_P-B Product feature CHAIN KU964168_HBSP_P-B of FT:mat_peptide KU964168_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964244_HBSP_P-B Product feature CHAIN KU964244_HBSP_P-B of FT:mat_peptide KU964244_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964245_HBSP_P-B Product feature CHAIN KU964245_HBSP_P-B of FT:mat_peptide KU964245_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964246_HBSP_P-B Product feature CHAIN KU964246_HBSP_P-B of FT:mat_peptide KU964246_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964247_HBSP_P-B Product feature CHAIN KU964247_HBSP_P-B of FT:mat_peptide KU964247_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964248_HBSP_P-B Product feature CHAIN KU964248_HBSP_P-B of FT:mat_peptide KU964248_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964249_HBSP_P-B Product feature CHAIN KU964249_HBSP_P-B of FT:mat_peptide KU964249_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964251_HBSP_P-B Product feature CHAIN KU964251_HBSP_P-B of FT:mat_peptide KU964251_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964253_HBSP_P-B Product feature CHAIN KU964253_HBSP_P-B of FT:mat_peptide KU964253_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964254_HBSP_P-B Product feature CHAIN KU964254_HBSP_P-B of FT:mat_peptide KU964254_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964255_HBSP_P-B Product feature CHAIN KU964255_HBSP_P-B of FT:mat_peptide KU964255_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964256_HBSP_P-B Product feature CHAIN KU964256_HBSP_P-B of FT:mat_peptide KU964256_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964257_HBSP_P-B Product feature CHAIN KU964257_HBSP_P-B of FT:mat_peptide KU964257_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSIH
>gnl|hbvpro|KU964258_HBSP_P-B Product feature CHAIN KU964258_HBSP_P-B of FT:mat_peptide KU964258_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCYPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964259_HBSP_P-B Product feature CHAIN KU964259_HBSP_P-B of FT:mat_peptide KU964259_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964260_HBSP_P-B Product feature CHAIN KU964260_HBSP_P-B of FT:mat_peptide KU964260_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964261_HBSP_P-B Product feature CHAIN KU964261_HBSP_P-B of FT:mat_peptide KU964261_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964262_HBSP_P-B Product feature CHAIN KU964262_HBSP_P-B of FT:mat_peptide KU964262_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964263_HBSP_P-B Product feature CHAIN KU964263_HBSP_P-B of FT:mat_peptide KU964263_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964264_HBSP_P-B Product feature CHAIN KU964264_HBSP_P-B of FT:mat_peptide KU964264_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964265_HBSP_P-B Product feature CHAIN KU964265_HBSP_P-B of FT:mat_peptide KU964265_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFSHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964266_HBSP_P-B Product feature CHAIN KU964266_HBSP_P-B of FT:mat_peptide KU964266_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964267_HBSP_P-B Product feature CHAIN KU964267_HBSP_P-B of FT:mat_peptide KU964267_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964268_HBSP_P-B Product feature CHAIN KU964268_HBSP_P-B of FT:mat_peptide KU964268_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964269_HBSP_P-B Product feature CHAIN KU964269_HBSP_P-B of FT:mat_peptide KU964269_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964270_HBSP_P-B Product feature CHAIN KU964270_HBSP_P-B of FT:mat_peptide KU964270_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|KU964271_HBSP_P-B Product feature CHAIN KU964271_HBSP_P-B of FT:mat_peptide KU964271_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964287_HBSP_P-B Product feature CHAIN KU964287_HBSP_P-B of FT:mat_peptide KU964287_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964288_HBSP_P-B Product feature CHAIN KU964288_HBSP_P-B of FT:mat_peptide KU964288_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964289_HBSP_P-B Product feature CHAIN KU964289_HBSP_P-B of FT:mat_peptide KU964289_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964290_HBSP_P-B Product feature CHAIN KU964290_HBSP_P-B of FT:mat_peptide KU964290_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964291_HBSP_P-B Product feature CHAIN KU964291_HBSP_P-B of FT:mat_peptide KU964291_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964292_HBSP_P-B Product feature CHAIN KU964292_HBSP_P-B of FT:mat_peptide KU964292_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964293_HBSP_P-B Product feature CHAIN KU964293_HBSP_P-B of FT:mat_peptide KU964293_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|KU964294_HBSP_P-B Product feature CHAIN KU964294_HBSP_P-B of FT:mat_peptide KU964294_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964295_HBSP_P-B Product feature CHAIN KU964295_HBSP_P-B of FT:mat_peptide KU964295_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964296_HBSP_P-B Product feature CHAIN KU964296_HBSP_P-B of FT:mat_peptide KU964296_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964297_HBSP_P-B Product feature CHAIN KU964297_HBSP_P-B of FT:mat_peptide KU964297_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964298_HBSP_P-B Product feature CHAIN KU964298_HBSP_P-B of FT:mat_peptide KU964298_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964299_HBSP_P-B Product feature CHAIN KU964299_HBSP_P-B of FT:mat_peptide KU964299_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964300_HBSP_P-B Product feature CHAIN KU964300_HBSP_P-B of FT:mat_peptide KU964300_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964301_HBSP_P-B Product feature CHAIN KU964301_HBSP_P-B of FT:mat_peptide KU964301_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964302_HBSP_P-B Product feature CHAIN KU964302_HBSP_P-B of FT:mat_peptide KU964302_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPARDHAKPARLLLKDPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964381_HBSP_P-B Product feature CHAIN KU964381_HBSP_P-B of FT:mat_peptide KU964381_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964382_HBSP_P-B Product feature CHAIN KU964382_HBSP_P-B of FT:mat_peptide KU964382_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964383_HBSP_P-B Product feature CHAIN KU964383_HBSP_P-B of FT:mat_peptide KU964383_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964384_HBSP_P-B Product feature CHAIN KU964384_HBSP_P-B of FT:mat_peptide KU964384_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964385_HBSP_P-B Product feature CHAIN KU964385_HBSP_P-B of FT:mat_peptide KU964385_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964386_HBSP_P-B Product feature CHAIN KU964386_HBSP_P-B of FT:mat_peptide KU964386_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_8). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964387_HBSP_P-B Product feature CHAIN KU964387_HBSP_P-B of FT:mat_peptide KU964387_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_9). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964388_HBSP_P-B Product feature CHAIN KU964388_HBSP_P-B of FT:mat_peptide KU964388_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964389_HBSP_P-B Product feature CHAIN KU964389_HBSP_P-B of FT:mat_peptide KU964389_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964390_HBSP_P-B Product feature CHAIN KU964390_HBSP_P-B of FT:mat_peptide KU964390_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_12). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964391_HBSP_P-B Product feature CHAIN KU964391_HBSP_P-B of FT:mat_peptide KU964391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964392_HBSP_P-B Product feature CHAIN KU964392_HBSP_P-B of FT:mat_peptide KU964392_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_14). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964393_HBSP_P-B Product feature CHAIN KU964393_HBSP_P-B of FT:mat_peptide KU964393_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964394_HBSP_P-B Product feature CHAIN KU964394_HBSP_P-B of FT:mat_peptide KU964394_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964395_HBSP_P-B Product feature CHAIN KU964395_HBSP_P-B of FT:mat_peptide KU964395_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964396_HBSP_P-B Product feature CHAIN KU964396_HBSP_P-B of FT:mat_peptide KU964396_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_16). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU964397_HBSP_P-B Product feature CHAIN KU964397_HBSP_P-B of FT:mat_peptide KU964397_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276771_HBSP_P-B Product feature CHAIN KX276771_HBSP_P-B of FT:mat_peptide KX276771_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHRQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276772_HBSP_P-B Product feature CHAIN KX276772_HBSP_P-B of FT:mat_peptide KX276772_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVH
>gnl|hbvpro|KX276773_HBSP_P-B Product feature CHAIN KX276773_HBSP_P-B of FT:mat_peptide KX276773_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276775_HBSP_P-B Product feature CHAIN KX276775_HBSP_P-B of FT:mat_peptide KX276775_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276777_HBSP_P-B Product feature CHAIN KX276777_HBSP_P-B of FT:mat_peptide KX276777_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276778_HBSP_P-B Product feature CHAIN KX276778_HBSP_P-B of FT:mat_peptide KX276778_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276779_HBSP_P-B Product feature CHAIN KX276779_HBSP_P-B of FT:mat_peptide KX276779_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDZXAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276781_HBSP_P-B Product feature CHAIN KX276781_HBSP_P-B of FT:mat_peptide KX276781_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276782_HBSP_P-B Product feature CHAIN KX276782_HBSP_P-B of FT:mat_peptide KX276782_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQQPAPDHAKPAQRLLKETLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGXQSVSLGSVY
>gnl|hbvpro|KX276783_HBSP_P-B Product feature CHAIN KX276783_HBSP_P-B of FT:mat_peptide KX276783_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEAGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRXPAPDHAKPAQLLLKEXLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276784_HBSP_P-B Product feature CHAIN KX276784_HBSP_P-B of FT:mat_peptide KX276784_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276785_HBSP_P-B Product feature CHAIN KX276785_HBSP_P-B of FT:mat_peptide KX276785_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSXQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCXPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276786_HBSP_P-B Product feature CHAIN KX276786_HBSP_P-B of FT:mat_peptide KX276786_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGXSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276787_HBSP_P-B Product feature CHAIN KX276787_HBSP_P-B of FT:mat_peptide KX276787_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPXHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHXLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276788_HBSP_P-B Product feature CHAIN KX276788_HBSP_P-B of FT:mat_peptide KX276788_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276789_HBSP_P-B Product feature CHAIN KX276789_HBSP_P-B of FT:mat_peptide KX276789_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQRPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276790_HBSP_P-B Product feature CHAIN KX276790_HBSP_P-B of FT:mat_peptide KX276790_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276792_HBSP_P-B Product feature CHAIN KX276792_HBSP_P-B of FT:mat_peptide KX276792_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRXLLLLEZDAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQQPAPDHAKXARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276793_HBSP_P-B Product feature CHAIN KX276793_HBSP_P-B of FT:mat_peptide KX276793_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLXQGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276794_HBSP_P-B Product feature CHAIN KX276794_HBSP_P-B of FT:mat_peptide KX276794_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEXGPLEEELPRLADDDLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLXFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276795_HBSP_P-B Product feature CHAIN KX276795_HBSP_P-B of FT:mat_peptide KX276795_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYXXFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLXQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KX276796_HBSP_P-B Product feature CHAIN KX276796_HBSP_P-B of FT:mat_peptide KX276796_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHXQPAXDHAKPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276797_HBSP_P-B Product feature CHAIN KX276797_HBSP_P-B of FT:mat_peptide KX276797_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRXLLLLDKDAGPLEEELPRLADEGLNRRVAEDLXLGXLNDHQQPAPDHAKPARLLLKAPLCFPHVAVQNLRT
ETAXVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276798_HBSP_P-B Product feature CHAIN KX276798_HBSP_P-B of FT:mat_peptide KX276798_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHXQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|KX276799_HBSP_P-B Product feature CHAIN KX276799_HBSP_P-B of FT:mat_peptide KX276799_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAXLLLKEPLXFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276800_HBSP_P-B Product feature CHAIN KX276800_HBSP_P-B of FT:mat_peptide KX276800_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276801_HBSP_P-B Product feature CHAIN KX276801_HBSP_P-B of FT:mat_peptide KX276801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHRQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276802_HBSP_P-B Product feature CHAIN KX276802_HBSP_P-B of FT:mat_peptide KX276802_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFLKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKXAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276803_HBSP_P-B Product feature CHAIN KX276803_HBSP_P-B of FT:mat_peptide KX276803_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDKEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276804_HBSP_P-B Product feature CHAIN KX276804_HBSP_P-B of FT:mat_peptide KX276804_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLXXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KX276805_HBSP_P-B Product feature CHAIN KX276805_HBSP_P-B of FT:mat_peptide KX276805_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQXTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276806_HBSP_P-B Product feature CHAIN KX276806_HBSP_P-B of FT:mat_peptide KX276806_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQLFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPXXDHAKPAQXLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276807_HBSP_P-B Product feature CHAIN KX276807_HBSP_P-B of FT:mat_peptide KX276807_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYXXFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276808_HBSP_P-B Product feature CHAIN KX276808_HBSP_P-B of FT:mat_peptide KX276808_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276809_HBSP_P-B Product feature CHAIN KX276809_HBSP_P-B of FT:mat_peptide KX276809_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276810_HBSP_P-B Product feature CHAIN KX276810_HBSP_P-B of FT:mat_peptide KX276810_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276811_HBSP_P-B Product feature CHAIN KX276811_HBSP_P-B of FT:mat_peptide KX276811_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQLFRKLLLLDNEAGPLEEELPRLADEXLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|KX276812_HBSP_P-B Product feature CHAIN KX276812_HBSP_P-B of FT:mat_peptide KX276812_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNESGPLEEELPRLADEGLNRRVAEDLHLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276813_HBSP_P-B Product feature CHAIN KX276813_HBSP_P-B of FT:mat_peptide KX276813_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQXPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276814_HBSP_P-B Product feature CHAIN KX276814_HBSP_P-B of FT:mat_peptide KX276814_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHXLGLSQNXYGSGPQSVSLGXVX
>gnl|hbvpro|KX276815_HBSP_P-B Product feature CHAIN KX276815_HBSP_P-B of FT:mat_peptide KX276815_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KX276816_HBSP_P-B Product feature CHAIN KX276816_HBSP_P-B of FT:mat_peptide KX276816_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLXDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276817_HBSP_P-B Product feature CHAIN KX276817_HBSP_P-B of FT:mat_peptide KX276817_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLDLGXPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|KX276818_HBSP_P-B Product feature CHAIN KX276818_HBSP_P-B of FT:mat_peptide KX276818_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSXHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|KX276819_HBSP_P-B Product feature CHAIN KX276819_HBSP_P-B of FT:mat_peptide KX276819_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYXHFRRLVLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQPPAPDHAKPARLLLKGTLCFPHVAVQNLRT
ETAPVFPSXXLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276820_HBSP_P-B Product feature CHAIN KX276820_HBSP_P-B of FT:mat_peptide KX276820_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNXYGSGPQSVSLGSVY
>gnl|hbvpro|KX276822_HBSP_P-B Product feature CHAIN KX276822_HBSP_P-B of FT:mat_peptide KX276822_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276823_HBSP_P-B Product feature CHAIN KX276823_HBSP_P-B of FT:mat_peptide KX276823_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSXQHFRKLLLLDBDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KX276824_HBSP_P-B Product feature CHAIN KX276824_HBSP_P-B of FT:mat_peptide KX276824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLXLLDBEAGXLEEELPRLADEGLNRRVAEDLNLGXLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276825_HBSP_P-B Product feature CHAIN KX276825_HBSP_P-B of FT:mat_peptide KX276825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQCFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHRPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276827_HBSP_P-B Product feature CHAIN KX276827_HBSP_P-B of FT:mat_peptide KX276827_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPGHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276828_HBSP_P-B Product feature CHAIN KX276828_HBSP_P-B of FT:mat_peptide KX276828_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KX276829_HBSP_P-B Product feature CHAIN KX276829_HBSP_P-B of FT:mat_peptide KX276829_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MXLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276830_HBSP_P-B Product feature CHAIN KX276830_HBSP_P-B of FT:mat_peptide KX276830_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276858_HBSP_P-B Product feature CHAIN KX276858_HBSP_P-B of FT:mat_peptide KX276858_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDBXAGPLEEELPRLADEGLNRRVAEDLNLGBXXDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX765841_HBSP_P-B Product feature CHAIN KX765841_HBSP_P-B of FT:mat_peptide KX765841_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PID:1074). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX765856_HBSP_P-B Product feature CHAIN KX765856_HBSP_P-B of FT:mat_peptide KX765856_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PID:9231). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470830_HBSP_P-B Product feature CHAIN KY470830_HBSP_P-B of FT:mat_peptide KY470830_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-2-15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470832_HBSP_P-B Product feature CHAIN KY470832_HBSP_P-B of FT:mat_peptide KY470832_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470833_HBSP_P-B Product feature CHAIN KY470833_HBSP_P-B of FT:mat_peptide KY470833_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470834_HBSP_P-B Product feature CHAIN KY470834_HBSP_P-B of FT:mat_peptide KY470834_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470835_HBSP_P-B Product feature CHAIN KY470835_HBSP_P-B of FT:mat_peptide KY470835_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470836_HBSP_P-B Product feature CHAIN KY470836_HBSP_P-B of FT:mat_peptide KY470836_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E07). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470837_HBSP_P-B Product feature CHAIN KY470837_HBSP_P-B of FT:mat_peptide KY470837_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470838_HBSP_P-B Product feature CHAIN KY470838_HBSP_P-B of FT:mat_peptide KY470838_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470839_HBSP_P-B Product feature CHAIN KY470839_HBSP_P-B of FT:mat_peptide KY470839_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470840_HBSP_P-B Product feature CHAIN KY470840_HBSP_P-B of FT:mat_peptide KY470840_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470841_HBSP_P-B Product feature CHAIN KY470841_HBSP_P-B of FT:mat_peptide KY470841_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470953_HBSP_P-B Product feature CHAIN KY470953_HBSP_P-B of FT:mat_peptide KY470953_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470954_HBSP_P-B Product feature CHAIN KY470954_HBSP_P-B of FT:mat_peptide KY470954_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470956_HBSP_P-B Product feature CHAIN KY470956_HBSP_P-B of FT:mat_peptide KY470956_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-D2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470960_HBSP_P-B Product feature CHAIN KY470960_HBSP_P-B of FT:mat_peptide KY470960_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-E11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470961_HBSP_P-B Product feature CHAIN KY470961_HBSP_P-B of FT:mat_peptide KY470961_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-E8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY470962_HBSP_P-B Product feature CHAIN KY470962_HBSP_P-B of FT:mat_peptide KY470962_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-F10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLENLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY629636_HBSP_P-B Product feature CHAIN KY629636_HBSP_P-B of FT:mat_peptide KY629636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TYM03036). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPQAPGLAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881721_HBSP_P-B Product feature CHAIN KY881721_HBSP_P-B of FT:mat_peptide KY881721_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881722_HBSP_P-B Product feature CHAIN KY881722_HBSP_P-B of FT:mat_peptide KY881722_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881723_HBSP_P-B Product feature CHAIN KY881723_HBSP_P-B of FT:mat_peptide KY881723_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881724_HBSP_P-B Product feature CHAIN KY881724_HBSP_P-B of FT:mat_peptide KY881724_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881725_HBSP_P-B Product feature CHAIN KY881725_HBSP_P-B of FT:mat_peptide KY881725_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881726_HBSP_P-B Product feature CHAIN KY881726_HBSP_P-B of FT:mat_peptide KY881726_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881727_HBSP_P-B Product feature CHAIN KY881727_HBSP_P-B of FT:mat_peptide KY881727_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881728_HBSP_P-B Product feature CHAIN KY881728_HBSP_P-B of FT:mat_peptide KY881728_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881729_HBSP_P-B Product feature CHAIN KY881729_HBSP_P-B of FT:mat_peptide KY881729_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881730_HBSP_P-B Product feature CHAIN KY881730_HBSP_P-B of FT:mat_peptide KY881730_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881731_HBSP_P-B Product feature CHAIN KY881731_HBSP_P-B of FT:mat_peptide KY881731_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881732_HBSP_P-B Product feature CHAIN KY881732_HBSP_P-B of FT:mat_peptide KY881732_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881733_HBSP_P-B Product feature CHAIN KY881733_HBSP_P-B of FT:mat_peptide KY881733_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881734_HBSP_P-B Product feature CHAIN KY881734_HBSP_P-B of FT:mat_peptide KY881734_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881735_HBSP_P-B Product feature CHAIN KY881735_HBSP_P-B of FT:mat_peptide KY881735_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881740_HBSP_P-B Product feature CHAIN KY881740_HBSP_P-B of FT:mat_peptide KY881740_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881741_HBSP_P-B Product feature CHAIN KY881741_HBSP_P-B of FT:mat_peptide KY881741_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881745_HBSP_P-B Product feature CHAIN KY881745_HBSP_P-B of FT:mat_peptide KY881745_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881746_HBSP_P-B Product feature CHAIN KY881746_HBSP_P-B of FT:mat_peptide KY881746_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881747_HBSP_P-B Product feature CHAIN KY881747_HBSP_P-B of FT:mat_peptide KY881747_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881752_HBSP_P-B Product feature CHAIN KY881752_HBSP_P-B of FT:mat_peptide KY881752_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881753_HBSP_P-B Product feature CHAIN KY881753_HBSP_P-B of FT:mat_peptide KY881753_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881756_HBSP_P-B Product feature CHAIN KY881756_HBSP_P-B of FT:mat_peptide KY881756_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881757_HBSP_P-B Product feature CHAIN KY881757_HBSP_P-B of FT:mat_peptide KY881757_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881759_HBSP_P-B Product feature CHAIN KY881759_HBSP_P-B of FT:mat_peptide KY881759_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881760_HBSP_P-B Product feature CHAIN KY881760_HBSP_P-B of FT:mat_peptide KY881760_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881761_HBSP_P-B Product feature CHAIN KY881761_HBSP_P-B of FT:mat_peptide KY881761_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881778_HBSP_P-B Product feature CHAIN KY881778_HBSP_P-B of FT:mat_peptide KY881778_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881779_HBSP_P-B Product feature CHAIN KY881779_HBSP_P-B of FT:mat_peptide KY881779_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881780_HBSP_P-B Product feature CHAIN KY881780_HBSP_P-B of FT:mat_peptide KY881780_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881781_HBSP_P-B Product feature CHAIN KY881781_HBSP_P-B of FT:mat_peptide KY881781_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881782_HBSP_P-B Product feature CHAIN KY881782_HBSP_P-B of FT:mat_peptide KY881782_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881783_HBSP_P-B Product feature CHAIN KY881783_HBSP_P-B of FT:mat_peptide KY881783_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881784_HBSP_P-B Product feature CHAIN KY881784_HBSP_P-B of FT:mat_peptide KY881784_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881785_HBSP_P-B Product feature CHAIN KY881785_HBSP_P-B of FT:mat_peptide KY881785_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881786_HBSP_P-B Product feature CHAIN KY881786_HBSP_P-B of FT:mat_peptide KY881786_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881787_HBSP_P-B Product feature CHAIN KY881787_HBSP_P-B of FT:mat_peptide KY881787_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRP
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881788_HBSP_P-B Product feature CHAIN KY881788_HBSP_P-B of FT:mat_peptide KY881788_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881789_HBSP_P-B Product feature CHAIN KY881789_HBSP_P-B of FT:mat_peptide KY881789_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881790_HBSP_P-B Product feature CHAIN KY881790_HBSP_P-B of FT:mat_peptide KY881790_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCSPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881791_HBSP_P-B Product feature CHAIN KY881791_HBSP_P-B of FT:mat_peptide KY881791_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881792_HBSP_P-B Product feature CHAIN KY881792_HBSP_P-B of FT:mat_peptide KY881792_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLRNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881793_HBSP_P-B Product feature CHAIN KY881793_HBSP_P-B of FT:mat_peptide KY881793_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881794_HBSP_P-B Product feature CHAIN KY881794_HBSP_P-B of FT:mat_peptide KY881794_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARFLLKEPLCFPHVAAQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881795_HBSP_P-B Product feature CHAIN KY881795_HBSP_P-B of FT:mat_peptide KY881795_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDNAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881796_HBSP_P-B Product feature CHAIN KY881796_HBSP_P-B of FT:mat_peptide KY881796_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881797_HBSP_P-B Product feature CHAIN KY881797_HBSP_P-B of FT:mat_peptide KY881797_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881798_HBSP_P-B Product feature CHAIN KY881798_HBSP_P-B of FT:mat_peptide KY881798_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881799_HBSP_P-B Product feature CHAIN KY881799_HBSP_P-B of FT:mat_peptide KY881799_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881800_HBSP_P-B Product feature CHAIN KY881800_HBSP_P-B of FT:mat_peptide KY881800_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881801_HBSP_P-B Product feature CHAIN KY881801_HBSP_P-B of FT:mat_peptide KY881801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881808_HBSP_P-B Product feature CHAIN KY881808_HBSP_P-B of FT:mat_peptide KY881808_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPCSVY
>gnl|hbvpro|KY881820_HBSP_P-B Product feature CHAIN KY881820_HBSP_P-B of FT:mat_peptide KY881820_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881821_HBSP_P-B Product feature CHAIN KY881821_HBSP_P-B of FT:mat_peptide KY881821_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881822_HBSP_P-B Product feature CHAIN KY881822_HBSP_P-B of FT:mat_peptide KY881822_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881823_HBSP_P-B Product feature CHAIN KY881823_HBSP_P-B of FT:mat_peptide KY881823_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881824_HBSP_P-B Product feature CHAIN KY881824_HBSP_P-B of FT:mat_peptide KY881824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881825_HBSP_P-B Product feature CHAIN KY881825_HBSP_P-B of FT:mat_peptide KY881825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881826_HBSP_P-B Product feature CHAIN KY881826_HBSP_P-B of FT:mat_peptide KY881826_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881827_HBSP_P-B Product feature CHAIN KY881827_HBSP_P-B of FT:mat_peptide KY881827_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881828_HBSP_P-B Product feature CHAIN KY881828_HBSP_P-B of FT:mat_peptide KY881828_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881829_HBSP_P-B Product feature CHAIN KY881829_HBSP_P-B of FT:mat_peptide KY881829_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881830_HBSP_P-B Product feature CHAIN KY881830_HBSP_P-B of FT:mat_peptide KY881830_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881831_HBSP_P-B Product feature CHAIN KY881831_HBSP_P-B of FT:mat_peptide KY881831_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881833_HBSP_P-B Product feature CHAIN KY881833_HBSP_P-B of FT:mat_peptide KY881833_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881834_HBSP_P-B Product feature CHAIN KY881834_HBSP_P-B of FT:mat_peptide KY881834_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881835_HBSP_P-B Product feature CHAIN KY881835_HBSP_P-B of FT:mat_peptide KY881835_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881836_HBSP_P-B Product feature CHAIN KY881836_HBSP_P-B of FT:mat_peptide KY881836_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881837_HBSP_P-B Product feature CHAIN KY881837_HBSP_P-B of FT:mat_peptide KY881837_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEKLPRLADEGLNRRVAEDLNLENLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881838_HBSP_P-B Product feature CHAIN KY881838_HBSP_P-B of FT:mat_peptide KY881838_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881839_HBSP_P-B Product feature CHAIN KY881839_HBSP_P-B of FT:mat_peptide KY881839_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881841_HBSP_P-B Product feature CHAIN KY881841_HBSP_P-B of FT:mat_peptide KY881841_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPIFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881842_HBSP_P-B Product feature CHAIN KY881842_HBSP_P-B of FT:mat_peptide KY881842_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881843_HBSP_P-B Product feature CHAIN KY881843_HBSP_P-B of FT:mat_peptide KY881843_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881844_HBSP_P-B Product feature CHAIN KY881844_HBSP_P-B of FT:mat_peptide KY881844_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881845_HBSP_P-B Product feature CHAIN KY881845_HBSP_P-B of FT:mat_peptide KY881845_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDRAKPAQLLLKEPLCFPHVTVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KY881846_HBSP_P-B Product feature CHAIN KY881846_HBSP_P-B of FT:mat_peptide KY881846_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDRAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881847_HBSP_P-B Product feature CHAIN KY881847_HBSP_P-B of FT:mat_peptide KY881847_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881848_HBSP_P-B Product feature CHAIN KY881848_HBSP_P-B of FT:mat_peptide KY881848_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881849_HBSP_P-B Product feature CHAIN KY881849_HBSP_P-B of FT:mat_peptide KY881849_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDRAEPAQLLLKEPLCFPHVTVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KY881850_HBSP_P-B Product feature CHAIN KY881850_HBSP_P-B of FT:mat_peptide KY881850_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881851_HBSP_P-B Product feature CHAIN KY881851_HBSP_P-B of FT:mat_peptide KY881851_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCSPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881852_HBSP_P-B Product feature CHAIN KY881852_HBSP_P-B of FT:mat_peptide KY881852_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881853_HBSP_P-B Product feature CHAIN KY881853_HBSP_P-B of FT:mat_peptide KY881853_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDRAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KY881854_HBSP_P-B Product feature CHAIN KY881854_HBSP_P-B of FT:mat_peptide KY881854_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881855_HBSP_P-B Product feature CHAIN KY881855_HBSP_P-B of FT:mat_peptide KY881855_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881856_HBSP_P-B Product feature CHAIN KY881856_HBSP_P-B of FT:mat_peptide KY881856_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881857_HBSP_P-B Product feature CHAIN KY881857_HBSP_P-B of FT:mat_peptide KY881857_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881858_HBSP_P-B Product feature CHAIN KY881858_HBSP_P-B of FT:mat_peptide KY881858_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881859_HBSP_P-B Product feature CHAIN KY881859_HBSP_P-B of FT:mat_peptide KY881859_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881860_HBSP_P-B Product feature CHAIN KY881860_HBSP_P-B of FT:mat_peptide KY881860_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881861_HBSP_P-B Product feature CHAIN KY881861_HBSP_P-B of FT:mat_peptide KY881861_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVSEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881862_HBSP_P-B Product feature CHAIN KY881862_HBSP_P-B of FT:mat_peptide KY881862_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLSRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881863_HBSP_P-B Product feature CHAIN KY881863_HBSP_P-B of FT:mat_peptide KY881863_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881864_HBSP_P-B Product feature CHAIN KY881864_HBSP_P-B of FT:mat_peptide KY881864_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDRAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KY881865_HBSP_P-B Product feature CHAIN KY881865_HBSP_P-B of FT:mat_peptide KY881865_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDRAKPAQLPLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881866_HBSP_P-B Product feature CHAIN KY881866_HBSP_P-B of FT:mat_peptide KY881866_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881867_HBSP_P-B Product feature CHAIN KY881867_HBSP_P-B of FT:mat_peptide KY881867_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFLHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881868_HBSP_P-B Product feature CHAIN KY881868_HBSP_P-B of FT:mat_peptide KY881868_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881869_HBSP_P-B Product feature CHAIN KY881869_HBSP_P-B of FT:mat_peptide KY881869_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDRAKPAQLLLKEPLCFPHVAVQNLRT
EAAPVFPSHHLGLLQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881893_HBSP_P-B Product feature CHAIN KY881893_HBSP_P-B of FT:mat_peptide KY881893_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881894_HBSP_P-B Product feature CHAIN KY881894_HBSP_P-B of FT:mat_peptide KY881894_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881895_HBSP_P-B Product feature CHAIN KY881895_HBSP_P-B of FT:mat_peptide KY881895_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881896_HBSP_P-B Product feature CHAIN KY881896_HBSP_P-B of FT:mat_peptide KY881896_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881897_HBSP_P-B Product feature CHAIN KY881897_HBSP_P-B of FT:mat_peptide KY881897_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881898_HBSP_P-B Product feature CHAIN KY881898_HBSP_P-B of FT:mat_peptide KY881898_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881899_HBSP_P-B Product feature CHAIN KY881899_HBSP_P-B of FT:mat_peptide KY881899_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881900_HBSP_P-B Product feature CHAIN KY881900_HBSP_P-B of FT:mat_peptide KY881900_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881901_HBSP_P-B Product feature CHAIN KY881901_HBSP_P-B of FT:mat_peptide KY881901_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881902_HBSP_P-B Product feature CHAIN KY881902_HBSP_P-B of FT:mat_peptide KY881902_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881903_HBSP_P-B Product feature CHAIN KY881903_HBSP_P-B of FT:mat_peptide KY881903_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881904_HBSP_P-B Product feature CHAIN KY881904_HBSP_P-B of FT:mat_peptide KY881904_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881905_HBSP_P-B Product feature CHAIN KY881905_HBSP_P-B of FT:mat_peptide KY881905_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881906_HBSP_P-B Product feature CHAIN KY881906_HBSP_P-B of FT:mat_peptide KY881906_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881907_HBSP_P-B Product feature CHAIN KY881907_HBSP_P-B of FT:mat_peptide KY881907_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881908_HBSP_P-B Product feature CHAIN KY881908_HBSP_P-B of FT:mat_peptide KY881908_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881909_HBSP_P-B Product feature CHAIN KY881909_HBSP_P-B of FT:mat_peptide KY881909_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881910_HBSP_P-B Product feature CHAIN KY881910_HBSP_P-B of FT:mat_peptide KY881910_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881911_HBSP_P-B Product feature CHAIN KY881911_HBSP_P-B of FT:mat_peptide KY881911_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881912_HBSP_P-B Product feature CHAIN KY881912_HBSP_P-B of FT:mat_peptide KY881912_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881913_HBSP_P-B Product feature CHAIN KY881913_HBSP_P-B of FT:mat_peptide KY881913_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSIGSVY
>gnl|hbvpro|KY881914_HBSP_P-B Product feature CHAIN KY881914_HBSP_P-B of FT:mat_peptide KY881914_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881944_HBSP_P-B Product feature CHAIN KY881944_HBSP_P-B of FT:mat_peptide KY881944_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881945_HBSP_P-B Product feature CHAIN KY881945_HBSP_P-B of FT:mat_peptide KY881945_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881946_HBSP_P-B Product feature CHAIN KY881946_HBSP_P-B of FT:mat_peptide KY881946_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881947_HBSP_P-B Product feature CHAIN KY881947_HBSP_P-B of FT:mat_peptide KY881947_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881948_HBSP_P-B Product feature CHAIN KY881948_HBSP_P-B of FT:mat_peptide KY881948_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881949_HBSP_P-B Product feature CHAIN KY881949_HBSP_P-B of FT:mat_peptide KY881949_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881950_HBSP_P-B Product feature CHAIN KY881950_HBSP_P-B of FT:mat_peptide KY881950_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881951_HBSP_P-B Product feature CHAIN KY881951_HBSP_P-B of FT:mat_peptide KY881951_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881952_HBSP_P-B Product feature CHAIN KY881952_HBSP_P-B of FT:mat_peptide KY881952_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881953_HBSP_P-B Product feature CHAIN KY881953_HBSP_P-B of FT:mat_peptide KY881953_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881954_HBSP_P-B Product feature CHAIN KY881954_HBSP_P-B of FT:mat_peptide KY881954_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881955_HBSP_P-B Product feature CHAIN KY881955_HBSP_P-B of FT:mat_peptide KY881955_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881956_HBSP_P-B Product feature CHAIN KY881956_HBSP_P-B of FT:mat_peptide KY881956_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881957_HBSP_P-B Product feature CHAIN KY881957_HBSP_P-B of FT:mat_peptide KY881957_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRIAEDLNLGNLNDHQPPAPDHAEPARLLLKGPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY881958_HBSP_P-B Product feature CHAIN KY881958_HBSP_P-B of FT:mat_peptide KY881958_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC279268_HBSP_P-B Product feature CHAIN LC279268_HBSP_P-B of FT:mat_peptide LC279268_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_1st_child_serum). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC279269_HBSP_P-B Product feature CHAIN LC279269_HBSP_P-B of FT:mat_peptide LC279269_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_1st_child_UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC279270_HBSP_P-B Product feature CHAIN LC279270_HBSP_P-B of FT:mat_peptide LC279270_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_2nd_child_serum). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC279271_HBSP_P-B Product feature CHAIN LC279271_HBSP_P-B of FT:mat_peptide LC279271_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_2nd_child_UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC279272_HBSP_P-B Product feature CHAIN LC279272_HBSP_P-B of FT:mat_peptide LC279272_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_3rd_child_UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC279273_HBSP_P-B Product feature CHAIN LC279273_HBSP_P-B of FT:mat_peptide LC279273_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_mother_serum). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349868_HBSP_P-B Product feature CHAIN LC349868_HBSP_P-B of FT:mat_peptide LC349868_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349869_HBSP_P-B Product feature CHAIN LC349869_HBSP_P-B of FT:mat_peptide LC349869_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349870_HBSP_P-B Product feature CHAIN LC349870_HBSP_P-B of FT:mat_peptide LC349870_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|LC349871_HBSP_P-B Product feature CHAIN LC349871_HBSP_P-B of FT:mat_peptide LC349871_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349872_HBSP_P-B Product feature CHAIN LC349872_HBSP_P-B of FT:mat_peptide LC349872_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349873_HBSP_P-B Product feature CHAIN LC349873_HBSP_P-B of FT:mat_peptide LC349873_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349874_HBSP_P-B Product feature CHAIN LC349874_HBSP_P-B of FT:mat_peptide LC349874_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349875_HBSP_P-B Product feature CHAIN LC349875_HBSP_P-B of FT:mat_peptide LC349875_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349877_HBSP_P-B Product feature CHAIN LC349877_HBSP_P-B of FT:mat_peptide LC349877_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349878_HBSP_P-B Product feature CHAIN LC349878_HBSP_P-B of FT:mat_peptide LC349878_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC349879_HBSP_P-B Product feature CHAIN LC349879_HBSP_P-B of FT:mat_peptide LC349879_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC416037_HBSP_P-B Product feature CHAIN LC416037_HBSP_P-B of FT:mat_peptide LC416037_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TKI_2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LT992442_HBSP_P-B Product feature CHAIN LT992442_HBSP_P-B of FT:mat_peptide LT992442_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate DA45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPAPDHAEXARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|M54923_HBSP_P-B Product feature CHAIN M54923_HBSP_P-B of FT:mat_peptide M54923_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRPVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674382_HBSP_P-B Product feature CHAIN MF674382_HBSP_P-B of FT:mat_peptide MF674382_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040003). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674383_HBSP_P-B Product feature CHAIN MF674383_HBSP_P-B of FT:mat_peptide MF674383_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040005). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674384_HBSP_P-B Product feature CHAIN MF674384_HBSP_P-B of FT:mat_peptide MF674384_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040008). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674385_HBSP_P-B Product feature CHAIN MF674385_HBSP_P-B of FT:mat_peptide MF674385_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674387_HBSP_P-B Product feature CHAIN MF674387_HBSP_P-B of FT:mat_peptide MF674387_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040013). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674389_HBSP_P-B Product feature CHAIN MF674389_HBSP_P-B of FT:mat_peptide MF674389_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040016). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674391_HBSP_P-B Product feature CHAIN MF674391_HBSP_P-B of FT:mat_peptide MF674391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040022). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674392_HBSP_P-B Product feature CHAIN MF674392_HBSP_P-B of FT:mat_peptide MF674392_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040023). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674393_HBSP_P-B Product feature CHAIN MF674393_HBSP_P-B of FT:mat_peptide MF674393_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040024). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674394_HBSP_P-B Product feature CHAIN MF674394_HBSP_P-B of FT:mat_peptide MF674394_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040025). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674395_HBSP_P-B Product feature CHAIN MF674395_HBSP_P-B of FT:mat_peptide MF674395_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674396_HBSP_P-B Product feature CHAIN MF674396_HBSP_P-B of FT:mat_peptide MF674396_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040027). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEHARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674397_HBSP_P-B Product feature CHAIN MF674397_HBSP_P-B of FT:mat_peptide MF674397_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040028). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674400_HBSP_P-B Product feature CHAIN MF674400_HBSP_P-B of FT:mat_peptide MF674400_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040031). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674401_HBSP_P-B Product feature CHAIN MF674401_HBSP_P-B of FT:mat_peptide MF674401_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040033). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAQDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674404_HBSP_P-B Product feature CHAIN MF674404_HBSP_P-B of FT:mat_peptide MF674404_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040037). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674405_HBSP_P-B Product feature CHAIN MF674405_HBSP_P-B of FT:mat_peptide MF674405_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040038). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674406_HBSP_P-B Product feature CHAIN MF674406_HBSP_P-B of FT:mat_peptide MF674406_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040042). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|MF674407_HBSP_P-B Product feature CHAIN MF674407_HBSP_P-B of FT:mat_peptide MF674407_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040043). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEDLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|MF674409_HBSP_P-B Product feature CHAIN MF674409_HBSP_P-B of FT:mat_peptide MF674409_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040047). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674410_HBSP_P-B Product feature CHAIN MF674410_HBSP_P-B of FT:mat_peptide MF674410_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040048). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674413_HBSP_P-B Product feature CHAIN MF674413_HBSP_P-B of FT:mat_peptide MF674413_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040058). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674414_HBSP_P-B Product feature CHAIN MF674414_HBSP_P-B of FT:mat_peptide MF674414_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040060). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674415_HBSP_P-B Product feature CHAIN MF674415_HBSP_P-B of FT:mat_peptide MF674415_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040061). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674416_HBSP_P-B Product feature CHAIN MF674416_HBSP_P-B of FT:mat_peptide MF674416_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040063). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674419_HBSP_P-B Product feature CHAIN MF674419_HBSP_P-B of FT:mat_peptide MF674419_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040069). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQPPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674420_HBSP_P-B Product feature CHAIN MF674420_HBSP_P-B of FT:mat_peptide MF674420_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040071). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGDLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674421_HBSP_P-B Product feature CHAIN MF674421_HBSP_P-B of FT:mat_peptide MF674421_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040075). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674422_HBSP_P-B Product feature CHAIN MF674422_HBSP_P-B of FT:mat_peptide MF674422_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040076). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674423_HBSP_P-B Product feature CHAIN MF674423_HBSP_P-B of FT:mat_peptide MF674423_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040078). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674424_HBSP_P-B Product feature CHAIN MF674424_HBSP_P-B of FT:mat_peptide MF674424_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040080). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674426_HBSP_P-B Product feature CHAIN MF674426_HBSP_P-B of FT:mat_peptide MF674426_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040083). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674427_HBSP_P-B Product feature CHAIN MF674427_HBSP_P-B of FT:mat_peptide MF674427_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040084). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674431_HBSP_P-B Product feature CHAIN MF674431_HBSP_P-B of FT:mat_peptide MF674431_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040090). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674432_HBSP_P-B Product feature CHAIN MF674432_HBSP_P-B of FT:mat_peptide MF674432_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040093). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674433_HBSP_P-B Product feature CHAIN MF674433_HBSP_P-B of FT:mat_peptide MF674433_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040099). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674434_HBSP_P-B Product feature CHAIN MF674434_HBSP_P-B of FT:mat_peptide MF674434_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040100). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674436_HBSP_P-B Product feature CHAIN MF674436_HBSP_P-B of FT:mat_peptide MF674436_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050007). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674437_HBSP_P-B Product feature CHAIN MF674437_HBSP_P-B of FT:mat_peptide MF674437_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050008). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEELNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674438_HBSP_P-B Product feature CHAIN MF674438_HBSP_P-B of FT:mat_peptide MF674438_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050023). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674439_HBSP_P-B Product feature CHAIN MF674439_HBSP_P-B of FT:mat_peptide MF674439_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050024). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLSLGTPNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674440_HBSP_P-B Product feature CHAIN MF674440_HBSP_P-B of FT:mat_peptide MF674440_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050025). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674441_HBSP_P-B Product feature CHAIN MF674441_HBSP_P-B of FT:mat_peptide MF674441_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050034). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674443_HBSP_P-B Product feature CHAIN MF674443_HBSP_P-B of FT:mat_peptide MF674443_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050051). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674445_HBSP_P-B Product feature CHAIN MF674445_HBSP_P-B of FT:mat_peptide MF674445_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674446_HBSP_P-B Product feature CHAIN MF674446_HBSP_P-B of FT:mat_peptide MF674446_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050056). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNEHQPPAPAHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674447_HBSP_P-B Product feature CHAIN MF674447_HBSP_P-B of FT:mat_peptide MF674447_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050057). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674448_HBSP_P-B Product feature CHAIN MF674448_HBSP_P-B of FT:mat_peptide MF674448_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050059). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674449_HBSP_P-B Product feature CHAIN MF674449_HBSP_P-B of FT:mat_peptide MF674449_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050060). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674450_HBSP_P-B Product feature CHAIN MF674450_HBSP_P-B of FT:mat_peptide MF674450_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050067). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674451_HBSP_P-B Product feature CHAIN MF674451_HBSP_P-B of FT:mat_peptide MF674451_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050068). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674452_HBSP_P-B Product feature CHAIN MF674452_HBSP_P-B of FT:mat_peptide MF674452_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050071). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674453_HBSP_P-B Product feature CHAIN MF674453_HBSP_P-B of FT:mat_peptide MF674453_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050074). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674455_HBSP_P-B Product feature CHAIN MF674455_HBSP_P-B of FT:mat_peptide MF674455_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050077). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADESLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674456_HBSP_P-B Product feature CHAIN MF674456_HBSP_P-B of FT:mat_peptide MF674456_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050079). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674459_HBSP_P-B Product feature CHAIN MF674459_HBSP_P-B of FT:mat_peptide MF674459_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050082). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674460_HBSP_P-B Product feature CHAIN MF674460_HBSP_P-B of FT:mat_peptide MF674460_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050083). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674461_HBSP_P-B Product feature CHAIN MF674461_HBSP_P-B of FT:mat_peptide MF674461_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050084). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674462_HBSP_P-B Product feature CHAIN MF674462_HBSP_P-B of FT:mat_peptide MF674462_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050085). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQITYGSGPQSVSLGSVY
>gnl|hbvpro|MF674464_HBSP_P-B Product feature CHAIN MF674464_HBSP_P-B of FT:mat_peptide MF674464_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050087). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674465_HBSP_P-B Product feature CHAIN MF674465_HBSP_P-B of FT:mat_peptide MF674465_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050091). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674466_HBSP_P-B Product feature CHAIN MF674466_HBSP_P-B of FT:mat_peptide MF674466_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050092). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674469_HBSP_P-B Product feature CHAIN MF674469_HBSP_P-B of FT:mat_peptide MF674469_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVM0614). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674470_HBSP_P-B Product feature CHAIN MF674470_HBSP_P-B of FT:mat_peptide MF674470_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVM1014). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674473_HBSP_P-B Product feature CHAIN MF674473_HBSP_P-B of FT:mat_peptide MF674473_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVVZ0514). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPQAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674476_HBSP_P-B Product feature CHAIN MF674476_HBSP_P-B of FT:mat_peptide MF674476_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN02A0827). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF674477_HBSP_P-B Product feature CHAIN MF674477_HBSP_P-B of FT:mat_peptide MF674477_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0023). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674478_HBSP_P-B Product feature CHAIN MF674478_HBSP_P-B of FT:mat_peptide MF674478_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0142). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQPPAPDHAEPARVLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674479_HBSP_P-B Product feature CHAIN MF674479_HBSP_P-B of FT:mat_peptide MF674479_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0296). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674480_HBSP_P-B Product feature CHAIN MF674480_HBSP_P-B of FT:mat_peptide MF674480_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0313). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674481_HBSP_P-B Product feature CHAIN MF674481_HBSP_P-B of FT:mat_peptide MF674481_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0315). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674482_HBSP_P-B Product feature CHAIN MF674482_HBSP_P-B of FT:mat_peptide MF674482_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0321). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674483_HBSP_P-B Product feature CHAIN MF674483_HBSP_P-B of FT:mat_peptide MF674483_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0352). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674485_HBSP_P-B Product feature CHAIN MF674485_HBSP_P-B of FT:mat_peptide MF674485_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0438). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674487_HBSP_P-B Product feature CHAIN MF674487_HBSP_P-B of FT:mat_peptide MF674487_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0864). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674488_HBSP_P-B Product feature CHAIN MF674488_HBSP_P-B of FT:mat_peptide MF674488_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05A0034). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674490_HBSP_P-B Product feature CHAIN MF674490_HBSP_P-B of FT:mat_peptide MF674490_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05A0515). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674491_HBSP_P-B Product feature CHAIN MF674491_HBSP_P-B of FT:mat_peptide MF674491_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05A0949). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674492_HBSP_P-B Product feature CHAIN MF674492_HBSP_P-B of FT:mat_peptide MF674492_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0114). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDHEAGPLEEELPRLADEGLNHRVAEELNLGNLNDHPPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674493_HBSP_P-B Product feature CHAIN MF674493_HBSP_P-B of FT:mat_peptide MF674493_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0131). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEELNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674495_HBSP_P-B Product feature CHAIN MF674495_HBSP_P-B of FT:mat_peptide MF674495_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0139). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674496_HBSP_P-B Product feature CHAIN MF674496_HBSP_P-B of FT:mat_peptide MF674496_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0140). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNHRVAEDLNLGNLNDHRPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674497_HBSP_P-B Product feature CHAIN MF674497_HBSP_P-B of FT:mat_peptide MF674497_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0141). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674498_HBSP_P-B Product feature CHAIN MF674498_HBSP_P-B of FT:mat_peptide MF674498_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0156). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674499_HBSP_P-B Product feature CHAIN MF674499_HBSP_P-B of FT:mat_peptide MF674499_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0158). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674500_HBSP_P-B Product feature CHAIN MF674500_HBSP_P-B of FT:mat_peptide MF674500_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0168). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674503_HBSP_P-B Product feature CHAIN MF674503_HBSP_P-B of FT:mat_peptide MF674503_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0191). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRHVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674505_HBSP_P-B Product feature CHAIN MF674505_HBSP_P-B of FT:mat_peptide MF674505_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0203). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPGHAEPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674506_HBSP_P-B Product feature CHAIN MF674506_HBSP_P-B of FT:mat_peptide MF674506_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0217). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674507_HBSP_P-B Product feature CHAIN MF674507_HBSP_P-B of FT:mat_peptide MF674507_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0218). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674508_HBSP_P-B Product feature CHAIN MF674508_HBSP_P-B of FT:mat_peptide MF674508_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0223). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674509_HBSP_P-B Product feature CHAIN MF674509_HBSP_P-B of FT:mat_peptide MF674509_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0226). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674510_HBSP_P-B Product feature CHAIN MF674510_HBSP_P-B of FT:mat_peptide MF674510_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0230). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674511_HBSP_P-B Product feature CHAIN MF674511_HBSP_P-B of FT:mat_peptide MF674511_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0240). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674512_HBSP_P-B Product feature CHAIN MF674512_HBSP_P-B of FT:mat_peptide MF674512_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0250). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674513_HBSP_P-B Product feature CHAIN MF674513_HBSP_P-B of FT:mat_peptide MF674513_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0253). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF674515_HBSP_P-B Product feature CHAIN MF674515_HBSP_P-B of FT:mat_peptide MF674515_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0261). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG372436_HBSP_P-B Product feature CHAIN MG372436_HBSP_P-B of FT:mat_peptide MG372436_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/08116). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571322_HBSP_P-B Product feature CHAIN MG571322_HBSP_P-B of FT:mat_peptide MG571322_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8376). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571323_HBSP_P-B Product feature CHAIN MG571323_HBSP_P-B of FT:mat_peptide MG571323_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12324). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHXLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571325_HBSP_P-B Product feature CHAIN MG571325_HBSP_P-B of FT:mat_peptide MG571325_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13536). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571326_HBSP_P-B Product feature CHAIN MG571326_HBSP_P-B of FT:mat_peptide MG571326_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13664). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571327_HBSP_P-B Product feature CHAIN MG571327_HBSP_P-B of FT:mat_peptide MG571327_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15035). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571328_HBSP_P-B Product feature CHAIN MG571328_HBSP_P-B of FT:mat_peptide MG571328_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 18612). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571329_HBSP_P-B Product feature CHAIN MG571329_HBSP_P-B of FT:mat_peptide MG571329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 18679). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571331_HBSP_P-B Product feature CHAIN MG571331_HBSP_P-B of FT:mat_peptide MG571331_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19273). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLWLSQNSYGSGPQSVSHGSIY
>gnl|hbvpro|MG571333_HBSP_P-B Product feature CHAIN MG571333_HBSP_P-B of FT:mat_peptide MG571333_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19574). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571334_HBSP_P-B Product feature CHAIN MG571334_HBSP_P-B of FT:mat_peptide MG571334_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19727). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571336_HBSP_P-B Product feature CHAIN MG571336_HBSP_P-B of FT:mat_peptide MG571336_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20730). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEKELPRLANEGLNRRVAQHLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571337_HBSP_P-B Product feature CHAIN MG571337_HBSP_P-B of FT:mat_peptide MG571337_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21116). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
VPLWYKHFRKLPLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571338_HBSP_P-B Product feature CHAIN MG571338_HBSP_P-B of FT:mat_peptide MG571338_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21180). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLXEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGXGPQPVSLGSVY
>gnl|hbvpro|MG571339_HBSP_P-B Product feature CHAIN MG571339_HBSP_P-B of FT:mat_peptide MG571339_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21359). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHHGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571340_HBSP_P-B Product feature CHAIN MG571340_HBSP_P-B of FT:mat_peptide MG571340_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21884). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQLFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571341_HBSP_P-B Product feature CHAIN MG571341_HBSP_P-B of FT:mat_peptide MG571341_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22174). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|MG571342_HBSP_P-B Product feature CHAIN MG571342_HBSP_P-B of FT:mat_peptide MG571342_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22531). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571344_HBSP_P-B Product feature CHAIN MG571344_HBSP_P-B of FT:mat_peptide MG571344_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22732). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571346_HBSP_P-B Product feature CHAIN MG571346_HBSP_P-B of FT:mat_peptide MG571346_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23244). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571347_HBSP_P-B Product feature CHAIN MG571347_HBSP_P-B of FT:mat_peptide MG571347_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23305). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKDPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571349_HBSP_P-B Product feature CHAIN MG571349_HBSP_P-B of FT:mat_peptide MG571349_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24177). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLQEELPRLADEGLNRRVAKDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571350_HBSP_P-B Product feature CHAIN MG571350_HBSP_P-B of FT:mat_peptide MG571350_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24531). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571351_HBSP_P-B Product feature CHAIN MG571351_HBSP_P-B of FT:mat_peptide MG571351_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24924). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLDKEAGPLKEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|MG571352_HBSP_P-B Product feature CHAIN MG571352_HBSP_P-B of FT:mat_peptide MG571352_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25179). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGVSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|MG571353_HBSP_P-B Product feature CHAIN MG571353_HBSP_P-B of FT:mat_peptide MG571353_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25771). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQRPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571354_HBSP_P-B Product feature CHAIN MG571354_HBSP_P-B of FT:mat_peptide MG571354_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 26391). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAQDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571355_HBSP_P-B Product feature CHAIN MG571355_HBSP_P-B of FT:mat_peptide MG571355_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 28100). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571356_HBSP_P-B Product feature CHAIN MG571356_HBSP_P-B of FT:mat_peptide MG571356_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 28144). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571357_HBSP_P-B Product feature CHAIN MG571357_HBSP_P-B of FT:mat_peptide MG571357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 28850). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571358_HBSP_P-B Product feature CHAIN MG571358_HBSP_P-B of FT:mat_peptide MG571358_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29611). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571360_HBSP_P-B Product feature CHAIN MG571360_HBSP_P-B of FT:mat_peptide MG571360_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29978). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571361_HBSP_P-B Product feature CHAIN MG571361_HBSP_P-B of FT:mat_peptide MG571361_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30357). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|MG571362_HBSP_P-B Product feature CHAIN MG571362_HBSP_P-B of FT:mat_peptide MG571362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30671). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571363_HBSP_P-B Product feature CHAIN MG571363_HBSP_P-B of FT:mat_peptide MG571363_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30700). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|MG571364_HBSP_P-B Product feature CHAIN MG571364_HBSP_P-B of FT:mat_peptide MG571364_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30737). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG571365_HBSP_P-B Product feature CHAIN MG571365_HBSP_P-B of FT:mat_peptide MG571365_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30923). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571367_HBSP_P-B Product feature CHAIN MG571367_HBSP_P-B of FT:mat_peptide MG571367_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31085). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|MG571368_HBSP_P-B Product feature CHAIN MG571368_HBSP_P-B of FT:mat_peptide MG571368_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31388). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLPDEGLNRRVAKDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571369_HBSP_P-B Product feature CHAIN MG571369_HBSP_P-B of FT:mat_peptide MG571369_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31608). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571370_HBSP_P-B Product feature CHAIN MG571370_HBSP_P-B of FT:mat_peptide MG571370_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31670). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEKELPRLADEGLNHRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571371_HBSP_P-B Product feature CHAIN MG571371_HBSP_P-B of FT:mat_peptide MG571371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31756). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571372_HBSP_P-B Product feature CHAIN MG571372_HBSP_P-B of FT:mat_peptide MG571372_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31789). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571373_HBSP_P-B Product feature CHAIN MG571373_HBSP_P-B of FT:mat_peptide MG571373_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31932). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571374_HBSP_P-B Product feature CHAIN MG571374_HBSP_P-B of FT:mat_peptide MG571374_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32118). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MG571375_HBSP_P-B Product feature CHAIN MG571375_HBSP_P-B of FT:mat_peptide MG571375_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32211). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLNDDARPLKQELPRLADEGLNRRVAEDLNLGNLNEHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLWLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG571376_HBSP_P-B Product feature CHAIN MG571376_HBSP_P-B of FT:mat_peptide MG571376_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35090). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQRPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|MG826152_HBSP_P-B Product feature CHAIN MG826152_HBSP_P-B of FT:mat_peptide MG826152_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YNKM70). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG826153_HBSP_P-B Product feature CHAIN MG826153_HBSP_P-B of FT:mat_peptide MG826153_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YNKM44H). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MH061283_HBSP_P-B Product feature CHAIN MH061283_HBSP_P-B of FT:mat_peptide MH061283_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate t4-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH663473_HBSP_P-B Product feature CHAIN MH663473_HBSP_P-B of FT:mat_peptide MH663473_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 268). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MH932712_HBSP_P-B Product feature CHAIN MH932712_HBSP_P-B of FT:mat_peptide MH932712_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hiroshima GtB CL1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK052962_HBSP_P-B Product feature CHAIN MK052962_HBSP_P-B of FT:mat_peptide MK052962_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NP137Q-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK052964_HBSP_P-B Product feature CHAIN MK052964_HBSP_P-B of FT:mat_peptide MK052964_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NP137Q-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK052965_HBSP_P-B Product feature CHAIN MK052965_HBSP_P-B of FT:mat_peptide MK052965_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NP137Q-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK075117_HBSP_P-B Product feature CHAIN MK075117_HBSP_P-B of FT:mat_peptide MK075117_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 667). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK818222_HBSP_P-B Product feature CHAIN MK818222_HBSP_P-B of FT:mat_peptide MK818222_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CH005). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK818223_HBSP_P-B Product feature CHAIN MK818223_HBSP_P-B of FT:mat_peptide MK818223_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CH058). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK818225_HBSP_P-B Product feature CHAIN MK818225_HBSP_P-B of FT:mat_peptide MK818225_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CH085). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQXFRXLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQXLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|X97850_HBSP_P-B Product feature CHAIN X97850_HBSP_P-B of FT:mat_peptide X97850_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKMLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDQQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|X97851_HBSP_P-B Product feature CHAIN X97851_HBSP_P-B of FT:mat_peptide X97851_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X98077_HBSP_P-B Product feature CHAIN X98077_HBSP_P-B of FT:mat_peptide X98077_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHARLAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
© 1998-2019