HBVdb

Dataset for protein HBc of genotype B

[Download (right click)] [Alignment] [Repertoires]

2862 sequence(s)

>gnl|hbvpro|AB010289_HBc_P-B Product feature CHAIN AB010289_HBc_P-B of FT:mat_peptide AB010289_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB010290_HBc_P-B Product feature CHAIN AB010290_HBc_P-B of FT:mat_peptide AB010290_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELISFLPADFFPSVRDLLDTAAALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB010291_HBc_P-B Product feature CHAIN AB010291_HBc_P-B of FT:mat_peptide AB010291_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATTELISFLPADFFPSVRDLLDTAAALYREALESPEHCSHHHTALRQATLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014366_HBc_P-B Product feature CHAIN AB014366_HBc_P-B of FT:mat_peptide AB014366_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 07D07HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTAIRQAILCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRTTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB023663_HBc_P-B Product feature CHAIN AB023663_HBc_P-B of FT:mat_peptide AB023663_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate case 12). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSYLTSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRPQSPRRRRSKSRESQC
>gnl|hbvpro|AB023667_HBc_P-B Product feature CHAIN AB023667_HBc_P-B of FT:mat_peptide AB023667_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate case 72). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRSRGRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB023677_HBc_P-B Product feature CHAIN AB023677_HBc_P-B of FT:mat_peptide AB023677_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate case 23). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFWPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB023682_HBc_P-B Product feature CHAIN AB023682_HBc_P-B of FT:mat_peptide AB023682_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate case 78). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTISALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLMFGRDTVLEFLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031261_HBc_P-B Product feature CHAIN AB031261_HBc_P-B of FT:mat_peptide AB031261_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietA-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031263_HBc_P-B Product feature CHAIN AB031263_HBc_P-B of FT:mat_peptide AB031263_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietA-5). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031264_HBc_P-B Product feature CHAIN AB031264_HBc_P-B of FT:mat_peptide AB031264_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHGSAHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031266_HBc_P-B Product feature CHAIN AB031266_HBc_P-B of FT:mat_peptide AB031266_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031267_HBc_P-B Product feature CHAIN AB031267_HBc_P-B of FT:mat_peptide AB031267_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHISPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031268_HBc_P-B Product feature CHAIN AB031268_HBc_P-B of FT:mat_peptide AB031268_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-7). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033554_HBc_P-B Product feature CHAIN AB033554_HBc_P-B of FT:mat_peptide AB033554_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB033555_HBc_P-B Product feature CHAIN AB033555_HBc_P-B of FT:mat_peptide AB033555_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB048705_HBc_P-B Product feature CHAIN AB048705_HBc_P-B of FT:mat_peptide AB048705_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073821_HBc_P-B Product feature CHAIN AB073821_HBc_P-B of FT:mat_peptide AB073821_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRXRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB073822_HBc_P-B Product feature CHAIN AB073822_HBc_P-B of FT:mat_peptide AB073822_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073823_HBc_P-B Product feature CHAIN AB073823_HBc_P-B of FT:mat_peptide AB073823_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073824_HBc_P-B Product feature CHAIN AB073824_HBc_P-B of FT:mat_peptide AB073824_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPADFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073825_HBc_P-B Product feature CHAIN AB073825_HBc_P-B of FT:mat_peptide AB073825_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB073826_HBc_P-B Product feature CHAIN AB073826_HBc_P-B of FT:mat_peptide AB073826_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073827_HBc_P-B Product feature CHAIN AB073827_HBc_P-B of FT:mat_peptide AB073827_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073828_HBc_P-B Product feature CHAIN AB073828_HBc_P-B of FT:mat_peptide AB073828_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073829_HBc_P-B Product feature CHAIN AB073829_HBc_P-B of FT:mat_peptide AB073829_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073831_HBc_P-B Product feature CHAIN AB073831_HBc_P-B of FT:mat_peptide AB073831_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073832_HBc_P-B Product feature CHAIN AB073832_HBc_P-B of FT:mat_peptide AB073832_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPXVRDLLDTASALYREALESPEHCXPHHTALRQAILCWGELMNLATWVGSNLEDPA
ARELVVNYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073833_HBc_P-B Product feature CHAIN AB073833_HBc_P-B of FT:mat_peptide AB073833_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073834_HBc_P-B Product feature CHAIN AB073834_HBc_P-B of FT:mat_peptide AB073834_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073835_HBc_P-B Product feature CHAIN AB073835_HBc_P-B of FT:mat_peptide AB073835_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073836_HBc_P-B Product feature CHAIN AB073836_HBc_P-B of FT:mat_peptide AB073836_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLATWVGGNLNDQA
SREAVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073837_HBc_P-B Product feature CHAIN AB073837_HBc_P-B of FT:mat_peptide AB073837_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073838_HBc_P-B Product feature CHAIN AB073838_HBc_P-B of FT:mat_peptide AB073838_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSAHHTALRQAXLCWGELTTLXTWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVRQRXRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB073839_HBc_P-B Product feature CHAIN AB073839_HBc_P-B of FT:mat_peptide AB073839_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVDLLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB073840_HBc_P-B Product feature CHAIN AB073840_HBc_P-B of FT:mat_peptide AB073840_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALDREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073841_HBc_P-B Product feature CHAIN AB073841_HBc_P-B of FT:mat_peptide AB073841_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTATALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHLSCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073843_HBc_P-B Product feature CHAIN AB073843_HBc_P-B of FT:mat_peptide AB073843_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSHHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073844_HBc_P-B Product feature CHAIN AB073844_HBc_P-B of FT:mat_peptide AB073844_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073845_HBc_P-B Product feature CHAIN AB073845_HBc_P-B of FT:mat_peptide AB073845_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073846_HBc_P-B Product feature CHAIN AB073846_HBc_P-B of FT:mat_peptide AB073846_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073847_HBc_P-B Product feature CHAIN AB073847_HBc_P-B of FT:mat_peptide AB073847_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTTAALYREALESPEHCSAHHTAIRQAILCWGELMTLATWVGSNLQDQA
SRDLVVNYVNINMGLKFRQLLWFHMSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073848_HBc_P-B Product feature CHAIN AB073848_HBc_P-B of FT:mat_peptide AB073848_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073849_HBc_P-B Product feature CHAIN AB073849_HBc_P-B of FT:mat_peptide AB073849_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSIRDLLDTAAALYRXALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKLRQLLWFHXSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETXVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073850_HBc_P-B Product feature CHAIN AB073850_HBc_P-B of FT:mat_peptide AB073850_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPVHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073851_HBc_P-B Product feature CHAIN AB073851_HBc_P-B of FT:mat_peptide AB073851_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073852_HBc_P-B Product feature CHAIN AB073852_HBc_P-B of FT:mat_peptide AB073852_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELISFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073853_HBc_P-B Product feature CHAIN AB073853_HBc_P-B of FT:mat_peptide AB073853_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSPHHTAIRQAIVCWGEVMTLASWVGNNLQDPA
SRDLVVDYVNTHMGLKIRQLLWFHISCIIFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073854_HBc_P-B Product feature CHAIN AB073854_HBc_P-B of FT:mat_peptide AB073854_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMTLASWVGQNLQDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFEREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073856_HBc_P-B Product feature CHAIN AB073856_HBc_P-B of FT:mat_peptide AB073856_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry46). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHVSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRIRSQSREPQC
>gnl|hbvpro|AB073857_HBc_P-B Product feature CHAIN AB073857_HBc_P-B of FT:mat_peptide AB073857_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPHC
>gnl|hbvpro|AB073858_HBc_P-B Product feature CHAIN AB073858_HBc_P-B of FT:mat_peptide AB073858_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPADFYPSVRDLLDTATALYREALESPEHCTAHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB100695_HBc_P-B Product feature CHAIN AB100695_HBc_P-B of FT:mat_peptide AB100695_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSPLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB106884_HBc_P-B Product feature CHAIN AB106884_HBc_P-B of FT:mat_peptide AB106884_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSARDLLDTAAALYREALESPEHCSPHHTALRQAXLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLMFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB115551_HBc_P-B Product feature CHAIN AB115551_HBc_P-B of FT:mat_peptide AB115551_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB117759_HBc_P-B Product feature CHAIN AB117759_HBc_P-B of FT:mat_peptide AB117759_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195933_HBc_P-B Product feature CHAIN AB195933_HBc_P-B of FT:mat_peptide AB195933_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195934_HBc_P-B Product feature CHAIN AB195934_HBc_P-B of FT:mat_peptide AB195934_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195935_HBc_P-B Product feature CHAIN AB195935_HBc_P-B of FT:mat_peptide AB195935_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205119_HBc_P-B Product feature CHAIN AB205119_HBc_P-B of FT:mat_peptide AB205119_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205120_HBc_P-B Product feature CHAIN AB205120_HBc_P-B of FT:mat_peptide AB205120_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205121_HBc_P-B Product feature CHAIN AB205121_HBc_P-B of FT:mat_peptide AB205121_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205122_HBc_P-B Product feature CHAIN AB205122_HBc_P-B of FT:mat_peptide AB205122_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVVEYLVSFGVWIRTPTPYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB212625_HBc_P-B Product feature CHAIN AB212625_HBc_P-B of FT:mat_peptide AB212625_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFFPTIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRTGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB212626_HBc_P-B Product feature CHAIN AB212626_HBc_P-B of FT:mat_peptide AB212626_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219426_HBc_P-B Product feature CHAIN AB219426_HBc_P-B of FT:mat_peptide AB219426_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219427_HBc_P-B Product feature CHAIN AB219427_HBc_P-B of FT:mat_peptide AB219427_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB219428_HBc_C-B Product feature CHAIN AB219428_HBc_C-B of FT:mat_peptide AB219428_HBc_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219429_HBc_P-B Product feature CHAIN AB219429_HBc_P-B of FT:mat_peptide AB219429_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219430_HBc_P-B Product feature CHAIN AB219430_HBc_P-B of FT:mat_peptide AB219430_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB231909_HBc_P-B Product feature CHAIN AB231909_HBc_P-B of FT:mat_peptide AB231909_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTAPRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRFQSPRRRRSQSRESQC
>gnl|hbvpro|AB241116_HBc_P-B Product feature CHAIN AB241116_HBc_P-B of FT:mat_peptide AB241116_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241117_HBc_P-B Product feature CHAIN AB241117_HBc_P-B of FT:mat_peptide AB241117_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246339_HBc_P-B Product feature CHAIN AB246339_HBc_P-B of FT:mat_peptide AB246339_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246340_HBc_P-B Product feature CHAIN AB246340_HBc_P-B of FT:mat_peptide AB246340_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246341_HBc_P-B Product feature CHAIN AB246341_HBc_P-B of FT:mat_peptide AB246341_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246342_HBc_P-B Product feature CHAIN AB246342_HBc_P-B of FT:mat_peptide AB246342_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246343_HBc_P-B Product feature CHAIN AB246343_HBc_P-B of FT:mat_peptide AB246343_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287314_HBc_P-B Product feature CHAIN AB287314_HBc_P-B of FT:mat_peptide AB287314_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287315_HBc_P-B Product feature CHAIN AB287315_HBc_P-B of FT:mat_peptide AB287315_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287316_HBc_P-B Product feature CHAIN AB287316_HBc_P-B of FT:mat_peptide AB287316_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTSHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCICFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287317_HBc_P-B Product feature CHAIN AB287317_HBc_P-B of FT:mat_peptide AB287317_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGATVELLSFLPDDFFPSVRDLLDTAAALYREALECPEHRSPHHTAIRQAIVCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCIIFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRGRSPGRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB287318_HBc_P-B Product feature CHAIN AB287318_HBc_P-B of FT:mat_peptide AB287318_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPNDFFPSVRDLLDTAAALYREALESPQHCSPHHTAIRQAVLCWGELMTLASWVNNNLQDPA
SRDLVVNYVNTHMALKIRQLLWFHVSCIMFGRNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287319_HBc_P-B Product feature CHAIN AB287319_HBc_P-B of FT:mat_peptide AB287319_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGSNLDDPA
SRDLVVNYVNINMGLKIRQLLWFHLSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB287320_HBc_P-B Product feature CHAIN AB287320_HBc_P-B of FT:mat_peptide AB287320_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSAHHTALRQAIVCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB287321_HBc_P-B Product feature CHAIN AB287321_HBc_P-B of FT:mat_peptide AB287321_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFYPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAIIRRRGRSPRRRT
PSPRRPRSQSPRRRRSQSRGPQC
>gnl|hbvpro|AB287322_HBc_P-B Product feature CHAIN AB287322_HBc_P-B of FT:mat_peptide AB287322_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLASWVGNNLNDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB287323_HBc_P-B Product feature CHAIN AB287323_HBc_P-B of FT:mat_peptide AB287323_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFYPSVRDLLDTASALYREALESSEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRPRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB287324_HBc_P-B Product feature CHAIN AB287324_HBc_P-B of FT:mat_peptide AB287324_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-5). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSARDLLDTASALFREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCISFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRCRSTGRRT
PSPRRPRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB287325_HBc_P-B Product feature CHAIN AB287325_HBc_P-B of FT:mat_peptide AB287325_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB287326_HBc_P-B Product feature CHAIN AB287326_HBc_P-B of FT:mat_peptide AB287326_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB287327_HBc_P-B Product feature CHAIN AB287327_HBc_P-B of FT:mat_peptide AB287327_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB287328_HBc_P-B Product feature CHAIN AB287328_HBc_P-B of FT:mat_peptide AB287328_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287329_HBc_P-B Product feature CHAIN AB287329_HBc_P-B of FT:mat_peptide AB287329_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300364_HBc_P-B Product feature CHAIN AB300364_HBc_P-B of FT:mat_peptide AB300364_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300370_HBc_P-B Product feature CHAIN AB300370_HBc_P-B of FT:mat_peptide AB300370_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB300371_HBc_P-B Product feature CHAIN AB300371_HBc_P-B of FT:mat_peptide AB300371_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPNIRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLQDSG
SRDLVVNYVNTNMGLKMRQLLWFHISCLTFGRETVLEYLGSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB302095_HBc_P-B Product feature CHAIN AB302095_HBc_P-B of FT:mat_peptide AB302095_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPPDFFPSARDLLDTTAALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHVSCIMFGRDTVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB302942_HBc_P-B Product feature CHAIN AB302942_HBc_P-B of FT:mat_peptide AB302942_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDQA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB302943_HBc_P-B Product feature CHAIN AB302943_HBc_P-B of FT:mat_peptide AB302943_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDQA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB302944_HBc_P-B Product feature CHAIN AB302944_HBc_P-B of FT:mat_peptide AB302944_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDQA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB302945_HBc_P-B Product feature CHAIN AB302945_HBc_P-B of FT:mat_peptide AB302945_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPYHTALRQAILCWGELMNLATWVGSNLQDQA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB334299_HBc_P-B Product feature CHAIN AB334299_HBc_P-B of FT:mat_peptide AB334299_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334300_HBc_P-B Product feature CHAIN AB334300_HBc_P-B of FT:mat_peptide AB334300_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334301_HBc_P-B Product feature CHAIN AB334301_HBc_P-B of FT:mat_peptide AB334301_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334302_HBc_P-B Product feature CHAIN AB334302_HBc_P-B of FT:mat_peptide AB334302_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334303_HBc_P-B Product feature CHAIN AB334303_HBc_P-B of FT:mat_peptide AB334303_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB355453_HBc_P-B Product feature CHAIN AB355453_HBc_P-B of FT:mat_peptide AB355453_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB355454_HBc_P-B Product feature CHAIN AB355454_HBc_P-B of FT:mat_peptide AB355454_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB355455_HBc_P-B Product feature CHAIN AB355455_HBc_P-B of FT:mat_peptide AB355455_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB362933_HBc_P-B Product feature CHAIN AB362933_HBc_P-B of FT:mat_peptide AB362933_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFYPSVRDLLDTAAALYREALESPEHCSPHHTAIRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB365445_HBc_P-B Product feature CHAIN AB365445_HBc_P-B of FT:mat_peptide AB365445_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQG
SRELVVGYVNVNMGLKLRQLLWFHISCLMFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB368295_HBc_P-B Product feature CHAIN AB368295_HBc_P-B of FT:mat_peptide AB368295_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAVVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB471854_HBc_P-B Product feature CHAIN AB471854_HBc_P-B of FT:mat_peptide AB471854_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471855_HBc_P-B Product feature CHAIN AB471855_HBc_P-B of FT:mat_peptide AB471855_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB493827_HBc_P-B Product feature CHAIN AB493827_HBc_P-B of FT:mat_peptide AB493827_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRXLLNPVLVLYRGALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB493833_HBc_P-B Product feature CHAIN AB493833_HBc_P-B of FT:mat_peptide AB493833_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB493835_HBc_P-B Product feature CHAIN AB493835_HBc_P-B of FT:mat_peptide AB493835_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAILCWGELRNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB555498_HBc_P-B Product feature CHAIN AB555498_HBc_P-B of FT:mat_peptide AB555498_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB642093_HBc_P-B Product feature CHAIN AB642093_HBc_P-B of FT:mat_peptide AB642093_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPXDFFPSVRDLLDTAXALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTXMGLKIRQLLWFHLSCIXFGXDTVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVXRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB642094_HBc_P-B Product feature CHAIN AB642094_HBc_P-B of FT:mat_peptide AB642094_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB642101_HBc_P-B Product feature CHAIN AB642101_HBc_P-B of FT:mat_peptide AB642101_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT2009-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPQDFYPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB675676_HBc_P-B Product feature CHAIN AB675676_HBc_P-B of FT:mat_peptide AB675676_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713527_HBc_P-B Product feature CHAIN AB713527_HBc_P-B of FT:mat_peptide AB713527_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713528_HBc_P-B Product feature CHAIN AB713528_HBc_P-B of FT:mat_peptide AB713528_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713530_HBc_P-B Product feature CHAIN AB713530_HBc_P-B of FT:mat_peptide AB713530_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALKQAILCWGELMNLATWVGSNLEDPA
CRDLIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713531_HBc_P-B Product feature CHAIN AB713531_HBc_P-B of FT:mat_peptide AB713531_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713532_HBc_P-B Product feature CHAIN AB713532_HBc_P-B of FT:mat_peptide AB713532_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv132). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIKQLLGVPIFGRTFRRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB828708_HBc_P-B Product feature CHAIN AB828708_HBc_P-B of FT:mat_peptide AB828708_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HB12-0626). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATTELLSFLPIDFFPSVRDLLDTAAALYREALESPEHCSAHHTALRQAVLCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCXMFGRXTVLEXLVSFGVWIRTPPXYRPPNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB900095_HBc_P-B Product feature CHAIN AB900095_HBc_P-B of FT:mat_peptide AB900095_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB900097_HBc_P-B Product feature CHAIN AB900097_HBc_P-B of FT:mat_peptide AB900097_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTAAALYREALESPEHCSPHHTAIRQAVLCWLELMTLANWVGNNLQDPA
SRDMVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB900098_HBc_P-B Product feature CHAIN AB900098_HBc_P-B of FT:mat_peptide AB900098_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATXELXSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB900103_HBc_P-B Product feature CHAIN AB900103_HBc_P-B of FT:mat_peptide AB900103_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPHDFFPSARDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDQA
SRDLVVNYVDTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB900104_HBc_P-B Product feature CHAIN AB900104_HBc_P-B of FT:mat_peptide AB900104_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWVELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB900105_HBc_P-B Product feature CHAIN AB900105_HBc_P-B of FT:mat_peptide AB900105_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTAAALYREALESPEHCSAHHTAIRQAILCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB900106_HBc_P-B Product feature CHAIN AB900106_HBc_P-B of FT:mat_peptide AB900106_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCTSHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB900107_HBc_P-B Product feature CHAIN AB900107_HBc_P-B of FT:mat_peptide AB900107_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSAHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB900108_HBc_P-B Product feature CHAIN AB900108_HBc_P-B of FT:mat_peptide AB900108_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYREALESPEHCSPHHTAIRQAFLCWGELMTLATWVGDNLDDPA
SRNLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPRC
>gnl|hbvpro|AB900110_HBc_P-B Product feature CHAIN AB900110_HBc_P-B of FT:mat_peptide AB900110_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTAIRQAIICWGELMNLATWVGSNLEDPS
SREAVVGYVNVNMGIKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPAAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB900111_HBc_P-B Product feature CHAIN AB900111_HBc_P-B of FT:mat_peptide AB900111_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASAELLSFLPSDFYPSVRDLLDTAAALYRDALESPEHCSAHHTALRQAVLCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDRSQC
>gnl|hbvpro|AB900112_HBc_P-B Product feature CHAIN AB900112_HBc_P-B of FT:mat_peptide AB900112_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPQDFYPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB908299_HBc_P-B Product feature CHAIN AB908299_HBc_P-B of FT:mat_peptide AB908299_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB908300_HBc_P-B Product feature CHAIN AB908300_HBc_P-B of FT:mat_peptide AB908300_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB908303_HBc_P-B Product feature CHAIN AB908303_HBc_P-B of FT:mat_peptide AB908303_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESLEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB908304_HBc_P-B Product feature CHAIN AB908304_HBc_P-B of FT:mat_peptide AB908304_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB931168_HBc_P-B Product feature CHAIN AB931168_HBc_P-B of FT:mat_peptide AB931168_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATGELLSFLPRDFFPSAQDLLDTAAALYREALESPEHCSYHHTALRQAILCWGELTNLGTWVGNNLQDQP
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB931169_HBc_P-B Product feature CHAIN AB931169_HBc_P-B of FT:mat_peptide AB931169_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATGELLSFLPRDFFPSAQDLLDTAAALYREALESPEHCSYHHTALRQAILCWGELTNLGTWVGNNLQDQP
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB976562_HBc_P-B Product feature CHAIN AB976562_HBc_P-B of FT:mat_peptide AB976562_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPVAYRPPNAPILSTLPETTVIRQRGRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF100308_HBc_P-B Product feature CHAIN AF100308_HBc_P-B of FT:mat_peptide AF100308_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF100309_HBc_P-B Product feature CHAIN AF100309_HBc_P-B of FT:mat_peptide AF100309_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121243_HBc_P-B Product feature CHAIN AF121243_HBc_P-B of FT:mat_peptide AF121243_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121244_HBc_P-B Product feature CHAIN AF121244_HBc_P-B of FT:mat_peptide AF121244_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121245_HBc_P-B Product feature CHAIN AF121245_HBc_P-B of FT:mat_peptide AF121245_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121246_HBc_P-B Product feature CHAIN AF121246_HBc_P-B of FT:mat_peptide AF121246_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121247_HBc_P-B Product feature CHAIN AF121247_HBc_P-B of FT:mat_peptide AF121247_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121248_HBc_P-B Product feature CHAIN AF121248_HBc_P-B of FT:mat_peptide AF121248_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AF121249_HBc_P-B Product feature CHAIN AF121249_HBc_P-B of FT:mat_peptide AF121249_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121250_HBc_P-B Product feature CHAIN AF121250_HBc_P-B of FT:mat_peptide AF121250_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AF121251_HBc_P-B Product feature CHAIN AF121251_HBc_P-B of FT:mat_peptide AF121251_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AF157020_HBc_P-B Product feature CHAIN AF157020_HBc_P-B of FT:mat_peptide AF157020_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWICTPPAYRPPNAPILSTLPDTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF157021_HBc_P-B Product feature CHAIN AF157021_HBc_P-B of FT:mat_peptide AF157021_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYVVSFGVWIRTPTAYRPPNAPILSTLPDTTVIRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF157022_HBc_P-B Product feature CHAIN AF157022_HBc_P-B of FT:mat_peptide AF157022_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPDTTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF157023_HBc_P-B Product feature CHAIN AF157023_HBc_P-B of FT:mat_peptide AF157023_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF157024_HBc_P-B Product feature CHAIN AF157024_HBc_P-B of FT:mat_peptide AF157024_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF157025_HBc_P-B Product feature CHAIN AF157025_HBc_P-B of FT:mat_peptide AF157025_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF233234_HBc_P-B Product feature CHAIN AF233234_HBc_P-B of FT:mat_peptide AF233234_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV259c). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF233235_HBc_P-B Product feature CHAIN AF233235_HBc_P-B of FT:mat_peptide AF233235_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV263c). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF233237_HBc_P-B Product feature CHAIN AF233237_HBc_P-B of FT:mat_peptide AF233237_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV4c). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF282917_HBc_P-B Product feature CHAIN AF282917_HBc_P-B of FT:mat_peptide AF282917_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGQNFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF282918_HBc_P-B Product feature CHAIN AF282918_HBc_P-B of FT:mat_peptide AF282918_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDPA
SRELVVSYVNANMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF323467_HBc_P-B Product feature CHAIN AF323467_HBc_P-B of FT:mat_peptide AF323467_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Korean A5). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRELIDTASALYREALESPEHCSPHHTALRQAMLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSHSRESQC
>gnl|hbvpro|AF323470_HBc_P-B Product feature CHAIN AF323470_HBc_P-B of FT:mat_peptide AF323470_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Korean A10). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324066_HBc_P-B Product feature CHAIN AF324066_HBc_P-B of FT:mat_peptide AF324066_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A11). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AF324067_HBc_P-B Product feature CHAIN AF324067_HBc_P-B of FT:mat_peptide AF324067_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A12). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AF324069_HBc_P-B Product feature CHAIN AF324069_HBc_P-B of FT:mat_peptide AF324069_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A14). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|AF324070_HBc_P-B Product feature CHAIN AF324070_HBc_P-B of FT:mat_peptide AF324070_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A15). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGACVELLSFLPYDFFPSIRELIDTASAMYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESEC
>gnl|hbvpro|AF324073_HBc_P-B Product feature CHAIN AF324073_HBc_P-B of FT:mat_peptide AF324073_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A20). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324078_HBc_P-B Product feature CHAIN AF324078_HBc_P-B of FT:mat_peptide AF324078_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A34). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324082_HBc_P-B Product feature CHAIN AF324082_HBc_P-B of FT:mat_peptide AF324082_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A38). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324085_HBc_P-B Product feature CHAIN AF324085_HBc_P-B of FT:mat_peptide AF324085_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A42). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREYQC
>gnl|hbvpro|AF324086_HBc_P-B Product feature CHAIN AF324086_HBc_P-B of FT:mat_peptide AF324086_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A43). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324088_HBc_P-B Product feature CHAIN AF324088_HBc_P-B of FT:mat_peptide AF324088_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A45). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLNDPA
SRELVVNYVNVNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AF324101_HBc_P-B Product feature CHAIN AF324101_HBc_P-B of FT:mat_peptide AF324101_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 0078). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324106_HBc_P-B Product feature CHAIN AF324106_HBc_P-B of FT:mat_peptide AF324106_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5072). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335738_HBc_P-B Product feature CHAIN AF335738_HBc_P-B of FT:mat_peptide AF335738_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335740_HBc_P-B Product feature CHAIN AF335740_HBc_P-B of FT:mat_peptide AF335740_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335741_HBc_P-B Product feature CHAIN AF335741_HBc_P-B of FT:mat_peptide AF335741_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335746_HBc_P-B Product feature CHAIN AF335746_HBc_P-B of FT:mat_peptide AF335746_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335748_HBc_P-B Product feature CHAIN AF335748_HBc_P-B of FT:mat_peptide AF335748_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGEVMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335751_HBc_P-B Product feature CHAIN AF335751_HBc_P-B of FT:mat_peptide AF335751_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESREHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335754_HBc_P-B Product feature CHAIN AF335754_HBc_P-B of FT:mat_peptide AF335754_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF461360_HBc_P-B Product feature CHAIN AF461360_HBc_P-B of FT:mat_peptide AF461360_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF479684_HBc_P-B Product feature CHAIN AF479684_HBc_P-B of FT:mat_peptide AF479684_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASVLYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480337_HBc_P-B Product feature CHAIN AF480337_HBc_P-B of FT:mat_peptide AF480337_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480338_HBc_P-B Product feature CHAIN AF480338_HBc_P-B of FT:mat_peptide AF480338_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PLPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480339_HBc_P-B Product feature CHAIN AF480339_HBc_P-B of FT:mat_peptide AF480339_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480340_HBc_P-B Product feature CHAIN AF480340_HBc_P-B of FT:mat_peptide AF480340_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480341_HBc_P-B Product feature CHAIN AF480341_HBc_P-B of FT:mat_peptide AF480341_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDFIDTASALYREALESSEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480342_HBc_P-B Product feature CHAIN AF480342_HBc_P-B of FT:mat_peptide AF480342_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480343_HBc_P-B Product feature CHAIN AF480343_HBc_P-B of FT:mat_peptide AF480343_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480344_HBc_P-B Product feature CHAIN AF480344_HBc_P-B of FT:mat_peptide AF480344_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480345_HBc_P-B Product feature CHAIN AF480345_HBc_P-B of FT:mat_peptide AF480345_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480346_HBc_P-B Product feature CHAIN AF480346_HBc_P-B of FT:mat_peptide AF480346_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCPTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480347_HBc_P-B Product feature CHAIN AF480347_HBc_P-B of FT:mat_peptide AF480347_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480348_HBc_P-B Product feature CHAIN AF480348_HBc_P-B of FT:mat_peptide AF480348_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480349_HBc_P-B Product feature CHAIN AF480349_HBc_P-B of FT:mat_peptide AF480349_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISRLTFGRETVLEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480350_HBc_P-B Product feature CHAIN AF480350_HBc_P-B of FT:mat_peptide AF480350_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480351_HBc_P-B Product feature CHAIN AF480351_HBc_P-B of FT:mat_peptide AF480351_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLTTWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRKSQSPRRRGSQSRESQC
>gnl|hbvpro|AF480352_HBc_P-B Product feature CHAIN AF480352_HBc_P-B of FT:mat_peptide AF480352_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480353_HBc_P-B Product feature CHAIN AF480353_HBc_P-B of FT:mat_peptide AF480353_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQNILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|AF480354_HBc_P-B Product feature CHAIN AF480354_HBc_P-B of FT:mat_peptide AF480354_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480355_HBc_P-B Product feature CHAIN AF480355_HBc_P-B of FT:mat_peptide AF480355_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480356_HBc_P-B Product feature CHAIN AF480356_HBc_P-B of FT:mat_peptide AF480356_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480357_HBc_P-B Product feature CHAIN AF480357_HBc_P-B of FT:mat_peptide AF480357_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480358_HBc_P-B Product feature CHAIN AF480358_HBc_P-B of FT:mat_peptide AF480358_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480359_HBc_P-B Product feature CHAIN AF480359_HBc_P-B of FT:mat_peptide AF480359_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480360_HBc_P-B Product feature CHAIN AF480360_HBc_P-B of FT:mat_peptide AF480360_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480361_HBc_P-B Product feature CHAIN AF480361_HBc_P-B of FT:mat_peptide AF480361_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWCELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480362_HBc_P-B Product feature CHAIN AF480362_HBc_P-B of FT:mat_peptide AF480362_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480363_HBc_P-B Product feature CHAIN AF480363_HBc_P-B of FT:mat_peptide AF480363_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480364_HBc_P-B Product feature CHAIN AF480364_HBc_P-B of FT:mat_peptide AF480364_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYIEFRASGELLSFLPSDFFPSIRDLLDTASALYREALQSPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ298864_HBc_P-B Product feature CHAIN AJ298864_HBc_P-B of FT:mat_peptide AJ298864_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPATTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627225_HBc_P-B Product feature CHAIN AJ627225_HBc_P-B of FT:mat_peptide AJ627225_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLDDQA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM888201_HBc_P-B Product feature CHAIN AM888201_HBc_P-B of FT:mat_peptide AM888201_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BM1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGPSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011084_HBc_P-B Product feature CHAIN AP011084_HBc_P-B of FT:mat_peptide AP011084_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011085_HBc_P-B Product feature CHAIN AP011085_HBc_P-B of FT:mat_peptide AP011085_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011086_HBc_P-B Product feature CHAIN AP011086_HBc_P-B of FT:mat_peptide AP011086_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011087_HBc_P-B Product feature CHAIN AP011087_HBc_P-B of FT:mat_peptide AP011087_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011088_HBc_P-B Product feature CHAIN AP011088_HBc_P-B of FT:mat_peptide AP011088_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011089_HBc_P-B Product feature CHAIN AP011089_HBc_P-B of FT:mat_peptide AP011089_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011090_HBc_P-B Product feature CHAIN AP011090_HBc_P-B of FT:mat_peptide AP011090_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011091_HBc_P-B Product feature CHAIN AP011091_HBc_P-B of FT:mat_peptide AP011091_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011092_HBc_P-B Product feature CHAIN AP011092_HBc_P-B of FT:mat_peptide AP011092_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011093_HBc_P-B Product feature CHAIN AP011093_HBc_P-B of FT:mat_peptide AP011093_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCITFGREIVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011094_HBc_P-B Product feature CHAIN AP011094_HBc_P-B of FT:mat_peptide AP011094_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHLSCLMFGRXTVLEYLVSFGVWIRTPAAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AP011095_HBc_P-B Product feature CHAIN AP011095_HBc_P-B of FT:mat_peptide AP011095_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011096_HBc_P-B Product feature CHAIN AP011096_HBc_P-B of FT:mat_peptide AP011096_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY033072_HBc_P-B Product feature CHAIN AY033072_HBc_P-B of FT:mat_peptide AY033072_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY033073_HBc_P-B Product feature CHAIN AY033073_HBc_P-B of FT:mat_peptide AY033073_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167089_HBc_P-B Product feature CHAIN AY167089_HBc_P-B of FT:mat_peptide AY167089_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167093_HBc_P-B Product feature CHAIN AY167093_HBc_P-B of FT:mat_peptide AY167093_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRDAVVSYVNVNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWMRTPPAYRPPNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167094_HBc_P-B Product feature CHAIN AY167094_HBc_P-B of FT:mat_peptide AY167094_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLXDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLXFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|AY167097_HBc_P-B Product feature CHAIN AY167097_HBc_P-B of FT:mat_peptide AY167097_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AY167098_HBc_P-B Product feature CHAIN AY167098_HBc_P-B of FT:mat_peptide AY167098_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNAGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167100_HBc_P-B Product feature CHAIN AY167100_HBc_P-B of FT:mat_peptide AY167100_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167101_HBc_P-B Product feature CHAIN AY167101_HBc_P-B of FT:mat_peptide AY167101_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|AY167102_HBc_P-B Product feature CHAIN AY167102_HBc_P-B of FT:mat_peptide AY167102_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALYREALESPEHLTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AY206375_HBc_P-B Product feature CHAIN AY206375_HBc_P-B of FT:mat_peptide AY206375_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206383_HBc_P-B Product feature CHAIN AY206383_HBc_P-B of FT:mat_peptide AY206383_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTPHHTAIRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLMFGRQVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRARCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206391_HBc_P-B Product feature CHAIN AY206391_HBc_P-B of FT:mat_peptide AY206391_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SREVVVSYVNVNMGLKIRQILWFHVSCLMFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AY217357_HBc_P-B Product feature CHAIN AY217357_HBc_P-B of FT:mat_peptide AY217357_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY217358_HBc_P-B Product feature CHAIN AY217358_HBc_P-B of FT:mat_peptide AY217358_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY217359_HBc_P-B Product feature CHAIN AY217359_HBc_P-B of FT:mat_peptide AY217359_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY217360_HBc_P-B Product feature CHAIN AY217360_HBc_P-B of FT:mat_peptide AY217360_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPHRRRSQSRESQC
>gnl|hbvpro|AY217361_HBc_P-B Product feature CHAIN AY217361_HBc_P-B of FT:mat_peptide AY217361_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY220697_HBc_P-B Product feature CHAIN AY220697_HBc_P-B of FT:mat_peptide AY220697_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY220698_HBc_P-B Product feature CHAIN AY220698_HBc_P-B of FT:mat_peptide AY220698_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY220703_HBc_P-B Product feature CHAIN AY220703_HBc_P-B of FT:mat_peptide AY220703_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY220704_HBc_P-B Product feature CHAIN AY220704_HBc_P-B of FT:mat_peptide AY220704_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269065_HBc_P-B Product feature CHAIN AY269065_HBc_P-B of FT:mat_peptide AY269065_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3419). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269078_HBc_P-B Product feature CHAIN AY269078_HBc_P-B of FT:mat_peptide AY269078_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5075). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269091_HBc_P-B Product feature CHAIN AY269091_HBc_P-B of FT:mat_peptide AY269091_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269093_HBc_P-B Product feature CHAIN AY269093_HBc_P-B of FT:mat_peptide AY269093_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269095_HBc_P-B Product feature CHAIN AY269095_HBc_P-B of FT:mat_peptide AY269095_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFSPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269097_HBc_P-B Product feature CHAIN AY269097_HBc_P-B of FT:mat_peptide AY269097_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269100_HBc_P-B Product feature CHAIN AY269100_HBc_P-B of FT:mat_peptide AY269100_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269102_HBc_P-B Product feature CHAIN AY269102_HBc_P-B of FT:mat_peptide AY269102_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVDYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSTRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY269105_HBc_P-B Product feature CHAIN AY269105_HBc_P-B of FT:mat_peptide AY269105_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPSNAPILSTLPETAVVRCRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269108_HBc_P-B Product feature CHAIN AY269108_HBc_P-B of FT:mat_peptide AY269108_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRELLDTASAQYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269109_HBc_P-B Product feature CHAIN AY269109_HBc_P-B of FT:mat_peptide AY269109_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFRASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269110_HBc_P-B Product feature CHAIN AY269110_HBc_P-B of FT:mat_peptide AY269110_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269115_HBc_P-B Product feature CHAIN AY269115_HBc_P-B of FT:mat_peptide AY269115_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269120_HBc_P-B Product feature CHAIN AY269120_HBc_P-B of FT:mat_peptide AY269120_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269128_HBc_P-B Product feature CHAIN AY269128_HBc_P-B of FT:mat_peptide AY269128_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPS
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPENTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQCL
>gnl|hbvpro|AY269131_HBc_P-B Product feature CHAIN AY269131_HBc_P-B of FT:mat_peptide AY269131_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269135_HBc_P-B Product feature CHAIN AY269135_HBc_P-B of FT:mat_peptide AY269135_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY293309_HBc_P-B Product feature CHAIN AY293309_HBc_P-B of FT:mat_peptide AY293309_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY517488_HBc_P-B Product feature CHAIN AY517488_HBc_P-B of FT:mat_peptide AY517488_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRA
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY517620_HBc_P-B Product feature CHAIN AY517620_HBc_P-B of FT:mat_peptide AY517620_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY518556_HBc_P-B Product feature CHAIN AY518556_HBc_P-B of FT:mat_peptide AY518556_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY582137_HBc_P-B Product feature CHAIN AY582137_HBc_P-B of FT:mat_peptide AY582137_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596102_HBc_P-B Product feature CHAIN AY596102_HBc_P-B of FT:mat_peptide AY596102_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596103_HBc_P-B Product feature CHAIN AY596103_HBc_P-B of FT:mat_peptide AY596103_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY596104_HBc_P-B Product feature CHAIN AY596104_HBc_P-B of FT:mat_peptide AY596104_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASDLYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596106_HBc_P-B Product feature CHAIN AY596106_HBc_P-B of FT:mat_peptide AY596106_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|AY596110_HBc_P-B Product feature CHAIN AY596110_HBc_P-B of FT:mat_peptide AY596110_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596111_HBc_P-B Product feature CHAIN AY596111_HBc_P-B of FT:mat_peptide AY596111_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSSHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKFRQILWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596112_HBc_P-B Product feature CHAIN AY596112_HBc_P-B of FT:mat_peptide AY596112_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY766463_HBc_P-B Product feature CHAIN AY766463_HBc_P-B of FT:mat_peptide AY766463_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY800389_HBc_P-B Product feature CHAIN AY800389_HBc_P-B of FT:mat_peptide AY800389_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY800391_HBc_P-B Product feature CHAIN AY800391_HBc_P-B of FT:mat_peptide AY800391_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTANAMFREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGKDTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY800392_HBc_P-B Product feature CHAIN AY800392_HBc_P-B of FT:mat_peptide AY800392_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTANAMFREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGKDTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00329_HBc_P-B Product feature CHAIN D00329_HBc_P-B of FT:mat_peptide D00329_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALKSPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLWWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00330_HBc_P-B Product feature CHAIN D00330_HBc_P-B of FT:mat_peptide D00330_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00331_HBc_C-B Product feature CHAIN D00331_HBc_C-B of FT:mat_peptide D00331_HBc_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D23678_HBc_P-B Product feature CHAIN D23678_HBc_P-B of FT:mat_peptide D23678_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTAAALYREALESPQHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|D23679_HBc_P-B Product feature CHAIN D23679_HBc_P-B of FT:mat_peptide D23679_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D50521_HBc_P-B Product feature CHAIN D50521_HBc_P-B of FT:mat_peptide D50521_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVHDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLASWVGNNLQDPA
SRELVVNYVNTHMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSRSREPQC
>gnl|hbvpro|D50522_HBc_P-B Product feature CHAIN D50522_HBc_P-B of FT:mat_peptide D50522_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVHDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLASWVGNNLQDPA
SRELVVNYVNTHMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSRSREPQC
>gnl|hbvpro|DQ144543_HBc_P-B Product feature CHAIN DQ144543_HBc_P-B of FT:mat_peptide DQ144543_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-A14). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144544_HBc_P-B Product feature CHAIN DQ144544_HBc_P-B of FT:mat_peptide DQ144544_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144545_HBc_P-B Product feature CHAIN DQ144545_HBc_P-B of FT:mat_peptide DQ144545_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-B3). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144546_HBc_P-B Product feature CHAIN DQ144546_HBc_P-B of FT:mat_peptide DQ144546_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-C2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144548_HBc_P-B Product feature CHAIN DQ144548_HBc_P-B of FT:mat_peptide DQ144548_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-E4). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144550_HBc_P-B Product feature CHAIN DQ144550_HBc_P-B of FT:mat_peptide DQ144550_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFSPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPHRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144551_HBc_P-B Product feature CHAIN DQ144551_HBc_P-B of FT:mat_peptide DQ144551_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-F3). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144552_HBc_P-B Product feature CHAIN DQ144552_HBc_P-B of FT:mat_peptide DQ144552_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-G2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144554_HBc_P-B Product feature CHAIN DQ144554_HBc_P-B of FT:mat_peptide DQ144554_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144555_HBc_P-B Product feature CHAIN DQ144555_HBc_P-B of FT:mat_peptide DQ144555_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-B10). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144556_HBc_P-B Product feature CHAIN DQ144556_HBc_P-B of FT:mat_peptide DQ144556_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-C6). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFEASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144557_HBc_P-B Product feature CHAIN DQ144557_HBc_P-B of FT:mat_peptide DQ144557_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-D2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144558_HBc_P-B Product feature CHAIN DQ144558_HBc_P-B of FT:mat_peptide DQ144558_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-10). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144559_HBc_P-B Product feature CHAIN DQ144559_HBc_P-B of FT:mat_peptide DQ144559_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-11). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILATLPETTVVRRRDRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144560_HBc_P-B Product feature CHAIN DQ144560_HBc_P-B of FT:mat_peptide DQ144560_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144561_HBc_P-B Product feature CHAIN DQ144561_HBc_P-B of FT:mat_peptide DQ144561_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATRVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|DQ144564_HBc_P-B Product feature CHAIN DQ144564_HBc_P-B of FT:mat_peptide DQ144564_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144565_HBc_P-B Product feature CHAIN DQ144565_HBc_P-B of FT:mat_peptide DQ144565_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-25). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144567_HBc_P-B Product feature CHAIN DQ144567_HBc_P-B of FT:mat_peptide DQ144567_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq3-A17). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144569_HBc_P-B Product feature CHAIN DQ144569_HBc_P-B of FT:mat_peptide DQ144569_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq3-C2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144570_HBc_P-B Product feature CHAIN DQ144570_HBc_P-B of FT:mat_peptide DQ144570_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq3-D3). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVRWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144574_HBc_P-B Product feature CHAIN DQ144574_HBc_P-B of FT:mat_peptide DQ144574_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq3-13). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144575_HBc_P-B Product feature CHAIN DQ144575_HBc_P-B of FT:mat_peptide DQ144575_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq3-18). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144576_HBc_P-B Product feature CHAIN DQ144576_HBc_P-B of FT:mat_peptide DQ144576_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq3-21). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|DQ144578_HBc_P-B Product feature CHAIN DQ144578_HBc_P-B of FT:mat_peptide DQ144578_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq3-25). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144579_HBc_P-B Product feature CHAIN DQ144579_HBc_P-B of FT:mat_peptide DQ144579_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144581_HBc_P-B Product feature CHAIN DQ144581_HBc_P-B of FT:mat_peptide DQ144581_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-B14). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144582_HBc_P-B Product feature CHAIN DQ144582_HBc_P-B of FT:mat_peptide DQ144582_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-7). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144583_HBc_P-B Product feature CHAIN DQ144583_HBc_P-B of FT:mat_peptide DQ144583_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-C4). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144584_HBc_P-B Product feature CHAIN DQ144584_HBc_P-B of FT:mat_peptide DQ144584_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-14). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144585_HBc_P-B Product feature CHAIN DQ144585_HBc_P-B of FT:mat_peptide DQ144585_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-13). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAIACWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144586_HBc_P-B Product feature CHAIN DQ144586_HBc_P-B of FT:mat_peptide DQ144586_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-D2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144587_HBc_P-B Product feature CHAIN DQ144587_HBc_P-B of FT:mat_peptide DQ144587_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-17). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPELCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPCRRRSQSRESQC
>gnl|hbvpro|DQ144589_HBc_P-B Product feature CHAIN DQ144589_HBc_P-B of FT:mat_peptide DQ144589_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-23). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILATLPETTVVRRRDRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144590_HBc_P-B Product feature CHAIN DQ144590_HBc_P-B of FT:mat_peptide DQ144590_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-24). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144592_HBc_P-B Product feature CHAIN DQ144592_HBc_P-B of FT:mat_peptide DQ144592_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-30). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFEASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144593_HBc_P-B Product feature CHAIN DQ144593_HBc_P-B of FT:mat_peptide DQ144593_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq4-32). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144594_HBc_P-B Product feature CHAIN DQ144594_HBc_P-B of FT:mat_peptide DQ144594_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144595_HBc_P-B Product feature CHAIN DQ144595_HBc_P-B of FT:mat_peptide DQ144595_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-A6). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFEASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144596_HBc_P-B Product feature CHAIN DQ144596_HBc_P-B of FT:mat_peptide DQ144596_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-B2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRETLESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144597_HBc_P-B Product feature CHAIN DQ144597_HBc_P-B of FT:mat_peptide DQ144597_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-C3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144598_HBc_P-B Product feature CHAIN DQ144598_HBc_P-B of FT:mat_peptide DQ144598_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-D7). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATRVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|DQ144599_HBc_P-B Product feature CHAIN DQ144599_HBc_P-B of FT:mat_peptide DQ144599_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-7). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144600_HBc_P-B Product feature CHAIN DQ144600_HBc_P-B of FT:mat_peptide DQ144600_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-9). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIGTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGESMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144602_HBc_P-B Product feature CHAIN DQ144602_HBc_P-B of FT:mat_peptide DQ144602_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-12). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLSWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144606_HBc_P-B Product feature CHAIN DQ144606_HBc_P-B of FT:mat_peptide DQ144606_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-F2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSSLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ361535_HBc_P-B Product feature CHAIN DQ361535_HBc_P-B of FT:mat_peptide DQ361535_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448619_HBc_P-B Product feature CHAIN DQ448619_HBc_P-B of FT:mat_peptide DQ448619_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448620_HBc_P-B Product feature CHAIN DQ448620_HBc_P-B of FT:mat_peptide DQ448620_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448621_HBc_P-B Product feature CHAIN DQ448621_HBc_P-B of FT:mat_peptide DQ448621_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448622_HBc_P-B Product feature CHAIN DQ448622_HBc_P-B of FT:mat_peptide DQ448622_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448623_HBc_P-B Product feature CHAIN DQ448623_HBc_P-B of FT:mat_peptide DQ448623_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448624_HBc_P-B Product feature CHAIN DQ448624_HBc_P-B of FT:mat_peptide DQ448624_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448625_HBc_P-B Product feature CHAIN DQ448625_HBc_P-B of FT:mat_peptide DQ448625_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448626_HBc_P-B Product feature CHAIN DQ448626_HBc_P-B of FT:mat_peptide DQ448626_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448627_HBc_P-B Product feature CHAIN DQ448627_HBc_P-B of FT:mat_peptide DQ448627_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448628_HBc_P-B Product feature CHAIN DQ448628_HBc_P-B of FT:mat_peptide DQ448628_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREAQC
>gnl|hbvpro|DQ463787_HBc_P-B Product feature CHAIN DQ463787_HBc_P-B of FT:mat_peptide DQ463787_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAVLCWGELMTLASWVGSNLDDPA
SRDLVVNYVNINMGLKIRQLLWFHLSCITFGKDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463788_HBc_P-B Product feature CHAIN DQ463788_HBc_P-B of FT:mat_peptide DQ463788_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ463789_HBc_P-B Product feature CHAIN DQ463789_HBc_P-B of FT:mat_peptide DQ463789_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHVSCIIFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ463790_HBc_P-B Product feature CHAIN DQ463790_HBc_P-B of FT:mat_peptide DQ463790_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESSEHCSYHHTALRQAILCWGELMTLASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWYHLSCLTFGRDTVHEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ463791_HBc_P-B Product feature CHAIN DQ463791_HBc_P-B of FT:mat_peptide DQ463791_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463792_HBc_P-B Product feature CHAIN DQ463792_HBc_P-B of FT:mat_peptide DQ463792_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRHRRRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463794_HBc_P-B Product feature CHAIN DQ463794_HBc_P-B of FT:mat_peptide DQ463794_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ463795_HBc_P-B Product feature CHAIN DQ463795_HBc_P-B of FT:mat_peptide DQ463795_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTAIRQAVLCWGELMTLASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCIIFGRSTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463796_HBc_P-B Product feature CHAIN DQ463796_HBc_P-B of FT:mat_peptide DQ463796_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALFREALESPEHCSPHHTAIRQAILCWGELMTLASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCIIFGKDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463797_HBc_P-B Product feature CHAIN DQ463797_HBc_P-B of FT:mat_peptide DQ463797_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHVSCIIFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463798_HBc_P-B Product feature CHAIN DQ463798_HBc_P-B of FT:mat_peptide DQ463798_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELMTLASWVGSNLNDPA
SRDLVVNYVNINMGLKIRQLLWYHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ463799_HBc_P-B Product feature CHAIN DQ463799_HBc_P-B of FT:mat_peptide DQ463799_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVNLLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGQLMTLASWVGNNLQDPA
SRDLVVDYVNNNMGLMIRQLLWFHLSCITFGQDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463800_HBc_P-B Product feature CHAIN DQ463800_HBc_P-B of FT:mat_peptide DQ463800_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSAHHTAIRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRLRRRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ463802_HBc_P-B Product feature CHAIN DQ463802_HBc_P-B of FT:mat_peptide DQ463802_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPQHCSPHHTAIRQAILCWGELMTLASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHLSCITFGKDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ904357_HBc_P-B Product feature CHAIN DQ904357_HBc_P-B of FT:mat_peptide DQ904357_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETCVVRRRGRSPRRRA
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ975271_HBc_P-B Product feature CHAIN DQ975271_HBc_P-B of FT:mat_peptide DQ975271_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993683_HBc_P-B Product feature CHAIN DQ993683_HBc_P-B of FT:mat_peptide DQ993683_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPHQEFGSSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ993684_HBc_P-B Product feature CHAIN DQ993684_HBc_P-B of FT:mat_peptide DQ993684_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLPTWVGSNLEDPA
SWKLLATCRNVKMGPKISQLLWFHISWLMFGRETVLEYLGSFGVWIRTPTAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993686_HBc_P-B Product feature CHAIN DQ993686_HBc_P-B of FT:mat_peptide DQ993686_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SWDFLVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993687_HBc_P-B Product feature CHAIN DQ993687_HBc_P-B of FT:mat_peptide DQ993687_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGSSAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLTQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993694_HBc_P-B Product feature CHAIN DQ993694_HBc_P-B of FT:mat_peptide DQ993694_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 234). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993696_HBc_P-B Product feature CHAIN DQ993696_HBc_P-B of FT:mat_peptide DQ993696_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993697_HBc_P-B Product feature CHAIN DQ993697_HBc_P-B of FT:mat_peptide DQ993697_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993699_HBc_P-B Product feature CHAIN DQ993699_HBc_P-B of FT:mat_peptide DQ993699_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993700_HBc_P-B Product feature CHAIN DQ993700_HBc_P-B of FT:mat_peptide DQ993700_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993701_HBc_P-B Product feature CHAIN DQ993701_HBc_P-B of FT:mat_peptide DQ993701_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993702_HBc_P-B Product feature CHAIN DQ993702_HBc_P-B of FT:mat_peptide DQ993702_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993703_HBc_P-B Product feature CHAIN DQ993703_HBc_P-B of FT:mat_peptide DQ993703_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993706_HBc_P-B Product feature CHAIN DQ993706_HBc_P-B of FT:mat_peptide DQ993706_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993707_HBc_P-B Product feature CHAIN DQ993707_HBc_P-B of FT:mat_peptide DQ993707_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEAPEHCSPHHTALRQALLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993708_HBc_P-B Product feature CHAIN DQ993708_HBc_P-B of FT:mat_peptide DQ993708_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIPDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993709_HBc_P-B Product feature CHAIN DQ993709_HBc_P-B of FT:mat_peptide DQ993709_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993711_HBc_P-B Product feature CHAIN DQ993711_HBc_P-B of FT:mat_peptide DQ993711_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|DQ995801_HBc_P-B Product feature CHAIN DQ995801_HBc_P-B of FT:mat_peptide DQ995801_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ995802_HBc_P-B Product feature CHAIN DQ995802_HBc_P-B of FT:mat_peptide DQ995802_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHYSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|DQ995803_HBc_P-B Product feature CHAIN DQ995803_HBc_P-B of FT:mat_peptide DQ995803_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C265-15). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDSFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEHPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSLRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ995804_HBc_P-B Product feature CHAIN DQ995804_HBc_P-B of FT:mat_peptide DQ995804_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELISFLPADFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMNLATWVGGNLDDPA
SRELVVGYVNVNMGLKFRQILWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRVRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ995805_HBc_P-B Product feature CHAIN DQ995805_HBc_P-B of FT:mat_peptide DQ995805_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-2.5KB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDPLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|EF134945_HBc_P-B Product feature CHAIN EF134945_HBc_P-B of FT:mat_peptide EF134945_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF134946_HBc_P-B Product feature CHAIN EF134946_HBc_P-B of FT:mat_peptide EF134946_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473971_HBc_P-B Product feature CHAIN EF473971_HBc_P-B of FT:mat_peptide EF473971_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473972_HBc_P-B Product feature CHAIN EF473972_HBc_P-B of FT:mat_peptide EF473972_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473973_HBc_P-B Product feature CHAIN EF473973_HBc_P-B of FT:mat_peptide EF473973_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDSFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILGWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPGRRRSQSRESQC
>gnl|hbvpro|EF473974_HBc_P-B Product feature CHAIN EF473974_HBc_P-B of FT:mat_peptide EF473974_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLHTASALNREALESPEHCSPHHTALRQAILGWGELMNLATWVGRNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGEWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSSGRRRSQSRESQC
>gnl|hbvpro|EF473975_HBc_P-B Product feature CHAIN EF473975_HBc_P-B of FT:mat_peptide EF473975_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473976_HBc_P-B Product feature CHAIN EF473976_HBc_P-B of FT:mat_peptide EF473976_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473977_HBc_P-B Product feature CHAIN EF473977_HBc_P-B of FT:mat_peptide EF473977_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRIPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494380_HBc_P-B Product feature CHAIN EF494380_HBc_P-B of FT:mat_peptide EF494380_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494381_HBc_P-B Product feature CHAIN EF494381_HBc_P-B of FT:mat_peptide EF494381_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494382_HBc_P-B Product feature CHAIN EF494382_HBc_P-B of FT:mat_peptide EF494382_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTANALYREALESPEHCSAHHTALRQAIVCWGELMNLATWVGGNLEDPG
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSKSPRRKRSQSRDSQC
>gnl|hbvpro|EU139543_HBc_P-B Product feature CHAIN EU139543_HBc_P-B of FT:mat_peptide EU139543_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU158262_HBc_P-B Product feature CHAIN EU158262_HBc_P-B of FT:mat_peptide EU158262_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU158263_HBc_P-B Product feature CHAIN EU158263_HBc_P-B of FT:mat_peptide EU158263_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305547_HBc_P-B Product feature CHAIN EU305547_HBc_P-B of FT:mat_peptide EU305547_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305548_HBc_P-B Product feature CHAIN EU305548_HBc_P-B of FT:mat_peptide EU305548_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306677_HBc_P-B Product feature CHAIN EU306677_HBc_P-B of FT:mat_peptide EU306677_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306678_HBc_P-B Product feature CHAIN EU306678_HBc_P-B of FT:mat_peptide EU306678_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306679_HBc_P-B Product feature CHAIN EU306679_HBc_P-B of FT:mat_peptide EU306679_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306680_HBc_P-B Product feature CHAIN EU306680_HBc_P-B of FT:mat_peptide EU306680_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306681_HBc_P-B Product feature CHAIN EU306681_HBc_P-B of FT:mat_peptide EU306681_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLGDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306695_HBc_P-B Product feature CHAIN EU306695_HBc_P-B of FT:mat_peptide EU306695_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306696_HBc_P-B Product feature CHAIN EU306696_HBc_P-B of FT:mat_peptide EU306696_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
PRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306697_HBc_P-B Product feature CHAIN EU306697_HBc_P-B of FT:mat_peptide EU306697_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306698_HBc_P-B Product feature CHAIN EU306698_HBc_P-B of FT:mat_peptide EU306698_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306699_HBc_P-B Product feature CHAIN EU306699_HBc_P-B of FT:mat_peptide EU306699_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDFLDTASALYREALESPEHCSPHHTALRQAILCWGVLMNLATWVGSNLENPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306700_HBc_P-B Product feature CHAIN EU306700_HBc_P-B of FT:mat_peptide EU306700_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306701_HBc_P-B Product feature CHAIN EU306701_HBc_P-B of FT:mat_peptide EU306701_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306702_HBc_P-B Product feature CHAIN EU306702_HBc_P-B of FT:mat_peptide EU306702_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306703_HBc_P-B Product feature CHAIN EU306703_HBc_P-B of FT:mat_peptide EU306703_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYGNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|EU306704_HBc_P-B Product feature CHAIN EU306704_HBc_P-B of FT:mat_peptide EU306704_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306705_HBc_P-B Product feature CHAIN EU306705_HBc_P-B of FT:mat_peptide EU306705_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306706_HBc_P-B Product feature CHAIN EU306706_HBc_P-B of FT:mat_peptide EU306706_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306707_HBc_P-B Product feature CHAIN EU306707_HBc_P-B of FT:mat_peptide EU306707_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306708_HBc_P-B Product feature CHAIN EU306708_HBc_P-B of FT:mat_peptide EU306708_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306709_HBc_P-B Product feature CHAIN EU306709_HBc_P-B of FT:mat_peptide EU306709_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQPLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306710_HBc_P-B Product feature CHAIN EU306710_HBc_P-B of FT:mat_peptide EU306710_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306712_HBc_P-B Product feature CHAIN EU306712_HBc_P-B of FT:mat_peptide EU306712_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330989_HBc_P-B Product feature CHAIN EU330989_HBc_P-B of FT:mat_peptide EU330989_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330990_HBc_P-B Product feature CHAIN EU330990_HBc_P-B of FT:mat_peptide EU330990_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330992_HBc_P-B Product feature CHAIN EU330992_HBc_P-B of FT:mat_peptide EU330992_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330994_HBc_P-B Product feature CHAIN EU330994_HBc_P-B of FT:mat_peptide EU330994_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330996_HBc_P-B Product feature CHAIN EU330996_HBc_P-B of FT:mat_peptide EU330996_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKISQLLWFHISCLTFGRETVLEYLVSFGVRIRTTPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330997_HBc_P-B Product feature CHAIN EU330997_HBc_P-B of FT:mat_peptide EU330997_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKGFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330998_HBc_P-B Product feature CHAIN EU330998_HBc_P-B of FT:mat_peptide EU330998_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330999_HBc_P-B Product feature CHAIN EU330999_HBc_P-B of FT:mat_peptide EU330999_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU331000_HBc_P-B Product feature CHAIN EU331000_HBc_P-B of FT:mat_peptide EU331000_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU331001_HBc_P-B Product feature CHAIN EU331001_HBc_P-B of FT:mat_peptide EU331001_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU350409_HBc_P-B Product feature CHAIN EU350409_HBc_P-B of FT:mat_peptide EU350409_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439018_HBc_P-B Product feature CHAIN EU439018_HBc_P-B of FT:mat_peptide EU439018_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439020_HBc_P-B Product feature CHAIN EU439020_HBc_P-B of FT:mat_peptide EU439020_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVEVLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439021_HBc_P-B Product feature CHAIN EU439021_HBc_P-B of FT:mat_peptide EU439021_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439022_HBc_P-B Product feature CHAIN EU439022_HBc_P-B of FT:mat_peptide EU439022_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439023_HBc_P-B Product feature CHAIN EU439023_HBc_P-B of FT:mat_peptide EU439023_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU487256_HBc_P-B Product feature CHAIN EU487256_HBc_P-B of FT:mat_peptide EU487256_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAMLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU487257_HBc_P-B Product feature CHAIN EU487257_HBc_P-B of FT:mat_peptide EU487257_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVPLLSFLPSDFFPSIRDLLDTATALYGEALESPEHCSPHHTALRQAVVCWGELMNLATWVGSNLDDPA
SREVVVNYVNVNMGLKIRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU522066_HBc_P-B Product feature CHAIN EU522066_HBc_P-B of FT:mat_peptide EU522066_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4N). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU522072_HBc_P-B Product feature CHAIN EU522072_HBc_P-B of FT:mat_peptide EU522072_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSTRRRT
PSPRRRRTQSPRRRRSKSRESQC
>gnl|hbvpro|EU522073_HBc_P-B Product feature CHAIN EU522073_HBc_P-B of FT:mat_peptide EU522073_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRQRGRSTRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|EU522074_HBc_P-B Product feature CHAIN EU522074_HBc_P-B of FT:mat_peptide EU522074_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPHAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU522075_HBc_P-B Product feature CHAIN EU522075_HBc_P-B of FT:mat_peptide EU522075_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYRKALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRQRGRSTRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|EU547563_HBc_P-B Product feature CHAIN EU547563_HBc_P-B of FT:mat_peptide EU547563_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRPRGRSLRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU564822_HBc_P-B Product feature CHAIN EU564822_HBc_P-B of FT:mat_peptide EU564822_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGEVMNLATWVGSNLEDPA
SRESVVSYVNINMGLKMRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU564823_HBc_P-B Product feature CHAIN EU564823_HBc_P-B of FT:mat_peptide EU564823_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGEVMNLATWVGSNLEDPA
SRESVVSYVNINMGLKMRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU564824_HBc_P-B Product feature CHAIN EU564824_HBc_P-B of FT:mat_peptide EU564824_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGEVMNLATWVGSNLEDPA
SRESVVSYVNINMGLKMRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU564825_HBc_P-B Product feature CHAIN EU564825_HBc_P-B of FT:mat_peptide EU564825_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11T). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLDYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU570069_HBc_P-B Product feature CHAIN EU570069_HBc_P-B of FT:mat_peptide EU570069_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVGRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570070_HBc_P-B Product feature CHAIN EU570070_HBc_P-B of FT:mat_peptide EU570070_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
PRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570071_HBc_P-B Product feature CHAIN EU570071_HBc_P-B of FT:mat_peptide EU570071_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570075_HBc_P-B Product feature CHAIN EU570075_HBc_P-B of FT:mat_peptide EU570075_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPEHTVVRQRRRSPGRRT
PSPRRPRSKSPRRRRSRSRESQC
>gnl|hbvpro|EU579441_HBc_P-B Product feature CHAIN EU579441_HBc_P-B of FT:mat_peptide EU579441_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPENTVVRPRRRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|EU595031_HBc_P-B Product feature CHAIN EU595031_HBc_P-B of FT:mat_peptide EU595031_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU660224_HBc_P-B Product feature CHAIN EU660224_HBc_P-B of FT:mat_peptide EU660224_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU660230_HBc_P-B Product feature CHAIN EU660230_HBc_P-B of FT:mat_peptide EU660230_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU660231_HBc_P-B Product feature CHAIN EU660231_HBc_P-B of FT:mat_peptide EU660231_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU660232_HBc_P-B Product feature CHAIN EU660232_HBc_P-B of FT:mat_peptide EU660232_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU660233_HBc_P-B Product feature CHAIN EU660233_HBc_P-B of FT:mat_peptide EU660233_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796066_HBc_P-B Product feature CHAIN EU796066_HBc_P-B of FT:mat_peptide EU796066_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU796067_HBc_P-B Product feature CHAIN EU796067_HBc_P-B of FT:mat_peptide EU796067_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796068_HBc_P-B Product feature CHAIN EU796068_HBc_P-B of FT:mat_peptide EU796068_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796071_HBc_P-B Product feature CHAIN EU796071_HBc_P-B of FT:mat_peptide EU796071_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU881997_HBc_P-B Product feature CHAIN EU881997_HBc_P-B of FT:mat_peptide EU881997_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU881998_HBc_P-B Product feature CHAIN EU881998_HBc_P-B of FT:mat_peptide EU881998_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU882002_HBc_P-B Product feature CHAIN EU882002_HBc_P-B of FT:mat_peptide EU882002_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU882003_HBc_P-B Product feature CHAIN EU882003_HBc_P-B of FT:mat_peptide EU882003_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQIWWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU882004_HBc_P-B Product feature CHAIN EU882004_HBc_P-B of FT:mat_peptide EU882004_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU919171_HBc_P-B Product feature CHAIN EU919171_HBc_P-B of FT:mat_peptide EU919171_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPDHVSAHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPRC
>gnl|hbvpro|EU919172_HBc_P-B Product feature CHAIN EU919172_HBc_P-B of FT:mat_peptide EU919172_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU919173_HBc_P-B Product feature CHAIN EU919173_HBc_P-B of FT:mat_peptide EU919173_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU919175_HBc_P-B Product feature CHAIN EU919175_HBc_P-B of FT:mat_peptide EU919175_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU919176_HBc_P-B Product feature CHAIN EU919176_HBc_P-B of FT:mat_peptide EU919176_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939559_HBc_P-B Product feature CHAIN EU939559_HBc_P-B of FT:mat_peptide EU939559_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|EU939633_HBc_P-B Product feature CHAIN EU939633_HBc_P-B of FT:mat_peptide EU939633_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNAGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939634_HBc_P-B Product feature CHAIN EU939634_HBc_P-B of FT:mat_peptide EU939634_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNAGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939635_HBc_P-B Product feature CHAIN EU939635_HBc_P-B of FT:mat_peptide EU939635_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B125). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGGNLEDAA
SRELVVGYVNVNMGLKLIQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939636_HBc_P-B Product feature CHAIN EU939636_HBc_P-B of FT:mat_peptide EU939636_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFYPSIRDLLDTASALYREALESPEHCTAHHTALRQAIVCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVIRRRSRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU939637_HBc_P-B Product feature CHAIN EU939637_HBc_P-B of FT:mat_peptide EU939637_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|EU939638_HBc_P-B Product feature CHAIN EU939638_HBc_P-B of FT:mat_peptide EU939638_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSREPQC
>gnl|hbvpro|EU939639_HBc_P-B Product feature CHAIN EU939639_HBc_P-B of FT:mat_peptide EU939639_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939660_HBc_P-B Product feature CHAIN EU939660_HBc_P-B of FT:mat_peptide EU939660_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C34). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU939661_HBc_P-B Product feature CHAIN EU939661_HBc_P-B of FT:mat_peptide EU939661_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPTDFFPSIRDLLDTATALYREALESPEHCSYHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU939663_HBc_P-B Product feature CHAIN EU939663_HBc_P-B of FT:mat_peptide EU939663_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939665_HBc_P-B Product feature CHAIN EU939665_HBc_P-B of FT:mat_peptide EU939665_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939666_HBc_P-B Product feature CHAIN EU939666_HBc_P-B of FT:mat_peptide EU939666_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939667_HBc_P-B Product feature CHAIN EU939667_HBc_P-B of FT:mat_peptide EU939667_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU939669_HBc_P-B Product feature CHAIN EU939669_HBc_P-B of FT:mat_peptide EU939669_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939670_HBc_P-B Product feature CHAIN EU939670_HBc_P-B of FT:mat_peptide EU939670_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRGGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU939671_HBc_P-B Product feature CHAIN EU939671_HBc_P-B of FT:mat_peptide EU939671_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C201). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939672_HBc_P-B Product feature CHAIN EU939672_HBc_P-B of FT:mat_peptide EU939672_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU939673_HBc_P-B Product feature CHAIN EU939673_HBc_P-B of FT:mat_peptide EU939673_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939674_HBc_P-B Product feature CHAIN EU939674_HBc_P-B of FT:mat_peptide EU939674_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU939675_HBc_P-B Product feature CHAIN EU939675_HBc_P-B of FT:mat_peptide EU939675_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPECTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939676_HBc_P-B Product feature CHAIN EU939676_HBc_P-B of FT:mat_peptide EU939676_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939677_HBc_P-B Product feature CHAIN EU939677_HBc_P-B of FT:mat_peptide EU939677_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASLELLSFLPSDFFPSIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRSRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|EU939678_HBc_P-B Product feature CHAIN EU939678_HBc_P-B of FT:mat_peptide EU939678_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLQDQA
SRDLVVNYVNVNMGIKLRQLLWFHVSCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939679_HBc_P-B Product feature CHAIN EU939679_HBc_P-B of FT:mat_peptide EU939679_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D134). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSARRRRSQSRESQC
>gnl|hbvpro|FJ023569_HBc_P-B Product feature CHAIN FJ023569_HBc_P-B of FT:mat_peptide FJ023569_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0081). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023573_HBc_P-B Product feature CHAIN FJ023573_HBc_P-B of FT:mat_peptide FJ023573_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSLLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023575_HBc_P-B Product feature CHAIN FJ023575_HBc_P-B of FT:mat_peptide FJ023575_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0990). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023576_HBc_P-B Product feature CHAIN FJ023576_HBc_P-B of FT:mat_peptide FJ023576_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-1046). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ023605_HBc_P-B Product feature CHAIN FJ023605_HBc_P-B of FT:mat_peptide FJ023605_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023606_HBc_P-B Product feature CHAIN FJ023606_HBc_P-B of FT:mat_peptide FJ023606_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023607_HBc_P-B Product feature CHAIN FJ023607_HBc_P-B of FT:mat_peptide FJ023607_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023608_HBc_P-B Product feature CHAIN FJ023608_HBc_P-B of FT:mat_peptide FJ023608_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETGLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023609_HBc_P-B Product feature CHAIN FJ023609_HBc_P-B of FT:mat_peptide FJ023609_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023610_HBc_P-B Product feature CHAIN FJ023610_HBc_P-B of FT:mat_peptide FJ023610_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SGDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023611_HBc_P-B Product feature CHAIN FJ023611_HBc_P-B of FT:mat_peptide FJ023611_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023612_HBc_P-B Product feature CHAIN FJ023612_HBc_P-B of FT:mat_peptide FJ023612_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023613_HBc_P-B Product feature CHAIN FJ023613_HBc_P-B of FT:mat_peptide FJ023613_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|FJ023614_HBc_P-B Product feature CHAIN FJ023614_HBc_P-B of FT:mat_peptide FJ023614_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023617_HBc_P-B Product feature CHAIN FJ023617_HBc_P-B of FT:mat_peptide FJ023617_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|FJ023618_HBc_P-B Product feature CHAIN FJ023618_HBc_P-B of FT:mat_peptide FJ023618_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023620_HBc_P-B Product feature CHAIN FJ023620_HBc_P-B of FT:mat_peptide FJ023620_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023627_HBc_P-B Product feature CHAIN FJ023627_HBc_P-B of FT:mat_peptide FJ023627_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023628_HBc_P-B Product feature CHAIN FJ023628_HBc_P-B of FT:mat_peptide FJ023628_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023629_HBc_P-B Product feature CHAIN FJ023629_HBc_P-B of FT:mat_peptide FJ023629_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023630_HBc_P-B Product feature CHAIN FJ023630_HBc_P-B of FT:mat_peptide FJ023630_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|FJ023631_HBc_P-B Product feature CHAIN FJ023631_HBc_P-B of FT:mat_peptide FJ023631_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETAVVRSRVRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023632_HBc_P-B Product feature CHAIN FJ023632_HBc_P-B of FT:mat_peptide FJ023632_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023633_HBc_P-B Product feature CHAIN FJ023633_HBc_P-B of FT:mat_peptide FJ023633_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023634_HBc_P-B Product feature CHAIN FJ023634_HBc_P-B of FT:mat_peptide FJ023634_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023635_HBc_P-B Product feature CHAIN FJ023635_HBc_P-B of FT:mat_peptide FJ023635_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023636_HBc_P-B Product feature CHAIN FJ023636_HBc_P-B of FT:mat_peptide FJ023636_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023637_HBc_P-B Product feature CHAIN FJ023637_HBc_P-B of FT:mat_peptide FJ023637_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSXSRESQC
>gnl|hbvpro|FJ023638_HBc_P-B Product feature CHAIN FJ023638_HBc_P-B of FT:mat_peptide FJ023638_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032342_HBc_P-B Product feature CHAIN FJ032342_HBc_P-B of FT:mat_peptide FJ032342_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELISFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SRDLVVNYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSALPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032344_HBc_P-B Product feature CHAIN FJ032344_HBc_P-B of FT:mat_peptide FJ032344_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPEHTVVRQRRRSPGRRT
PSPRRPRSKSPRRRRSRSRESQC
>gnl|hbvpro|FJ032349_HBc_P-B Product feature CHAIN FJ032349_HBc_P-B of FT:mat_peptide FJ032349_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032352_HBc_P-B Product feature CHAIN FJ032352_HBc_P-B of FT:mat_peptide FJ032352_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFLPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032353_HBc_P-B Product feature CHAIN FJ032353_HBc_P-B of FT:mat_peptide FJ032353_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLGDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032354_HBc_P-B Product feature CHAIN FJ032354_HBc_P-B of FT:mat_peptide FJ032354_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032357_HBc_P-B Product feature CHAIN FJ032357_HBc_P-B of FT:mat_peptide FJ032357_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032358_HBc_P-B Product feature CHAIN FJ032358_HBc_P-B of FT:mat_peptide FJ032358_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEGPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349236_HBc_P-B Product feature CHAIN FJ349236_HBc_P-B of FT:mat_peptide FJ349236_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386582_HBc_P-B Product feature CHAIN FJ386582_HBc_P-B of FT:mat_peptide FJ386582_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386583_HBc_P-B Product feature CHAIN FJ386583_HBc_P-B of FT:mat_peptide FJ386583_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386584_HBc_P-B Product feature CHAIN FJ386584_HBc_P-B of FT:mat_peptide FJ386584_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386600_HBc_P-B Product feature CHAIN FJ386600_HBc_P-B of FT:mat_peptide FJ386600_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKENGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386608_HBc_P-B Product feature CHAIN FJ386608_HBc_P-B of FT:mat_peptide FJ386608_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|FJ386610_HBc_P-B Product feature CHAIN FJ386610_HBc_P-B of FT:mat_peptide FJ386610_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386615_HBc_P-B Product feature CHAIN FJ386615_HBc_P-B of FT:mat_peptide FJ386615_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDQA
SRDSVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386634_HBc_P-B Product feature CHAIN FJ386634_HBc_P-B of FT:mat_peptide FJ386634_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386636_HBc_P-B Product feature CHAIN FJ386636_HBc_P-B of FT:mat_peptide FJ386636_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386642_HBc_P-B Product feature CHAIN FJ386642_HBc_P-B of FT:mat_peptide FJ386642_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386648_HBc_P-B Product feature CHAIN FJ386648_HBc_P-B of FT:mat_peptide FJ386648_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPVHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|FJ386654_HBc_P-B Product feature CHAIN FJ386654_HBc_P-B of FT:mat_peptide FJ386654_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386655_HBc_P-B Product feature CHAIN FJ386655_HBc_P-B of FT:mat_peptide FJ386655_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386656_HBc_P-B Product feature CHAIN FJ386656_HBc_P-B of FT:mat_peptide FJ386656_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASAMFREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPEHTVVRQRRRSPGRRT
PSPRRPRSKSPRRRRSRSRESQC
>gnl|hbvpro|FJ386658_HBc_P-B Product feature CHAIN FJ386658_HBc_P-B of FT:mat_peptide FJ386658_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHLSCLTFGRDTVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386660_HBc_P-B Product feature CHAIN FJ386660_HBc_P-B of FT:mat_peptide FJ386660_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386666_HBc_P-B Product feature CHAIN FJ386666_HBc_P-B of FT:mat_peptide FJ386666_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386668_HBc_P-B Product feature CHAIN FJ386668_HBc_P-B of FT:mat_peptide FJ386668_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386669_HBc_P-B Product feature CHAIN FJ386669_HBc_P-B of FT:mat_peptide FJ386669_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386675_HBc_P-B Product feature CHAIN FJ386675_HBc_P-B of FT:mat_peptide FJ386675_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386676_HBc_P-B Product feature CHAIN FJ386676_HBc_P-B of FT:mat_peptide FJ386676_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386680_HBc_P-B Product feature CHAIN FJ386680_HBc_P-B of FT:mat_peptide FJ386680_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1244). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|FJ386681_HBc_P-B Product feature CHAIN FJ386681_HBc_P-B of FT:mat_peptide FJ386681_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|FJ386683_HBc_P-B Product feature CHAIN FJ386683_HBc_P-B of FT:mat_peptide FJ386683_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|FJ386684_HBc_P-B Product feature CHAIN FJ386684_HBc_P-B of FT:mat_peptide FJ386684_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386688_HBc_P-B Product feature CHAIN FJ386688_HBc_P-B of FT:mat_peptide FJ386688_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ518812_HBc_P-B Product feature CHAIN FJ518812_HBc_P-B of FT:mat_peptide FJ518812_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562219_HBc_P-B Product feature CHAIN FJ562219_HBc_P-B of FT:mat_peptide FJ562219_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562224_HBc_P-B Product feature CHAIN FJ562224_HBc_P-B of FT:mat_peptide FJ562224_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562231_HBc_P-B Product feature CHAIN FJ562231_HBc_P-B of FT:mat_peptide FJ562231_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562234_HBc_P-B Product feature CHAIN FJ562234_HBc_P-B of FT:mat_peptide FJ562234_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNGHMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562236_HBc_P-B Product feature CHAIN FJ562236_HBc_P-B of FT:mat_peptide FJ562236_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562237_HBc_P-B Product feature CHAIN FJ562237_HBc_P-B of FT:mat_peptide FJ562237_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562240_HBc_P-B Product feature CHAIN FJ562240_HBc_P-B of FT:mat_peptide FJ562240_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562246_HBc_P-B Product feature CHAIN FJ562246_HBc_P-B of FT:mat_peptide FJ562246_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSYHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562253_HBc_P-B Product feature CHAIN FJ562253_HBc_P-B of FT:mat_peptide FJ562253_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562254_HBc_P-B Product feature CHAIN FJ562254_HBc_P-B of FT:mat_peptide FJ562254_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ562257_HBc_P-B Product feature CHAIN FJ562257_HBc_P-B of FT:mat_peptide FJ562257_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562259_HBc_P-B Product feature CHAIN FJ562259_HBc_P-B of FT:mat_peptide FJ562259_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPQ
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562260_HBc_P-B Product feature CHAIN FJ562260_HBc_P-B of FT:mat_peptide FJ562260_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTANALYRESLESPEHCSDHHTAIRHAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ562262_HBc_P-B Product feature CHAIN FJ562262_HBc_P-B of FT:mat_peptide FJ562262_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I111). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562289_HBc_P-B Product feature CHAIN FJ562289_HBc_P-B of FT:mat_peptide FJ562289_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562296_HBc_P-B Product feature CHAIN FJ562296_HBc_P-B of FT:mat_peptide FJ562296_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRGRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562303_HBc_P-B Product feature CHAIN FJ562303_HBc_P-B of FT:mat_peptide FJ562303_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562311_HBc_P-B Product feature CHAIN FJ562311_HBc_P-B of FT:mat_peptide FJ562311_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDQG
SRDLVVGYVNVNMGIKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562312_HBc_P-B Product feature CHAIN FJ562312_HBc_P-B of FT:mat_peptide FJ562312_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRPRGRSSRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ562321_HBc_P-B Product feature CHAIN FJ562321_HBc_P-B of FT:mat_peptide FJ562321_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I214). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYRDALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ562322_HBc_P-B Product feature CHAIN FJ562322_HBc_P-B of FT:mat_peptide FJ562322_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ592177_HBc_P-B Product feature CHAIN FJ592177_HBc_P-B of FT:mat_peptide FJ592177_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ667207_HBc_P-B Product feature CHAIN FJ667207_HBc_P-B of FT:mat_peptide FJ667207_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mars_RJ_8803658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ751766_HBc_P-B Product feature CHAIN FJ751766_HBc_P-B of FT:mat_peptide FJ751766_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAIVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ751767_HBc_P-B Product feature CHAIN FJ751767_HBc_P-B of FT:mat_peptide FJ751767_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, LHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ751769_HBc_P-B Product feature CHAIN FJ751769_HBc_P-B of FT:mat_peptide FJ751769_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|FJ755833_HBc_P-B Product feature CHAIN FJ755833_HBc_P-B of FT:mat_peptide FJ755833_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEGPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQ
>gnl|hbvpro|FJ787444_HBc_P-B Product feature CHAIN FJ787444_HBc_P-B of FT:mat_peptide FJ787444_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787475_HBc_P-B Product feature CHAIN FJ787475_HBc_P-B of FT:mat_peptide FJ787475_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ787477_HBc_P-B Product feature CHAIN FJ787477_HBc_P-B of FT:mat_peptide FJ787477_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ899779_HBc_P-B Product feature CHAIN FJ899779_HBc_P-B of FT:mat_peptide FJ899779_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899784_HBc_P-B Product feature CHAIN FJ899784_HBc_P-B of FT:mat_peptide FJ899784_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ899785_HBc_P-B Product feature CHAIN FJ899785_HBc_P-B of FT:mat_peptide FJ899785_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVGHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ899786_HBc_P-B Product feature CHAIN FJ899786_HBc_P-B of FT:mat_peptide FJ899786_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLPFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVVCWGELMNLATWVGSNLDDPA
SRELVVGHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ899787_HBc_P-B Product feature CHAIN FJ899787_HBc_P-B of FT:mat_peptide FJ899787_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVGHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ899790_HBc_P-B Product feature CHAIN FJ899790_HBc_P-B of FT:mat_peptide FJ899790_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|FJ899791_HBc_P-B Product feature CHAIN FJ899791_HBc_P-B of FT:mat_peptide FJ899791_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|GQ358136_HBc_P-B Product feature CHAIN GQ358136_HBc_P-B of FT:mat_peptide GQ358136_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358137_HBc_P-B Product feature CHAIN GQ358137_HBc_P-B of FT:mat_peptide GQ358137_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRYQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358138_HBc_P-B Product feature CHAIN GQ358138_HBc_P-B of FT:mat_peptide GQ358138_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358140_HBc_P-B Product feature CHAIN GQ358140_HBc_P-B of FT:mat_peptide GQ358140_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358141_HBc_P-B Product feature CHAIN GQ358141_HBc_P-B of FT:mat_peptide GQ358141_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358142_HBc_P-B Product feature CHAIN GQ358142_HBc_P-B of FT:mat_peptide GQ358142_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358143_HBc_P-B Product feature CHAIN GQ358143_HBc_P-B of FT:mat_peptide GQ358143_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358144_HBc_P-B Product feature CHAIN GQ358144_HBc_P-B of FT:mat_peptide GQ358144_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRKAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358145_HBc_P-B Product feature CHAIN GQ358145_HBc_P-B of FT:mat_peptide GQ358145_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVEVLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWLGSNLKDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRGRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358146_HBc_P-B Product feature CHAIN GQ358146_HBc_P-B of FT:mat_peptide GQ358146_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVEVLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWLGSNLKDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358147_HBc_P-B Product feature CHAIN GQ358147_HBc_P-B of FT:mat_peptide GQ358147_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVEVLSFLPSDSFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWLGSNLKDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358148_HBc_P-B Product feature CHAIN GQ358148_HBc_P-B of FT:mat_peptide GQ358148_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SKELVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358149_HBc_P-B Product feature CHAIN GQ358149_HBc_P-B of FT:mat_peptide GQ358149_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358150_HBc_P-B Product feature CHAIN GQ358150_HBc_P-B of FT:mat_peptide GQ358150_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358151_HBc_P-B Product feature CHAIN GQ358151_HBc_P-B of FT:mat_peptide GQ358151_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358152_HBc_P-B Product feature CHAIN GQ358152_HBc_P-B of FT:mat_peptide GQ358152_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377519_HBc_P-B Product feature CHAIN GQ377519_HBc_P-B of FT:mat_peptide GQ377519_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377525_HBc_P-B Product feature CHAIN GQ377525_HBc_P-B of FT:mat_peptide GQ377525_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377537_HBc_P-B Product feature CHAIN GQ377537_HBc_P-B of FT:mat_peptide GQ377537_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377542_HBc_P-B Product feature CHAIN GQ377542_HBc_P-B of FT:mat_peptide GQ377542_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377547_HBc_P-B Product feature CHAIN GQ377547_HBc_P-B of FT:mat_peptide GQ377547_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377558_HBc_P-B Product feature CHAIN GQ377558_HBc_P-B of FT:mat_peptide GQ377558_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377561_HBc_P-B Product feature CHAIN GQ377561_HBc_P-B of FT:mat_peptide GQ377561_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377566_HBc_P-B Product feature CHAIN GQ377566_HBc_P-B of FT:mat_peptide GQ377566_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377568_HBc_P-B Product feature CHAIN GQ377568_HBc_P-B of FT:mat_peptide GQ377568_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377569_HBc_P-B Product feature CHAIN GQ377569_HBc_P-B of FT:mat_peptide GQ377569_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377582_HBc_P-B Product feature CHAIN GQ377582_HBc_P-B of FT:mat_peptide GQ377582_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377587_HBc_P-B Product feature CHAIN GQ377587_HBc_P-B of FT:mat_peptide GQ377587_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377588_HBc_P-B Product feature CHAIN GQ377588_HBc_P-B of FT:mat_peptide GQ377588_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377606_HBc_P-B Product feature CHAIN GQ377606_HBc_P-B of FT:mat_peptide GQ377606_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377610_HBc_P-B Product feature CHAIN GQ377610_HBc_P-B of FT:mat_peptide GQ377610_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377612_HBc_P-B Product feature CHAIN GQ377612_HBc_P-B of FT:mat_peptide GQ377612_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377622_HBc_P-B Product feature CHAIN GQ377622_HBc_P-B of FT:mat_peptide GQ377622_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GQ377625_HBc_P-B Product feature CHAIN GQ377625_HBc_P-B of FT:mat_peptide GQ377625_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|GQ377629_HBc_P-B Product feature CHAIN GQ377629_HBc_P-B of FT:mat_peptide GQ377629_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377638_HBc_P-B Product feature CHAIN GQ377638_HBc_P-B of FT:mat_peptide GQ377638_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377639_HBc_P-B Product feature CHAIN GQ377639_HBc_P-B of FT:mat_peptide GQ377639_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377641_HBc_P-B Product feature CHAIN GQ377641_HBc_P-B of FT:mat_peptide GQ377641_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377643_HBc_P-B Product feature CHAIN GQ377643_HBc_P-B of FT:mat_peptide GQ377643_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377644_HBc_P-B Product feature CHAIN GQ377644_HBc_P-B of FT:mat_peptide GQ377644_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQCILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475340_HBc_P-B Product feature CHAIN GQ475340_HBc_P-B of FT:mat_peptide GQ475340_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855522_HBc_P-B Product feature CHAIN GQ855522_HBc_P-B of FT:mat_peptide GQ855522_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 23). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855526_HBc_P-B Product feature CHAIN GQ855526_HBc_P-B of FT:mat_peptide GQ855526_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 103). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSPESQC
>gnl|hbvpro|GQ855532_HBc_P-B Product feature CHAIN GQ855532_HBc_P-B of FT:mat_peptide GQ855532_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 210). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924603_HBc_P-B Product feature CHAIN GQ924603_HBc_P-B of FT:mat_peptide GQ924603_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924605_HBc_P-B Product feature CHAIN GQ924605_HBc_P-B of FT:mat_peptide GQ924605_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEXLVSFGVWIRTXPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRGRRSQSRESQC
>gnl|hbvpro|GQ924606_HBc_P-B Product feature CHAIN GQ924606_HBc_P-B of FT:mat_peptide GQ924606_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASXLYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924607_HBc_P-B Product feature CHAIN GQ924607_HBc_P-B of FT:mat_peptide GQ924607_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQWPRRRRSQSRESQC
>gnl|hbvpro|GQ924608_HBc_P-B Product feature CHAIN GQ924608_HBc_P-B of FT:mat_peptide GQ924608_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924610_HBc_P-B Product feature CHAIN GQ924610_HBc_P-B of FT:mat_peptide GQ924610_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924611_HBc_P-B Product feature CHAIN GQ924611_HBc_P-B of FT:mat_peptide GQ924611_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924617_HBc_P-B Product feature CHAIN GQ924617_HBc_P-B of FT:mat_peptide GQ924617_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRPRSRSLRRRT
PSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|GQ924621_HBc_P-B Product feature CHAIN GQ924621_HBc_P-B of FT:mat_peptide GQ924621_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924624_HBc_P-B Product feature CHAIN GQ924624_HBc_P-B of FT:mat_peptide GQ924624_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924625_HBc_P-B Product feature CHAIN GQ924625_HBc_P-B of FT:mat_peptide GQ924625_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924626_HBc_P-B Product feature CHAIN GQ924626_HBc_P-B of FT:mat_peptide GQ924626_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPDDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETTVVRQRCRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|GQ924627_HBc_P-B Product feature CHAIN GQ924627_HBc_P-B of FT:mat_peptide GQ924627_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924628_HBc_P-B Product feature CHAIN GQ924628_HBc_P-B of FT:mat_peptide GQ924628_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSREPQC
>gnl|hbvpro|GQ924630_HBc_P-B Product feature CHAIN GQ924630_HBc_P-B of FT:mat_peptide GQ924630_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPVDFYPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELVNLATWVGGNLEDQA
SRELVVGYVNGNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWLRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSREPQC
>gnl|hbvpro|GQ924631_HBc_P-B Product feature CHAIN GQ924631_HBc_P-B of FT:mat_peptide GQ924631_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924632_HBc_P-B Product feature CHAIN GQ924632_HBc_P-B of FT:mat_peptide GQ924632_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTASALYREALESPEHVSAHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ924634_HBc_P-B Product feature CHAIN GQ924634_HBc_P-B of FT:mat_peptide GQ924634_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924635_HBc_P-B Product feature CHAIN GQ924635_HBc_P-B of FT:mat_peptide GQ924635_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCITFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRQGSRSPRRRT
PSPRRRRSQSPRRRRFQCRECQC
>gnl|hbvpro|GQ924637_HBc_P-B Product feature CHAIN GQ924637_HBc_P-B of FT:mat_peptide GQ924637_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDIYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGIKIRQLLWFHISCITFGREIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|GQ924638_HBc_P-B Product feature CHAIN GQ924638_HBc_P-B of FT:mat_peptide GQ924638_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKLRQILWFHLSCLTFGREVVLEYLVSFGVWIRTPSAYRPQNAPILSTLPETTVVRGRGRSPRRRT
PSRRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924639_HBc_P-B Product feature CHAIN GQ924639_HBc_P-B of FT:mat_peptide GQ924639_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSRRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924640_HBc_P-B Product feature CHAIN GQ924640_HBc_P-B of FT:mat_peptide GQ924640_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924641_HBc_P-B Product feature CHAIN GQ924641_HBc_P-B of FT:mat_peptide GQ924641_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPTDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRESVVRYVNVNMGLKIRQLLWFHISCITFGREIVVEYLVSFGVWIRTPPAYRPPNAPILSTLPECAVVSRRGRSPRRRT
PSPRRRRSQSPRRRRSQCREPQC
>gnl|hbvpro|GQ924644_HBc_P-B Product feature CHAIN GQ924644_HBc_P-B of FT:mat_peptide GQ924644_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M79). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924645_HBc_P-B Product feature CHAIN GQ924645_HBc_P-B of FT:mat_peptide GQ924645_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGREVVLEYLVSFGVWIRTPQAYRPSNAPILSTLPETTVIRRRSRSLRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924646_HBc_P-B Product feature CHAIN GQ924646_HBc_P-B of FT:mat_peptide GQ924646_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAVLCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPQNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ924647_HBc_P-B Product feature CHAIN GQ924647_HBc_P-B of FT:mat_peptide GQ924647_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924648_HBc_P-B Product feature CHAIN GQ924648_HBc_P-B of FT:mat_peptide GQ924648_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHISPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSHVNVNMGLKMRQILWFHISCLCFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924651_HBc_P-B Product feature CHAIN GQ924651_HBc_P-B of FT:mat_peptide GQ924651_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924653_HBc_P-B Product feature CHAIN GQ924653_HBc_P-B of FT:mat_peptide GQ924653_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924654_HBc_P-B Product feature CHAIN GQ924654_HBc_P-B of FT:mat_peptide GQ924654_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924656_HBc_P-B Product feature CHAIN GQ924656_HBc_P-B of FT:mat_peptide GQ924656_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPCRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ924660_HBc_P-B Product feature CHAIN GQ924660_HBc_P-B of FT:mat_peptide GQ924660_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M74). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GU357842_HBc_P-B Product feature CHAIN GU357842_HBc_P-B of FT:mat_peptide GU357842_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU434372_HBc_P-B Product feature CHAIN GU434372_HBc_P-B of FT:mat_peptide GU434372_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU434373_HBc_P-B Product feature CHAIN GU434373_HBc_P-B of FT:mat_peptide GU434373_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU451682_HBc_P-B Product feature CHAIN GU451682_HBc_P-B of FT:mat_peptide GU451682_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815548_HBc_P-B Product feature CHAIN GU815548_HBc_P-B of FT:mat_peptide GU815548_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815549_HBc_P-B Product feature CHAIN GU815549_HBc_P-B of FT:mat_peptide GU815549_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815550_HBc_P-B Product feature CHAIN GU815550_HBc_P-B of FT:mat_peptide GU815550_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815551_HBc_P-B Product feature CHAIN GU815551_HBc_P-B of FT:mat_peptide GU815551_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815552_HBc_P-B Product feature CHAIN GU815552_HBc_P-B of FT:mat_peptide GU815552_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815553_HBc_P-B Product feature CHAIN GU815553_HBc_P-B of FT:mat_peptide GU815553_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815554_HBc_P-B Product feature CHAIN GU815554_HBc_P-B of FT:mat_peptide GU815554_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815555_HBc_P-B Product feature CHAIN GU815555_HBc_P-B of FT:mat_peptide GU815555_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815556_HBc_P-B Product feature CHAIN GU815556_HBc_P-B of FT:mat_peptide GU815556_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815557_HBc_P-B Product feature CHAIN GU815557_HBc_P-B of FT:mat_peptide GU815557_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815558_HBc_P-B Product feature CHAIN GU815558_HBc_P-B of FT:mat_peptide GU815558_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=183 residues).
VDIDPYKEFGASVELLSFLPSDFFPPIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815559_HBc_P-B Product feature CHAIN GU815559_HBc_P-B of FT:mat_peptide GU815559_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815560_HBc_P-B Product feature CHAIN GU815560_HBc_P-B of FT:mat_peptide GU815560_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815561_HBc_P-B Product feature CHAIN GU815561_HBc_P-B of FT:mat_peptide GU815561_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815562_HBc_P-B Product feature CHAIN GU815562_HBc_P-B of FT:mat_peptide GU815562_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815563_HBc_P-B Product feature CHAIN GU815563_HBc_P-B of FT:mat_peptide GU815563_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815564_HBc_P-B Product feature CHAIN GU815564_HBc_P-B of FT:mat_peptide GU815564_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815565_HBc_P-B Product feature CHAIN GU815565_HBc_P-B of FT:mat_peptide GU815565_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815566_HBc_P-B Product feature CHAIN GU815566_HBc_P-B of FT:mat_peptide GU815566_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815567_HBc_P-B Product feature CHAIN GU815567_HBc_P-B of FT:mat_peptide GU815567_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815568_HBc_P-B Product feature CHAIN GU815568_HBc_P-B of FT:mat_peptide GU815568_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815569_HBc_P-B Product feature CHAIN GU815569_HBc_P-B of FT:mat_peptide GU815569_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815570_HBc_P-B Product feature CHAIN GU815570_HBc_P-B of FT:mat_peptide GU815570_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815571_HBc_P-B Product feature CHAIN GU815571_HBc_P-B of FT:mat_peptide GU815571_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815572_HBc_P-B Product feature CHAIN GU815572_HBc_P-B of FT:mat_peptide GU815572_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPEATVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU815573_HBc_P-B Product feature CHAIN GU815573_HBc_P-B of FT:mat_peptide GU815573_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815574_HBc_P-B Product feature CHAIN GU815574_HBc_P-B of FT:mat_peptide GU815574_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815575_HBc_P-B Product feature CHAIN GU815575_HBc_P-B of FT:mat_peptide GU815575_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815576_HBc_P-B Product feature CHAIN GU815576_HBc_P-B of FT:mat_peptide GU815576_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815577_HBc_P-B Product feature CHAIN GU815577_HBc_P-B of FT:mat_peptide GU815577_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815578_HBc_P-B Product feature CHAIN GU815578_HBc_P-B of FT:mat_peptide GU815578_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815579_HBc_P-B Product feature CHAIN GU815579_HBc_P-B of FT:mat_peptide GU815579_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815581_HBc_P-B Product feature CHAIN GU815581_HBc_P-B of FT:mat_peptide GU815581_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815583_HBc_P-B Product feature CHAIN GU815583_HBc_P-B of FT:mat_peptide GU815583_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815584_HBc_P-B Product feature CHAIN GU815584_HBc_P-B of FT:mat_peptide GU815584_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815585_HBc_P-B Product feature CHAIN GU815585_HBc_P-B of FT:mat_peptide GU815585_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815586_HBc_P-B Product feature CHAIN GU815586_HBc_P-B of FT:mat_peptide GU815586_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815587_HBc_P-B Product feature CHAIN GU815587_HBc_P-B of FT:mat_peptide GU815587_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYEEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSKLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815588_HBc_P-B Product feature CHAIN GU815588_HBc_P-B of FT:mat_peptide GU815588_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815590_HBc_P-B Product feature CHAIN GU815590_HBc_P-B of FT:mat_peptide GU815590_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815591_HBc_P-B Product feature CHAIN GU815591_HBc_P-B of FT:mat_peptide GU815591_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815593_HBc_P-B Product feature CHAIN GU815593_HBc_P-B of FT:mat_peptide GU815593_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815594_HBc_P-B Product feature CHAIN GU815594_HBc_P-B of FT:mat_peptide GU815594_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815595_HBc_P-B Product feature CHAIN GU815595_HBc_P-B of FT:mat_peptide GU815595_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815596_HBc_P-B Product feature CHAIN GU815596_HBc_P-B of FT:mat_peptide GU815596_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815597_HBc_P-B Product feature CHAIN GU815597_HBc_P-B of FT:mat_peptide GU815597_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815598_HBc_P-B Product feature CHAIN GU815598_HBc_P-B of FT:mat_peptide GU815598_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815599_HBc_P-B Product feature CHAIN GU815599_HBc_P-B of FT:mat_peptide GU815599_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815600_HBc_P-B Product feature CHAIN GU815600_HBc_P-B of FT:mat_peptide GU815600_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815601_HBc_P-B Product feature CHAIN GU815601_HBc_P-B of FT:mat_peptide GU815601_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815602_HBc_P-B Product feature CHAIN GU815602_HBc_P-B of FT:mat_peptide GU815602_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815603_HBc_P-B Product feature CHAIN GU815603_HBc_P-B of FT:mat_peptide GU815603_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815604_HBc_P-B Product feature CHAIN GU815604_HBc_P-B of FT:mat_peptide GU815604_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815605_HBc_P-B Product feature CHAIN GU815605_HBc_P-B of FT:mat_peptide GU815605_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815606_HBc_P-B Product feature CHAIN GU815606_HBc_P-B of FT:mat_peptide GU815606_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815607_HBc_P-B Product feature CHAIN GU815607_HBc_P-B of FT:mat_peptide GU815607_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815608_HBc_P-B Product feature CHAIN GU815608_HBc_P-B of FT:mat_peptide GU815608_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815609_HBc_P-B Product feature CHAIN GU815609_HBc_P-B of FT:mat_peptide GU815609_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIGPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815610_HBc_P-B Product feature CHAIN GU815610_HBc_P-B of FT:mat_peptide GU815610_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815611_HBc_P-B Product feature CHAIN GU815611_HBc_P-B of FT:mat_peptide GU815611_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815612_HBc_P-B Product feature CHAIN GU815612_HBc_P-B of FT:mat_peptide GU815612_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDPLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815613_HBc_P-B Product feature CHAIN GU815613_HBc_P-B of FT:mat_peptide GU815613_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815614_HBc_P-B Product feature CHAIN GU815614_HBc_P-B of FT:mat_peptide GU815614_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815616_HBc_P-B Product feature CHAIN GU815616_HBc_P-B of FT:mat_peptide GU815616_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815617_HBc_P-B Product feature CHAIN GU815617_HBc_P-B of FT:mat_peptide GU815617_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815618_HBc_P-B Product feature CHAIN GU815618_HBc_P-B of FT:mat_peptide GU815618_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815619_HBc_P-B Product feature CHAIN GU815619_HBc_P-B of FT:mat_peptide GU815619_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISYLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815620_HBc_P-B Product feature CHAIN GU815620_HBc_P-B of FT:mat_peptide GU815620_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815621_HBc_P-B Product feature CHAIN GU815621_HBc_P-B of FT:mat_peptide GU815621_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815622_HBc_P-B Product feature CHAIN GU815622_HBc_P-B of FT:mat_peptide GU815622_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815623_HBc_P-B Product feature CHAIN GU815623_HBc_P-B of FT:mat_peptide GU815623_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815624_HBc_P-B Product feature CHAIN GU815624_HBc_P-B of FT:mat_peptide GU815624_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815625_HBc_P-B Product feature CHAIN GU815625_HBc_P-B of FT:mat_peptide GU815625_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815626_HBc_P-B Product feature CHAIN GU815626_HBc_P-B of FT:mat_peptide GU815626_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815627_HBc_P-B Product feature CHAIN GU815627_HBc_P-B of FT:mat_peptide GU815627_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVDLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815628_HBc_P-B Product feature CHAIN GU815628_HBc_P-B of FT:mat_peptide GU815628_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815629_HBc_P-B Product feature CHAIN GU815629_HBc_P-B of FT:mat_peptide GU815629_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815630_HBc_P-B Product feature CHAIN GU815630_HBc_P-B of FT:mat_peptide GU815630_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815631_HBc_P-B Product feature CHAIN GU815631_HBc_P-B of FT:mat_peptide GU815631_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815632_HBc_P-B Product feature CHAIN GU815632_HBc_P-B of FT:mat_peptide GU815632_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815633_HBc_P-B Product feature CHAIN GU815633_HBc_P-B of FT:mat_peptide GU815633_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815634_HBc_P-B Product feature CHAIN GU815634_HBc_P-B of FT:mat_peptide GU815634_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-10). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815635_HBc_P-B Product feature CHAIN GU815635_HBc_P-B of FT:mat_peptide GU815635_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815636_HBc_P-B Product feature CHAIN GU815636_HBc_P-B of FT:mat_peptide GU815636_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815637_HBc_P-B Product feature CHAIN GU815637_HBc_P-B of FT:mat_peptide GU815637_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815638_HBc_P-B Product feature CHAIN GU815638_HBc_P-B of FT:mat_peptide GU815638_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815639_HBc_P-B Product feature CHAIN GU815639_HBc_P-B of FT:mat_peptide GU815639_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815640_HBc_P-B Product feature CHAIN GU815640_HBc_P-B of FT:mat_peptide GU815640_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815641_HBc_P-B Product feature CHAIN GU815641_HBc_P-B of FT:mat_peptide GU815641_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815642_HBc_P-B Product feature CHAIN GU815642_HBc_P-B of FT:mat_peptide GU815642_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815643_HBc_P-B Product feature CHAIN GU815643_HBc_P-B of FT:mat_peptide GU815643_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815644_HBc_P-B Product feature CHAIN GU815644_HBc_P-B of FT:mat_peptide GU815644_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815645_HBc_P-B Product feature CHAIN GU815645_HBc_P-B of FT:mat_peptide GU815645_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815646_HBc_P-B Product feature CHAIN GU815646_HBc_P-B of FT:mat_peptide GU815646_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815647_HBc_P-B Product feature CHAIN GU815647_HBc_P-B of FT:mat_peptide GU815647_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815648_HBc_P-B Product feature CHAIN GU815648_HBc_P-B of FT:mat_peptide GU815648_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815649_HBc_P-B Product feature CHAIN GU815649_HBc_P-B of FT:mat_peptide GU815649_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815650_HBc_P-B Product feature CHAIN GU815650_HBc_P-B of FT:mat_peptide GU815650_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815651_HBc_P-B Product feature CHAIN GU815651_HBc_P-B of FT:mat_peptide GU815651_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815652_HBc_P-B Product feature CHAIN GU815652_HBc_P-B of FT:mat_peptide GU815652_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815653_HBc_P-B Product feature CHAIN GU815653_HBc_P-B of FT:mat_peptide GU815653_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815654_HBc_P-B Product feature CHAIN GU815654_HBc_P-B of FT:mat_peptide GU815654_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815656_HBc_P-B Product feature CHAIN GU815656_HBc_P-B of FT:mat_peptide GU815656_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815657_HBc_P-B Product feature CHAIN GU815657_HBc_P-B of FT:mat_peptide GU815657_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISRLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815658_HBc_P-B Product feature CHAIN GU815658_HBc_P-B of FT:mat_peptide GU815658_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815659_HBc_P-B Product feature CHAIN GU815659_HBc_P-B of FT:mat_peptide GU815659_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815660_HBc_P-B Product feature CHAIN GU815660_HBc_P-B of FT:mat_peptide GU815660_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815661_HBc_P-B Product feature CHAIN GU815661_HBc_P-B of FT:mat_peptide GU815661_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815662_HBc_P-B Product feature CHAIN GU815662_HBc_P-B of FT:mat_peptide GU815662_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSRSPRRRRSQSRESQC
>gnl|hbvpro|GU815663_HBc_P-B Product feature CHAIN GU815663_HBc_P-B of FT:mat_peptide GU815663_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815664_HBc_P-B Product feature CHAIN GU815664_HBc_P-B of FT:mat_peptide GU815664_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815665_HBc_P-B Product feature CHAIN GU815665_HBc_P-B of FT:mat_peptide GU815665_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815666_HBc_P-B Product feature CHAIN GU815666_HBc_P-B of FT:mat_peptide GU815666_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815667_HBc_P-B Product feature CHAIN GU815667_HBc_P-B of FT:mat_peptide GU815667_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815668_HBc_P-B Product feature CHAIN GU815668_HBc_P-B of FT:mat_peptide GU815668_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWAGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815669_HBc_P-B Product feature CHAIN GU815669_HBc_P-B of FT:mat_peptide GU815669_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815670_HBc_P-B Product feature CHAIN GU815670_HBc_P-B of FT:mat_peptide GU815670_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815672_HBc_P-B Product feature CHAIN GU815672_HBc_P-B of FT:mat_peptide GU815672_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815673_HBc_P-B Product feature CHAIN GU815673_HBc_P-B of FT:mat_peptide GU815673_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815674_HBc_P-B Product feature CHAIN GU815674_HBc_P-B of FT:mat_peptide GU815674_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815675_HBc_P-B Product feature CHAIN GU815675_HBc_P-B of FT:mat_peptide GU815675_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815676_HBc_P-B Product feature CHAIN GU815676_HBc_P-B of FT:mat_peptide GU815676_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVSVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815677_HBc_P-B Product feature CHAIN GU815677_HBc_P-B of FT:mat_peptide GU815677_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQVILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815678_HBc_P-B Product feature CHAIN GU815678_HBc_P-B of FT:mat_peptide GU815678_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFNISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815679_HBc_P-B Product feature CHAIN GU815679_HBc_P-B of FT:mat_peptide GU815679_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815680_HBc_P-B Product feature CHAIN GU815680_HBc_P-B of FT:mat_peptide GU815680_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815681_HBc_P-B Product feature CHAIN GU815681_HBc_P-B of FT:mat_peptide GU815681_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815683_HBc_P-B Product feature CHAIN GU815683_HBc_P-B of FT:mat_peptide GU815683_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815684_HBc_P-B Product feature CHAIN GU815684_HBc_P-B of FT:mat_peptide GU815684_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815685_HBc_P-B Product feature CHAIN GU815685_HBc_P-B of FT:mat_peptide GU815685_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815686_HBc_P-B Product feature CHAIN GU815686_HBc_P-B of FT:mat_peptide GU815686_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815687_HBc_P-B Product feature CHAIN GU815687_HBc_P-B of FT:mat_peptide GU815687_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815688_HBc_P-B Product feature CHAIN GU815688_HBc_P-B of FT:mat_peptide GU815688_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815689_HBc_P-B Product feature CHAIN GU815689_HBc_P-B of FT:mat_peptide GU815689_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815691_HBc_P-B Product feature CHAIN GU815691_HBc_P-B of FT:mat_peptide GU815691_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815692_HBc_P-B Product feature CHAIN GU815692_HBc_P-B of FT:mat_peptide GU815692_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815693_HBc_P-B Product feature CHAIN GU815693_HBc_P-B of FT:mat_peptide GU815693_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815694_HBc_P-B Product feature CHAIN GU815694_HBc_P-B of FT:mat_peptide GU815694_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815695_HBc_P-B Product feature CHAIN GU815695_HBc_P-B of FT:mat_peptide GU815695_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPKTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815696_HBc_P-B Product feature CHAIN GU815696_HBc_P-B of FT:mat_peptide GU815696_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHPTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815697_HBc_P-B Product feature CHAIN GU815697_HBc_P-B of FT:mat_peptide GU815697_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815698_HBc_P-B Product feature CHAIN GU815698_HBc_P-B of FT:mat_peptide GU815698_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815699_HBc_P-B Product feature CHAIN GU815699_HBc_P-B of FT:mat_peptide GU815699_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815700_HBc_P-B Product feature CHAIN GU815700_HBc_P-B of FT:mat_peptide GU815700_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815701_HBc_P-B Product feature CHAIN GU815701_HBc_P-B of FT:mat_peptide GU815701_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815702_HBc_P-B Product feature CHAIN GU815702_HBc_P-B of FT:mat_peptide GU815702_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815703_HBc_P-B Product feature CHAIN GU815703_HBc_P-B of FT:mat_peptide GU815703_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815704_HBc_P-B Product feature CHAIN GU815704_HBc_P-B of FT:mat_peptide GU815704_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815705_HBc_P-B Product feature CHAIN GU815705_HBc_P-B of FT:mat_peptide GU815705_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815706_HBc_P-B Product feature CHAIN GU815706_HBc_P-B of FT:mat_peptide GU815706_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815707_HBc_P-B Product feature CHAIN GU815707_HBc_P-B of FT:mat_peptide GU815707_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815708_HBc_P-B Product feature CHAIN GU815708_HBc_P-B of FT:mat_peptide GU815708_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815709_HBc_P-B Product feature CHAIN GU815709_HBc_P-B of FT:mat_peptide GU815709_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815710_HBc_P-B Product feature CHAIN GU815710_HBc_P-B of FT:mat_peptide GU815710_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815711_HBc_P-B Product feature CHAIN GU815711_HBc_P-B of FT:mat_peptide GU815711_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815712_HBc_P-B Product feature CHAIN GU815712_HBc_P-B of FT:mat_peptide GU815712_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRETLESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNTPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815713_HBc_P-B Product feature CHAIN GU815713_HBc_P-B of FT:mat_peptide GU815713_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815715_HBc_P-B Product feature CHAIN GU815715_HBc_P-B of FT:mat_peptide GU815715_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815716_HBc_P-B Product feature CHAIN GU815716_HBc_P-B of FT:mat_peptide GU815716_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815717_HBc_P-B Product feature CHAIN GU815717_HBc_P-B of FT:mat_peptide GU815717_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815718_HBc_P-B Product feature CHAIN GU815718_HBc_P-B of FT:mat_peptide GU815718_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815719_HBc_P-B Product feature CHAIN GU815719_HBc_P-B of FT:mat_peptide GU815719_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815720_HBc_P-B Product feature CHAIN GU815720_HBc_P-B of FT:mat_peptide GU815720_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815721_HBc_P-B Product feature CHAIN GU815721_HBc_P-B of FT:mat_peptide GU815721_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815722_HBc_P-B Product feature CHAIN GU815722_HBc_P-B of FT:mat_peptide GU815722_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MGIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815723_HBc_P-B Product feature CHAIN GU815723_HBc_P-B of FT:mat_peptide GU815723_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815724_HBc_P-B Product feature CHAIN GU815724_HBc_P-B of FT:mat_peptide GU815724_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815725_HBc_P-B Product feature CHAIN GU815725_HBc_P-B of FT:mat_peptide GU815725_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815726_HBc_P-B Product feature CHAIN GU815726_HBc_P-B of FT:mat_peptide GU815726_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815727_HBc_P-B Product feature CHAIN GU815727_HBc_P-B of FT:mat_peptide GU815727_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815728_HBc_P-B Product feature CHAIN GU815728_HBc_P-B of FT:mat_peptide GU815728_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815729_HBc_P-B Product feature CHAIN GU815729_HBc_P-B of FT:mat_peptide GU815729_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815730_HBc_P-B Product feature CHAIN GU815730_HBc_P-B of FT:mat_peptide GU815730_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815731_HBc_P-B Product feature CHAIN GU815731_HBc_P-B of FT:mat_peptide GU815731_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815732_HBc_P-B Product feature CHAIN GU815732_HBc_P-B of FT:mat_peptide GU815732_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815733_HBc_P-B Product feature CHAIN GU815733_HBc_P-B of FT:mat_peptide GU815733_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815734_HBc_P-B Product feature CHAIN GU815734_HBc_P-B of FT:mat_peptide GU815734_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815735_HBc_P-B Product feature CHAIN GU815735_HBc_P-B of FT:mat_peptide GU815735_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815736_HBc_P-B Product feature CHAIN GU815736_HBc_P-B of FT:mat_peptide GU815736_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815737_HBc_P-B Product feature CHAIN GU815737_HBc_P-B of FT:mat_peptide GU815737_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815738_HBc_P-B Product feature CHAIN GU815738_HBc_P-B of FT:mat_peptide GU815738_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815739_HBc_P-B Product feature CHAIN GU815739_HBc_P-B of FT:mat_peptide GU815739_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815740_HBc_P-B Product feature CHAIN GU815740_HBc_P-B of FT:mat_peptide GU815740_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815741_HBc_P-B Product feature CHAIN GU815741_HBc_P-B of FT:mat_peptide GU815741_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815742_HBc_P-B Product feature CHAIN GU815742_HBc_P-B of FT:mat_peptide GU815742_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815743_HBc_P-B Product feature CHAIN GU815743_HBc_P-B of FT:mat_peptide GU815743_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815744_HBc_P-B Product feature CHAIN GU815744_HBc_P-B of FT:mat_peptide GU815744_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815745_HBc_P-B Product feature CHAIN GU815745_HBc_P-B of FT:mat_peptide GU815745_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815746_HBc_P-B Product feature CHAIN GU815746_HBc_P-B of FT:mat_peptide GU815746_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815747_HBc_P-B Product feature CHAIN GU815747_HBc_P-B of FT:mat_peptide GU815747_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNRGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815748_HBc_P-B Product feature CHAIN GU815748_HBc_P-B of FT:mat_peptide GU815748_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNRGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815749_HBc_P-B Product feature CHAIN GU815749_HBc_P-B of FT:mat_peptide GU815749_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815750_HBc_P-B Product feature CHAIN GU815750_HBc_P-B of FT:mat_peptide GU815750_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815751_HBc_P-B Product feature CHAIN GU815751_HBc_P-B of FT:mat_peptide GU815751_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815752_HBc_P-B Product feature CHAIN GU815752_HBc_P-B of FT:mat_peptide GU815752_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRPQSPRRRRSQSRESQC
>gnl|hbvpro|GU815753_HBc_P-B Product feature CHAIN GU815753_HBc_P-B of FT:mat_peptide GU815753_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815754_HBc_P-B Product feature CHAIN GU815754_HBc_P-B of FT:mat_peptide GU815754_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815755_HBc_P-B Product feature CHAIN GU815755_HBc_P-B of FT:mat_peptide GU815755_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815756_HBc_P-B Product feature CHAIN GU815756_HBc_P-B of FT:mat_peptide GU815756_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815757_HBc_P-B Product feature CHAIN GU815757_HBc_P-B of FT:mat_peptide GU815757_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815759_HBc_P-B Product feature CHAIN GU815759_HBc_P-B of FT:mat_peptide GU815759_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815760_HBc_P-B Product feature CHAIN GU815760_HBc_P-B of FT:mat_peptide GU815760_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815761_HBc_P-B Product feature CHAIN GU815761_HBc_P-B of FT:mat_peptide GU815761_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRCRRSQSRESQC
>gnl|hbvpro|GU815762_HBc_P-B Product feature CHAIN GU815762_HBc_P-B of FT:mat_peptide GU815762_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815764_HBc_P-B Product feature CHAIN GU815764_HBc_P-B of FT:mat_peptide GU815764_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRCRRSQSRESQC
>gnl|hbvpro|GU815765_HBc_P-B Product feature CHAIN GU815765_HBc_P-B of FT:mat_peptide GU815765_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815766_HBc_P-B Product feature CHAIN GU815766_HBc_P-B of FT:mat_peptide GU815766_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815767_HBc_P-B Product feature CHAIN GU815767_HBc_P-B of FT:mat_peptide GU815767_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815768_HBc_P-B Product feature CHAIN GU815768_HBc_P-B of FT:mat_peptide GU815768_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815769_HBc_P-B Product feature CHAIN GU815769_HBc_P-B of FT:mat_peptide GU815769_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815770_HBc_P-B Product feature CHAIN GU815770_HBc_P-B of FT:mat_peptide GU815770_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815771_HBc_P-B Product feature CHAIN GU815771_HBc_P-B of FT:mat_peptide GU815771_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815772_HBc_P-B Product feature CHAIN GU815772_HBc_P-B of FT:mat_peptide GU815772_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815773_HBc_P-B Product feature CHAIN GU815773_HBc_P-B of FT:mat_peptide GU815773_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815774_HBc_P-B Product feature CHAIN GU815774_HBc_P-B of FT:mat_peptide GU815774_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815775_HBc_P-B Product feature CHAIN GU815775_HBc_P-B of FT:mat_peptide GU815775_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLVDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815776_HBc_P-B Product feature CHAIN GU815776_HBc_P-B of FT:mat_peptide GU815776_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815777_HBc_P-B Product feature CHAIN GU815777_HBc_P-B of FT:mat_peptide GU815777_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815778_HBc_P-B Product feature CHAIN GU815778_HBc_P-B of FT:mat_peptide GU815778_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815779_HBc_P-B Product feature CHAIN GU815779_HBc_P-B of FT:mat_peptide GU815779_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815780_HBc_P-B Product feature CHAIN GU815780_HBc_P-B of FT:mat_peptide GU815780_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815781_HBc_P-B Product feature CHAIN GU815781_HBc_P-B of FT:mat_peptide GU815781_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815782_HBc_P-B Product feature CHAIN GU815782_HBc_P-B of FT:mat_peptide GU815782_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815783_HBc_P-B Product feature CHAIN GU815783_HBc_P-B of FT:mat_peptide GU815783_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU827630_HBc_P-B Product feature CHAIN GU827630_HBc_P-B of FT:mat_peptide GU827630_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CMC104L). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011466_HBc_P-B Product feature CHAIN HM011466_HBc_P-B of FT:mat_peptide HM011466_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFYPSIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMSLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|HM011467_HBc_P-B Product feature CHAIN HM011467_HBc_P-B of FT:mat_peptide HM011467_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=182 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEXTVVRGRRSPRRRTP
SPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|HM011469_HBc_P-B Product feature CHAIN HM011469_HBc_P-B of FT:mat_peptide HM011469_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHXSPHHTALRQAILCWGELMNLATWVGGNLEDPX
SREAVVGYVNVNMGLKLRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXXQC
>gnl|hbvpro|HM011470_HBc_P-B Product feature CHAIN HM011470_HBc_P-B of FT:mat_peptide HM011470_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQVILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGLKVRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011471_HBc_P-B Product feature CHAIN HM011471_HBc_P-B of FT:mat_peptide HM011471_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMNLATWVGSNLEDPA
SRESVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWMRTPPAYRPQNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|HM011473_HBc_P-B Product feature CHAIN HM011473_HBc_P-B of FT:mat_peptide HM011473_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGEVMNLATWVGSNLEDPA
SRELVVSYVNDNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETXVIRXRGRXPRRRT
PSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|HM011474_HBc_P-B Product feature CHAIN HM011474_HBc_P-B of FT:mat_peptide HM011474_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011476_HBc_P-B Product feature CHAIN HM011476_HBc_P-B of FT:mat_peptide HM011476_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDPA
SRELVVGYVNVNMGIKLRQQLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRGRRRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|HM011477_HBc_P-B Product feature CHAIN HM011477_HBc_P-B of FT:mat_peptide HM011477_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVXLLSFLPSDFFPSXXDLLDTASALYREALESPEHYTPHHTALRQAIVCWGELMNLATWVGXNLEDPX
SREAVVNYVNVNMGIKIRQLLWFHISCLTFGXXTVLEYLVSFGVWXRTPPAYRPQNAPILSTLPETTVXRQRGRSPRRRT
PSPRRRRSQSPRCRRSQSREPRC
>gnl|hbvpro|HM011478_HBc_P-B Product feature CHAIN HM011478_HBc_P-B of FT:mat_peptide HM011478_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXZLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPS
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011480_HBc_P-B Product feature CHAIN HM011480_HBc_P-B of FT:mat_peptide HM011480_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELTNLATWVGGNLEDQA
SRELVVGYVNDNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011484_HBc_P-B Product feature CHAIN HM011484_HBc_P-B of FT:mat_peptide HM011484_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPADFFPSVRDLLDTAXALYREALESPEHCTXHHTALRQAIVCWGELMNLATWVGGNLEDPX
SREXVVNYVNVNMGIKIRQLLWFHISCLMFGRXXVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETXVXRRRSRTPRRRT
PSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|HM011487_HBc_P-B Product feature CHAIN HM011487_HBc_P-B of FT:mat_peptide HM011487_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATTELVSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011490_HBc_P-B Product feature CHAIN HM011490_HBc_P-B of FT:mat_peptide HM011490_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGIKLRQLLWFHISCITFGRXTVLEYLVSFGVWIRTPAPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011492_HBc_P-B Product feature CHAIN HM011492_HBc_P-B of FT:mat_peptide HM011492_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011494_HBc_P-B Product feature CHAIN HM011494_HBc_P-B of FT:mat_peptide HM011494_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSXRDLLDTAXALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRXPRRRT
PSPRRRRSQSPRRRRSXSRESQC
>gnl|hbvpro|HM011496_HBc_P-B Product feature CHAIN HM011496_HBc_P-B of FT:mat_peptide HM011496_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFFPNIRDLLDTANALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDQS
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|HM011503_HBc_P-B Product feature CHAIN HM011503_HBc_P-B of FT:mat_peptide HM011503_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCXPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXPQC
>gnl|hbvpro|HM011504_HBc_P-B Product feature CHAIN HM011504_HBc_P-B of FT:mat_peptide HM011504_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|HQ700546_HBc_P-B Product feature CHAIN HQ700546_HBc_P-B of FT:mat_peptide HQ700546_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREYQC
>gnl|hbvpro|HQ700548_HBc_P-B Product feature CHAIN HQ700548_HBc_P-B of FT:mat_peptide HQ700548_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700549_HBc_P-B Product feature CHAIN HQ700549_HBc_P-B of FT:mat_peptide HQ700549_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF412801_HBc_P-B Product feature CHAIN JF412801_HBc_P-B of FT:mat_peptide JF412801_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF436921_HBc_P-B Product feature CHAIN JF436921_HBc_P-B of FT:mat_peptide JF436921_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775480_HBc_P-B Product feature CHAIN JF775480_HBc_P-B of FT:mat_peptide JF775480_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775482_HBc_P-B Product feature CHAIN JF775482_HBc_P-B of FT:mat_peptide JF775482_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775483_HBc_P-B Product feature CHAIN JF775483_HBc_P-B of FT:mat_peptide JF775483_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775484_HBc_P-B Product feature CHAIN JF775484_HBc_P-B of FT:mat_peptide JF775484_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF899335_HBc_P-B Product feature CHAIN JF899335_HBc_P-B of FT:mat_peptide JF899335_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN406371_HBc_P-B Product feature CHAIN JN406371_HBc_P-B of FT:mat_peptide JN406371_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792894_HBc_P-B Product feature CHAIN JN792894_HBc_P-B of FT:mat_peptide JN792894_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSYHHTALRQAILCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHVSCLTFGRNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRGRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN792895_HBc_P-B Product feature CHAIN JN792895_HBc_P-B of FT:mat_peptide JN792895_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHVSCIIFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN792896_HBc_P-B Product feature CHAIN JN792896_HBc_P-B of FT:mat_peptide JN792896_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALFRDALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLEDQA
SRDLVVNYVNTHMGLKIRQLLWFHVSCIIFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792897_HBc_P-B Product feature CHAIN JN792897_HBc_P-B of FT:mat_peptide JN792897_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRLRRRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN792898_HBc_P-B Product feature CHAIN JN792898_HBc_P-B of FT:mat_peptide JN792898_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSAHHTAIRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRLRRRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN792899_HBc_P-B Product feature CHAIN JN792899_HBc_P-B of FT:mat_peptide JN792899_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELMTLASWVGSNLNDPA
SRDLVVNYVNINMGLKIRQLLWYHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792900_HBc_P-B Product feature CHAIN JN792900_HBc_P-B of FT:mat_peptide JN792900_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESTEHCSYHHTALRQAILCWGELMTLASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWYHLSCLTFGRDTVHEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792901_HBc_P-B Product feature CHAIN JN792901_HBc_P-B of FT:mat_peptide JN792901_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATTELLSFLPSDFYPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAALCWGELMTLATWVGNNLNDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRGRT
PSPRRRRSKSPRRRRSHSRESQC
>gnl|hbvpro|JN792902_HBc_P-B Product feature CHAIN JN792902_HBc_P-B of FT:mat_peptide JN792902_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAALCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPGRRT
PSPRRRRSKSPRRRRSHSRESQC
>gnl|hbvpro|JN827419_HBc_P-B Product feature CHAIN JN827419_HBc_P-B of FT:mat_peptide JN827419_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027311_HBc_P-B Product feature CHAIN JQ027311_HBc_P-B of FT:mat_peptide JQ027311_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXXLLSFLPADFFPSVHDLLDTATALYREALESPEHCSPHHTAXRQAILCWGELMNLATWVGGNLXDPX
SRELVVGYVNVNMGLKXRQLLWFHISCLXFGRETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027312_HBc_P-B Product feature CHAIN JQ027312_HBc_P-B of FT:mat_peptide JQ027312_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELXSFLPTDFFPXVRDLLDTASALYREALESPEHCTPHHTALRQVILCWGELMNLATWVGSNLDDXT
SREAVVNYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPXYRPXNAPILSTLPETAVVRXRXRSXRRRT
PSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|JQ027313_HBc_P-B Product feature CHAIN JQ027313_HBc_P-B of FT:mat_peptide JQ027313_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPXDFFPSXRDLXDTASALYREALESPEHCSHHHTALRQAILCWVELMNLATWVGGNLEDPA
SRELVVNHVNXNMGXKIRQLLWFHISCLTFGRETVLXXLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027315_HBc_P-B Product feature CHAIN JQ027315_HBc_P-B of FT:mat_peptide JQ027315_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGGNLEDQA
SRELVVGYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ027316_HBc_P-B Product feature CHAIN JQ027316_HBc_P-B of FT:mat_peptide JQ027316_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGREVVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027325_HBc_P-B Product feature CHAIN JQ027325_HBc_P-B of FT:mat_peptide JQ027325_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027330_HBc_P-B Product feature CHAIN JQ027330_HBc_P-B of FT:mat_peptide JQ027330_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVXYVNVNMGIKIRQLLWFHISCITFGREXVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ027331_HBc_P-B Product feature CHAIN JQ027331_HBc_P-B of FT:mat_peptide JQ027331_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVXYVNVNMGIKIRQLLWFHISCITFGREXVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ027334_HBc_P-B Product feature CHAIN JQ027334_HBc_P-B of FT:mat_peptide JQ027334_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQPYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ040125_HBc_P-B Product feature CHAIN JQ040125_HBc_P-B of FT:mat_peptide JQ040125_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPHRRRSQSRESQC
>gnl|hbvpro|JQ040128_HBc_P-B Product feature CHAIN JQ040128_HBc_P-B of FT:mat_peptide JQ040128_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYXEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|JQ040138_HBc_P-B Product feature CHAIN JQ040138_HBc_P-B of FT:mat_peptide JQ040138_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDLA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040147_HBc_P-B Product feature CHAIN JQ040147_HBc_P-B of FT:mat_peptide JQ040147_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040157_HBc_P-B Product feature CHAIN JQ040157_HBc_P-B of FT:mat_peptide JQ040157_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTXXALYREALEXPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040169_HBc_P-B Product feature CHAIN JQ040169_HBc_P-B of FT:mat_peptide JQ040169_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G237). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040170_HBc_P-B Product feature CHAIN JQ040170_HBc_P-B of FT:mat_peptide JQ040170_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040171_HBc_P-B Product feature CHAIN JQ040171_HBc_P-B of FT:mat_peptide JQ040171_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPXRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040173_HBc_P-B Product feature CHAIN JQ040173_HBc_P-B of FT:mat_peptide JQ040173_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341459_HBc_P-B Product feature CHAIN JQ341459_HBc_P-B of FT:mat_peptide JQ341459_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341460_HBc_P-B Product feature CHAIN JQ341460_HBc_P-B of FT:mat_peptide JQ341460_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341461_HBc_P-B Product feature CHAIN JQ341461_HBc_P-B of FT:mat_peptide JQ341461_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341462_HBc_P-B Product feature CHAIN JQ341462_HBc_P-B of FT:mat_peptide JQ341462_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFXASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQXAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341463_HBc_P-B Product feature CHAIN JQ341463_HBc_P-B of FT:mat_peptide JQ341463_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXXDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPAYRPQXAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341464_HBc_P-B Product feature CHAIN JQ341464_HBc_P-B of FT:mat_peptide JQ341464_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQXRESQC
>gnl|hbvpro|JQ341465_HBc_P-B Product feature CHAIN JQ341465_HBc_P-B of FT:mat_peptide JQ341465_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341466_HBc_P-B Product feature CHAIN JQ341466_HBc_P-B of FT:mat_peptide JQ341466_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASAMYREALESPEHCSXHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETXVVRQRRRSPRRRT
PSPRRRRSKSPRRRRSKSRDSQC
>gnl|hbvpro|JQ341467_HBc_P-B Product feature CHAIN JQ341467_HBc_P-B of FT:mat_peptide JQ341467_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAIXCWGEXMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRXRSQSRESQC
>gnl|hbvpro|JQ341468_HBc_P-B Product feature CHAIN JQ341468_HBc_P-B of FT:mat_peptide JQ341468_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPS
SRELVVGYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPAXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341469_HBc_P-B Product feature CHAIN JQ341469_HBc_P-B of FT:mat_peptide JQ341469_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPXAPILSTLPETTVVRGRSRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341470_HBc_P-B Product feature CHAIN JQ341470_HBc_P-B of FT:mat_peptide JQ341470_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341471_HBc_P-B Product feature CHAIN JQ341471_HBc_P-B of FT:mat_peptide JQ341471_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ341472_HBc_P-B Product feature CHAIN JQ341472_HBc_P-B of FT:mat_peptide JQ341472_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXXAPILSTLPETXVVRRXXRSPRRRT
PSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|JQ341473_HBc_P-B Product feature CHAIN JQ341473_HBc_P-B of FT:mat_peptide JQ341473_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341474_HBc_P-B Product feature CHAIN JQ341474_HBc_P-B of FT:mat_peptide JQ341474_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVIRRRGRXPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|JQ341475_HBc_P-B Product feature CHAIN JQ341475_HBc_P-B of FT:mat_peptide JQ341475_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESQEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ341476_HBc_P-B Product feature CHAIN JQ341476_HBc_P-B of FT:mat_peptide JQ341476_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHVSCLTFGRQTVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341477_HBc_P-B Product feature CHAIN JQ341477_HBc_P-B of FT:mat_peptide JQ341477_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341479_HBc_P-B Product feature CHAIN JQ341479_HBc_P-B of FT:mat_peptide JQ341479_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ341480_HBc_P-B Product feature CHAIN JQ341480_HBc_P-B of FT:mat_peptide JQ341480_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ341481_HBc_P-B Product feature CHAIN JQ341481_HBc_P-B of FT:mat_peptide JQ341481_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341482_HBc_P-B Product feature CHAIN JQ341482_HBc_P-B of FT:mat_peptide JQ341482_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALXSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341483_HBc_P-B Product feature CHAIN JQ341483_HBc_P-B of FT:mat_peptide JQ341483_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRXGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341484_HBc_P-B Product feature CHAIN JQ341484_HBc_P-B of FT:mat_peptide JQ341484_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ341485_HBc_P-B Product feature CHAIN JQ341485_HBc_P-B of FT:mat_peptide JQ341485_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341486_HBc_P-B Product feature CHAIN JQ341486_HBc_P-B of FT:mat_peptide JQ341486_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDSASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQXAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ341487_HBc_P-B Product feature CHAIN JQ341487_HBc_P-B of FT:mat_peptide JQ341487_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPAYRPXXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341488_HBc_P-B Product feature CHAIN JQ341488_HBc_P-B of FT:mat_peptide JQ341488_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTAXRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPXYRPQXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESXC
>gnl|hbvpro|JQ341489_HBc_P-B Product feature CHAIN JQ341489_HBc_P-B of FT:mat_peptide JQ341489_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPAYRPXXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341490_HBc_P-B Product feature CHAIN JQ341490_HBc_P-B of FT:mat_peptide JQ341490_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ341491_HBc_P-B Product feature CHAIN JQ341491_HBc_P-B of FT:mat_peptide JQ341491_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQXAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341492_HBc_P-B Product feature CHAIN JQ341492_HBc_P-B of FT:mat_peptide JQ341492_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPADFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPX
SRELVVSYVNVNMGIKIRQILWFHISCLTFGRDVVLEYLVSFGVWIRTPPAYRPQXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRXQSREHQC
>gnl|hbvpro|JQ341493_HBc_P-B Product feature CHAIN JQ341493_HBc_P-B of FT:mat_peptide JQ341493_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPHHTAXRQAILCWGELMNLAXWVGXNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQXAPILSTLPETTVVRQRGRSXRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ341494_HBc_P-B Product feature CHAIN JQ341494_HBc_P-B of FT:mat_peptide JQ341494_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQX
>gnl|hbvpro|JQ341495_HBc_P-B Product feature CHAIN JQ341495_HBc_P-B of FT:mat_peptide JQ341495_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno44). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPTIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGXNLDDPA
SREXVVSYVNVNMGLKIRQLLWFHISCLXFGRQTVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVXRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSREHQC
>gnl|hbvpro|JQ341496_HBc_P-B Product feature CHAIN JQ341496_HBc_P-B of FT:mat_peptide JQ341496_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341497_HBc_P-B Product feature CHAIN JQ341497_HBc_P-B of FT:mat_peptide JQ341497_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRZTVLEYLVSFGVWIRTPPAYRPXXAPILSTLPETTVVRXRGRXPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341499_HBc_P-B Product feature CHAIN JQ341499_HBc_P-B of FT:mat_peptide JQ341499_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFYPSIRDLLDTASALYREALESPEHXTPHHTALRQAILCWGELMNLATWVGSNLEDPX
SREXVVSYVNVNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQXAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341500_HBc_P-B Product feature CHAIN JQ341500_HBc_P-B of FT:mat_peptide JQ341500_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno49). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALXREALESPEHCSPHHTALRQAXXCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPAYRPXXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341501_HBc_P-B Product feature CHAIN JQ341501_HBc_P-B of FT:mat_peptide JQ341501_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341502_HBc_P-B Product feature CHAIN JQ341502_HBc_P-B of FT:mat_peptide JQ341502_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXXAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ341503_HBc_P-B Product feature CHAIN JQ341503_HBc_P-B of FT:mat_peptide JQ341503_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGGSVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLDDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPPXAPILSMLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ341504_HBc_P-B Product feature CHAIN JQ341504_HBc_P-B of FT:mat_peptide JQ341504_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGXNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPAYRPXXAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341508_HBc_P-B Product feature CHAIN JQ341508_HBc_P-B of FT:mat_peptide JQ341508_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno58). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXXQC
>gnl|hbvpro|JQ341509_HBc_P-B Product feature CHAIN JQ341509_HBc_P-B of FT:mat_peptide JQ341509_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno60). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYXXFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ341510_HBc_P-B Product feature CHAIN JQ341510_HBc_P-B of FT:mat_peptide JQ341510_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JQ341515_HBc_P-B Product feature CHAIN JQ341515_HBc_P-B of FT:mat_peptide JQ341515_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cgeno12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEXPA
SRELXVSYVNVNMGLKXRQXLWFHISCLTFGXXTVLEYLVSFGVWIRTPXAYRPPXAPILSTLPETTVVRXRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341530_HBc_P-B Product feature CHAIN JQ341530_HBc_P-B of FT:mat_peptide JQ341530_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cgeno39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ429079_HBc_P-B Product feature CHAIN JQ429079_HBc_P-B of FT:mat_peptide JQ429079_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08.10.002). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSXVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ429080_HBc_P-B Product feature CHAIN JQ429080_HBc_P-B of FT:mat_peptide JQ429080_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.40.033). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ429081_HBc_P-B Product feature CHAIN JQ429081_HBc_P-B of FT:mat_peptide JQ429081_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ429082_HBc_P-B Product feature CHAIN JQ429082_HBc_P-B of FT:mat_peptide JQ429082_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.41.591). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ688405_HBc_P-B Product feature CHAIN JQ688405_HBc_P-B of FT:mat_peptide JQ688405_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707734_HBc_P-B Product feature CHAIN JQ707734_HBc_P-B of FT:mat_peptide JQ707734_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707735_HBc_P-B Product feature CHAIN JQ707735_HBc_P-B of FT:mat_peptide JQ707735_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707737_HBc_P-B Product feature CHAIN JQ707737_HBc_P-B of FT:mat_peptide JQ707737_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707738_HBc_P-B Product feature CHAIN JQ707738_HBc_P-B of FT:mat_peptide JQ707738_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707739_HBc_P-B Product feature CHAIN JQ707739_HBc_P-B of FT:mat_peptide JQ707739_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707740_HBc_P-B Product feature CHAIN JQ707740_HBc_P-B of FT:mat_peptide JQ707740_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707742_HBc_P-B Product feature CHAIN JQ707742_HBc_P-B of FT:mat_peptide JQ707742_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707743_HBc_P-B Product feature CHAIN JQ707743_HBc_P-B of FT:mat_peptide JQ707743_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707744_HBc_P-B Product feature CHAIN JQ707744_HBc_P-B of FT:mat_peptide JQ707744_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707745_HBc_P-B Product feature CHAIN JQ707745_HBc_P-B of FT:mat_peptide JQ707745_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707746_HBc_P-B Product feature CHAIN JQ707746_HBc_P-B of FT:mat_peptide JQ707746_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_24-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707747_HBc_P-B Product feature CHAIN JQ707747_HBc_P-B of FT:mat_peptide JQ707747_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707749_HBc_P-B Product feature CHAIN JQ707749_HBc_P-B of FT:mat_peptide JQ707749_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707750_HBc_P-B Product feature CHAIN JQ707750_HBc_P-B of FT:mat_peptide JQ707750_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707753_HBc_P-B Product feature CHAIN JQ707753_HBc_P-B of FT:mat_peptide JQ707753_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707755_HBc_P-B Product feature CHAIN JQ707755_HBc_P-B of FT:mat_peptide JQ707755_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707758_HBc_P-B Product feature CHAIN JQ707758_HBc_P-B of FT:mat_peptide JQ707758_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707759_HBc_P-B Product feature CHAIN JQ707759_HBc_P-B of FT:mat_peptide JQ707759_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707762_HBc_P-B Product feature CHAIN JQ707762_HBc_P-B of FT:mat_peptide JQ707762_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707763_HBc_P-B Product feature CHAIN JQ707763_HBc_P-B of FT:mat_peptide JQ707763_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707764_HBc_P-B Product feature CHAIN JQ707764_HBc_P-B of FT:mat_peptide JQ707764_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707765_HBc_P-B Product feature CHAIN JQ707765_HBc_P-B of FT:mat_peptide JQ707765_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707766_HBc_P-B Product feature CHAIN JQ707766_HBc_P-B of FT:mat_peptide JQ707766_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707767_HBc_P-B Product feature CHAIN JQ707767_HBc_P-B of FT:mat_peptide JQ707767_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801471_HBc_P-B Product feature CHAIN JQ801471_HBc_P-B of FT:mat_peptide JQ801471_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801474_HBc_P-B Product feature CHAIN JQ801474_HBc_P-B of FT:mat_peptide JQ801474_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKFRQLLWFHISCITFGRETVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801479_HBc_P-B Product feature CHAIN JQ801479_HBc_P-B of FT:mat_peptide JQ801479_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801494_HBc_P-B Product feature CHAIN JQ801494_HBc_P-B of FT:mat_peptide JQ801494_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTISALHREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLQDPT
SREAVVSYVNVNMGLKIRQLLWFHLSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ801506_HBc_P-B Product feature CHAIN JQ801506_HBc_P-B of FT:mat_peptide JQ801506_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKFRQILWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ801507_HBc_P-B Product feature CHAIN JQ801507_HBc_P-B of FT:mat_peptide JQ801507_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801512_HBc_P-B Product feature CHAIN JQ801512_HBc_P-B of FT:mat_peptide JQ801512_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801514_HBc_P-B Product feature CHAIN JQ801514_HBc_P-B of FT:mat_peptide JQ801514_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801516_HBc_P-B Product feature CHAIN JQ801516_HBc_P-B of FT:mat_peptide JQ801516_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801524_HBc_P-B Product feature CHAIN JQ801524_HBc_P-B of FT:mat_peptide JQ801524_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026879_HBc_P-B Product feature CHAIN JX026879_HBc_P-B of FT:mat_peptide JX026879_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFFFLPSDFFPSIRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLED
PASRELVVSYVNVNMGLKIRQLSWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026886_HBc_P-B Product feature CHAIN JX026886_HBc_P-B of FT:mat_peptide JX026886_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-73). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JX429897_HBc_P-B Product feature CHAIN JX429897_HBc_P-B of FT:mat_peptide JX429897_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAPALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429899_HBc_P-B Product feature CHAIN JX429899_HBc_P-B of FT:mat_peptide JX429899_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPV
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429901_HBc_P-B Product feature CHAIN JX429901_HBc_P-B of FT:mat_peptide JX429901_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429902_HBc_P-B Product feature CHAIN JX429902_HBc_P-B of FT:mat_peptide JX429902_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429908_HBc_P-B Product feature CHAIN JX429908_HBc_P-B of FT:mat_peptide JX429908_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|JX429910_HBc_P-B Product feature CHAIN JX429910_HBc_P-B of FT:mat_peptide JX429910_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|JX429911_HBc_P-B Product feature CHAIN JX429911_HBc_P-B of FT:mat_peptide JX429911_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-45). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFFLPSDFFPSIRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDP
ASRELVVSYVNVNMGLKIRQLSWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRR
TPSPRRRRSQLPRRRRSQSRESQCQ
>gnl|hbvpro|JX504531_HBc_P-B Product feature CHAIN JX504531_HBc_P-B of FT:mat_peptide JX504531_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504532_HBc_P-B Product feature CHAIN JX504532_HBc_P-B of FT:mat_peptide JX504532_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504533_HBc_P-B Product feature CHAIN JX504533_HBc_P-B of FT:mat_peptide JX504533_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504538_HBc_P-B Product feature CHAIN JX504538_HBc_P-B of FT:mat_peptide JX504538_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDTDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504543_HBc_P-B Product feature CHAIN JX504543_HBc_P-B of FT:mat_peptide JX504543_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NNJ-19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507210_HBc_P-B Product feature CHAIN JX507210_HBc_P-B of FT:mat_peptide JX507210_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSLLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507213_HBc_P-B Product feature CHAIN JX507213_HBc_P-B of FT:mat_peptide JX507213_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPHHTAHRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507215_HBc_P-B Product feature CHAIN JX507215_HBc_P-B of FT:mat_peptide JX507215_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 310). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661470_HBc_P-B Product feature CHAIN JX661470_HBc_P-B of FT:mat_peptide JX661470_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1221-B12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661471_HBc_P-B Product feature CHAIN JX661471_HBc_P-B of FT:mat_peptide JX661471_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1202-B1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661472_HBc_P-B Product feature CHAIN JX661472_HBc_P-B of FT:mat_peptide JX661472_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1224-B13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661473_HBc_P-B Product feature CHAIN JX661473_HBc_P-B of FT:mat_peptide JX661473_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1220-B11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661474_HBc_P-B Product feature CHAIN JX661474_HBc_P-B of FT:mat_peptide JX661474_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1229-B15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661475_HBc_P-B Product feature CHAIN JX661475_HBc_P-B of FT:mat_peptide JX661475_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1216-B9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661476_HBc_P-B Product feature CHAIN JX661476_HBc_P-B of FT:mat_peptide JX661476_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1227-B14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661477_HBc_P-B Product feature CHAIN JX661477_HBc_P-B of FT:mat_peptide JX661477_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1209-B5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661478_HBc_P-B Product feature CHAIN JX661478_HBc_P-B of FT:mat_peptide JX661478_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1211-B7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661479_HBc_P-B Product feature CHAIN JX661479_HBc_P-B of FT:mat_peptide JX661479_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1219-B10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661480_HBc_P-B Product feature CHAIN JX661480_HBc_P-B of FT:mat_peptide JX661480_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1210-B6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661481_HBc_P-B Product feature CHAIN JX661481_HBc_P-B of FT:mat_peptide JX661481_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1214-B8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661482_HBc_P-B Product feature CHAIN JX661482_HBc_P-B of FT:mat_peptide JX661482_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1204-B2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661483_HBc_P-B Product feature CHAIN JX661483_HBc_P-B of FT:mat_peptide JX661483_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1205-B3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661484_HBc_P-B Product feature CHAIN JX661484_HBc_P-B of FT:mat_peptide JX661484_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1206-B4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX869998_HBc_P-B Product feature CHAIN JX869998_HBc_P-B of FT:mat_peptide JX869998_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 317). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEFMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX869999_HBc_P-B Product feature CHAIN JX869999_HBc_P-B of FT:mat_peptide JX869999_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX870001_HBc_P-B Product feature CHAIN JX870001_HBc_P-B of FT:mat_peptide JX870001_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 90). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQG
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETXVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX978431_HBc_P-B Product feature CHAIN JX978431_HBc_P-B of FT:mat_peptide JX978431_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate X02). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC492739_HBc_P-B Product feature CHAIN KC492739_HBc_P-B of FT:mat_peptide KC492739_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MT). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KC510641_HBc_P-B Product feature CHAIN KC510641_HBc_P-B of FT:mat_peptide KC510641_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510642_HBc_P-B Product feature CHAIN KC510642_HBc_P-B of FT:mat_peptide KC510642_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510643_HBc_P-B Product feature CHAIN KC510643_HBc_P-B of FT:mat_peptide KC510643_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510644_HBc_P-B Product feature CHAIN KC510644_HBc_P-B of FT:mat_peptide KC510644_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510646_HBc_P-B Product feature CHAIN KC510646_HBc_P-B of FT:mat_peptide KC510646_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510647_HBc_P-B Product feature CHAIN KC510647_HBc_P-B of FT:mat_peptide KC510647_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510648_HBc_P-B Product feature CHAIN KC510648_HBc_P-B of FT:mat_peptide KC510648_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510649_HBc_P-B Product feature CHAIN KC510649_HBc_P-B of FT:mat_peptide KC510649_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510650_HBc_P-B Product feature CHAIN KC510650_HBc_P-B of FT:mat_peptide KC510650_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510651_HBc_P-B Product feature CHAIN KC510651_HBc_P-B of FT:mat_peptide KC510651_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510652_HBc_P-B Product feature CHAIN KC510652_HBc_P-B of FT:mat_peptide KC510652_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510653_HBc_P-B Product feature CHAIN KC510653_HBc_P-B of FT:mat_peptide KC510653_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510654_HBc_P-B Product feature CHAIN KC510654_HBc_P-B of FT:mat_peptide KC510654_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510655_HBc_P-B Product feature CHAIN KC510655_HBc_P-B of FT:mat_peptide KC510655_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510656_HBc_P-B Product feature CHAIN KC510656_HBc_P-B of FT:mat_peptide KC510656_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510657_HBc_P-B Product feature CHAIN KC510657_HBc_P-B of FT:mat_peptide KC510657_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510658_HBc_P-B Product feature CHAIN KC510658_HBc_P-B of FT:mat_peptide KC510658_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510659_HBc_P-B Product feature CHAIN KC510659_HBc_P-B of FT:mat_peptide KC510659_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510660_HBc_P-B Product feature CHAIN KC510660_HBc_P-B of FT:mat_peptide KC510660_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774362_HBc_P-B Product feature CHAIN KC774362_HBc_P-B of FT:mat_peptide KC774362_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz1107). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774363_HBc_P-B Product feature CHAIN KC774363_HBc_P-B of FT:mat_peptide KC774363_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2022). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774365_HBc_P-B Product feature CHAIN KC774365_HBc_P-B of FT:mat_peptide KC774365_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2113). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774366_HBc_P-B Product feature CHAIN KC774366_HBc_P-B of FT:mat_peptide KC774366_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774367_HBc_P-B Product feature CHAIN KC774367_HBc_P-B of FT:mat_peptide KC774367_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2147). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774368_HBc_P-B Product feature CHAIN KC774368_HBc_P-B of FT:mat_peptide KC774368_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1012). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KC774369_HBc_P-B Product feature CHAIN KC774369_HBc_P-B of FT:mat_peptide KC774369_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774370_HBc_P-B Product feature CHAIN KC774370_HBc_P-B of FT:mat_peptide KC774370_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1014). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSHSRESQC
>gnl|hbvpro|KC774371_HBc_P-B Product feature CHAIN KC774371_HBc_P-B of FT:mat_peptide KC774371_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1036). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774372_HBc_P-B Product feature CHAIN KC774372_HBc_P-B of FT:mat_peptide KC774372_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1040). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774373_HBc_P-B Product feature CHAIN KC774373_HBc_P-B of FT:mat_peptide KC774373_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1044). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774374_HBc_P-B Product feature CHAIN KC774374_HBc_P-B of FT:mat_peptide KC774374_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1053). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774375_HBc_P-B Product feature CHAIN KC774375_HBc_P-B of FT:mat_peptide KC774375_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1055). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774376_HBc_P-B Product feature CHAIN KC774376_HBc_P-B of FT:mat_peptide KC774376_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1056). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774377_HBc_P-B Product feature CHAIN KC774377_HBc_P-B of FT:mat_peptide KC774377_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1064). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774378_HBc_P-B Product feature CHAIN KC774378_HBc_P-B of FT:mat_peptide KC774378_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1015). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774379_HBc_P-B Product feature CHAIN KC774379_HBc_P-B of FT:mat_peptide KC774379_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1023). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774380_HBc_P-B Product feature CHAIN KC774380_HBc_P-B of FT:mat_peptide KC774380_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1033). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774381_HBc_P-B Product feature CHAIN KC774381_HBc_P-B of FT:mat_peptide KC774381_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1062). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774382_HBc_P-B Product feature CHAIN KC774382_HBc_P-B of FT:mat_peptide KC774382_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1063). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774383_HBc_P-B Product feature CHAIN KC774383_HBc_P-B of FT:mat_peptide KC774383_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1081). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774384_HBc_P-B Product feature CHAIN KC774384_HBc_P-B of FT:mat_peptide KC774384_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1091). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774385_HBc_P-B Product feature CHAIN KC774385_HBc_P-B of FT:mat_peptide KC774385_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1099). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774386_HBc_P-B Product feature CHAIN KC774386_HBc_P-B of FT:mat_peptide KC774386_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774387_HBc_P-B Product feature CHAIN KC774387_HBc_P-B of FT:mat_peptide KC774387_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1104). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774388_HBc_P-B Product feature CHAIN KC774388_HBc_P-B of FT:mat_peptide KC774388_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774389_HBc_P-B Product feature CHAIN KC774389_HBc_P-B of FT:mat_peptide KC774389_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1121). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774390_HBc_P-B Product feature CHAIN KC774390_HBc_P-B of FT:mat_peptide KC774390_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2158). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774391_HBc_P-B Product feature CHAIN KC774391_HBc_P-B of FT:mat_peptide KC774391_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2163). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774392_HBc_P-B Product feature CHAIN KC774392_HBc_P-B of FT:mat_peptide KC774392_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2169). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774393_HBc_P-B Product feature CHAIN KC774393_HBc_P-B of FT:mat_peptide KC774393_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1068). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774394_HBc_P-B Product feature CHAIN KC774394_HBc_P-B of FT:mat_peptide KC774394_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1070). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774395_HBc_P-B Product feature CHAIN KC774395_HBc_P-B of FT:mat_peptide KC774395_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1073). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774396_HBc_P-B Product feature CHAIN KC774396_HBc_P-B of FT:mat_peptide KC774396_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1182). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774397_HBc_P-B Product feature CHAIN KC774397_HBc_P-B of FT:mat_peptide KC774397_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1185). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPSDFFPSIRDLLDTASALFREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774398_HBc_P-B Product feature CHAIN KC774398_HBc_P-B of FT:mat_peptide KC774398_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1202). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774399_HBc_P-B Product feature CHAIN KC774399_HBc_P-B of FT:mat_peptide KC774399_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1556). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774400_HBc_P-B Product feature CHAIN KC774400_HBc_P-B of FT:mat_peptide KC774400_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1585). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774401_HBc_P-B Product feature CHAIN KC774401_HBc_P-B of FT:mat_peptide KC774401_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1663). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774402_HBc_P-B Product feature CHAIN KC774402_HBc_P-B of FT:mat_peptide KC774402_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1670). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774403_HBc_P-B Product feature CHAIN KC774403_HBc_P-B of FT:mat_peptide KC774403_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774404_HBc_P-B Product feature CHAIN KC774404_HBc_P-B of FT:mat_peptide KC774404_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774405_HBc_P-B Product feature CHAIN KC774405_HBc_P-B of FT:mat_peptide KC774405_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2005). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774406_HBc_P-B Product feature CHAIN KC774406_HBc_P-B of FT:mat_peptide KC774406_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774407_HBc_P-B Product feature CHAIN KC774407_HBc_P-B of FT:mat_peptide KC774407_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2011). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774408_HBc_P-B Product feature CHAIN KC774408_HBc_P-B of FT:mat_peptide KC774408_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2012). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774409_HBc_P-B Product feature CHAIN KC774409_HBc_P-B of FT:mat_peptide KC774409_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774410_HBc_P-B Product feature CHAIN KC774410_HBc_P-B of FT:mat_peptide KC774410_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2018). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774411_HBc_P-B Product feature CHAIN KC774411_HBc_P-B of FT:mat_peptide KC774411_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2025). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774412_HBc_P-B Product feature CHAIN KC774412_HBc_P-B of FT:mat_peptide KC774412_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2034). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774413_HBc_P-B Product feature CHAIN KC774413_HBc_P-B of FT:mat_peptide KC774413_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2037). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774415_HBc_P-B Product feature CHAIN KC774415_HBc_P-B of FT:mat_peptide KC774415_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2064). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774416_HBc_P-B Product feature CHAIN KC774416_HBc_P-B of FT:mat_peptide KC774416_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1016). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774417_HBc_P-B Product feature CHAIN KC774417_HBc_P-B of FT:mat_peptide KC774417_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1028). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774418_HBc_P-B Product feature CHAIN KC774418_HBc_P-B of FT:mat_peptide KC774418_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1055). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774419_HBc_P-B Product feature CHAIN KC774419_HBc_P-B of FT:mat_peptide KC774419_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1083). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836830_HBc_P-B Product feature CHAIN KC836830_HBc_P-B of FT:mat_peptide KC836830_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836841_HBc_P-B Product feature CHAIN KC836841_HBc_P-B of FT:mat_peptide KC836841_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836843_HBc_P-B Product feature CHAIN KC836843_HBc_P-B of FT:mat_peptide KC836843_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836847_HBc_P-B Product feature CHAIN KC836847_HBc_P-B of FT:mat_peptide KC836847_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH23). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836853_HBc_P-B Product feature CHAIN KC836853_HBc_P-B of FT:mat_peptide KC836853_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836857_HBc_P-B Product feature CHAIN KC836857_HBc_P-B of FT:mat_peptide KC836857_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH37). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836861_HBc_P-B Product feature CHAIN KC836861_HBc_P-B of FT:mat_peptide KC836861_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836863_HBc_P-B Product feature CHAIN KC836863_HBc_P-B of FT:mat_peptide KC836863_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836864_HBc_P-B Product feature CHAIN KC836864_HBc_P-B of FT:mat_peptide KC836864_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836865_HBc_P-B Product feature CHAIN KC836865_HBc_P-B of FT:mat_peptide KC836865_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH49). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836872_HBc_P-B Product feature CHAIN KC836872_HBc_P-B of FT:mat_peptide KC836872_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH58). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836874_HBc_P-B Product feature CHAIN KC836874_HBc_P-B of FT:mat_peptide KC836874_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH60). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF164967_HBc_P-B Product feature CHAIN KF164967_HBc_P-B of FT:mat_peptide KF164967_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 122). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF165328_HBc_P-B Product feature CHAIN KF165328_HBc_P-B of FT:mat_peptide KF165328_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1702). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF165906_HBc_P-B Product feature CHAIN KF165906_HBc_P-B of FT:mat_peptide KF165906_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2865). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILPTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF166001_HBc_P-B Product feature CHAIN KF166001_HBc_P-B of FT:mat_peptide KF166001_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3025). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRDAVVSYVNVNMGIKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRAHSRESQ
>gnl|hbvpro|KF167010_HBc_P-B Product feature CHAIN KF167010_HBc_P-B of FT:mat_peptide KF167010_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 763). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173297_HBc_P-B Product feature CHAIN KJ173297_HBc_P-B of FT:mat_peptide KJ173297_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008C(e46n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173298_HBc_P-B Product feature CHAIN KJ173298_HBc_P-B of FT:mat_peptide KJ173298_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008M(e47)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173339_HBc_P-B Product feature CHAIN KJ173339_HBc_P-B of FT:mat_peptide KJ173339_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001C(e201)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173340_HBc_P-B Product feature CHAIN KJ173340_HBc_P-B of FT:mat_peptide KJ173340_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001M(e202)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173341_HBc_P-B Product feature CHAIN KJ173341_HBc_P-B of FT:mat_peptide KJ173341_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003C(e204)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173342_HBc_P-B Product feature CHAIN KJ173342_HBc_P-B of FT:mat_peptide KJ173342_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003M(e205)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173343_HBc_P-B Product feature CHAIN KJ173343_HBc_P-B of FT:mat_peptide KJ173343_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX007C(e211)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173345_HBc_P-B Product feature CHAIN KJ173345_HBc_P-B of FT:mat_peptide KJ173345_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX008C(e214)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173347_HBc_P-B Product feature CHAIN KJ173347_HBc_P-B of FT:mat_peptide KJ173347_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012C(e220)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173348_HBc_P-B Product feature CHAIN KJ173348_HBc_P-B of FT:mat_peptide KJ173348_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012M(e221)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173351_HBc_P-B Product feature CHAIN KJ173351_HBc_P-B of FT:mat_peptide KJ173351_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025C(e234)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173352_HBc_P-B Product feature CHAIN KJ173352_HBc_P-B of FT:mat_peptide KJ173352_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025M(e235n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173353_HBc_P-B Product feature CHAIN KJ173353_HBc_P-B of FT:mat_peptide KJ173353_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027C(e237)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173354_HBc_P-B Product feature CHAIN KJ173354_HBc_P-B of FT:mat_peptide KJ173354_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027M(e235n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173355_HBc_P-B Product feature CHAIN KJ173355_HBc_P-B of FT:mat_peptide KJ173355_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032C(e247n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173356_HBc_P-B Product feature CHAIN KJ173356_HBc_P-B of FT:mat_peptide KJ173356_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032M(e248n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173357_HBc_P-B Product feature CHAIN KJ173357_HBc_P-B of FT:mat_peptide KJ173357_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX065C(e313)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173359_HBc_P-B Product feature CHAIN KJ173359_HBc_P-B of FT:mat_peptide KJ173359_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161C(m162)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173360_HBc_P-B Product feature CHAIN KJ173360_HBc_P-B of FT:mat_peptide KJ173360_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161M(m161)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173361_HBc_P-B Product feature CHAIN KJ173361_HBc_P-B of FT:mat_peptide KJ173361_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041C(m42)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173362_HBc_P-B Product feature CHAIN KJ173362_HBc_P-B of FT:mat_peptide KJ173362_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041M(m41)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173363_HBc_P-B Product feature CHAIN KJ173363_HBc_P-B of FT:mat_peptide KJ173363_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-C(006)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173364_HBc_P-B Product feature CHAIN KJ173364_HBc_P-B of FT:mat_peptide KJ173364_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-M(007)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173365_HBc_P-B Product feature CHAIN KJ173365_HBc_P-B of FT:mat_peptide KJ173365_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-C(009)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173366_HBc_P-B Product feature CHAIN KJ173366_HBc_P-B of FT:mat_peptide KJ173366_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-M(011)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173367_HBc_P-B Product feature CHAIN KJ173367_HBc_P-B of FT:mat_peptide KJ173367_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-C(B1)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173368_HBc_P-B Product feature CHAIN KJ173368_HBc_P-B of FT:mat_peptide KJ173368_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-M(B3)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFVVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173369_HBc_P-B Product feature CHAIN KJ173369_HBc_P-B of FT:mat_peptide KJ173369_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-C(B37)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173370_HBc_P-B Product feature CHAIN KJ173370_HBc_P-B of FT:mat_peptide KJ173370_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-M(B39)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173373_HBc_P-B Product feature CHAIN KJ173373_HBc_P-B of FT:mat_peptide KJ173373_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-C1(147a)). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTALTTRQPLWFDISCVTFGRETVREYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173374_HBc_P-B Product feature CHAIN KJ173374_HBc_P-B of FT:mat_peptide KJ173374_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-M(B149)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173375_HBc_P-B Product feature CHAIN KJ173375_HBc_P-B of FT:mat_peptide KJ173375_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004C(e107)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173376_HBc_P-B Product feature CHAIN KJ173376_HBc_P-B of FT:mat_peptide KJ173376_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004M(e108)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173377_HBc_P-B Product feature CHAIN KJ173377_HBc_P-B of FT:mat_peptide KJ173377_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY014C(e115)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173379_HBc_P-B Product feature CHAIN KJ173379_HBc_P-B of FT:mat_peptide KJ173379_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019C(e121)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173380_HBc_P-B Product feature CHAIN KJ173380_HBc_P-B of FT:mat_peptide KJ173380_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019M(e122)). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173381_HBc_P-B Product feature CHAIN KJ173381_HBc_P-B of FT:mat_peptide KJ173381_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-C(FY137Cn).fas). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173382_HBc_P-B Product feature CHAIN KJ173382_HBc_P-B of FT:mat_peptide KJ173382_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137An).fas). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173383_HBc_P-B Product feature CHAIN KJ173383_HBc_P-B of FT:mat_peptide KJ173383_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YZ009C(e30)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETXVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173386_HBc_P-B Product feature CHAIN KJ173386_HBc_P-B of FT:mat_peptide KJ173386_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-C(m604)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173387_HBc_P-B Product feature CHAIN KJ173387_HBc_P-B of FT:mat_peptide KJ173387_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-M(m607)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173388_HBc_P-B Product feature CHAIN KJ173388_HBc_P-B of FT:mat_peptide KJ173388_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-C(m608)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173389_HBc_P-B Product feature CHAIN KJ173389_HBc_P-B of FT:mat_peptide KJ173389_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-M(m617)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173390_HBc_P-B Product feature CHAIN KJ173390_HBc_P-B of FT:mat_peptide KJ173390_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-C(m618)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173397_HBc_P-B Product feature CHAIN KJ173397_HBc_P-B of FT:mat_peptide KJ173397_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-M(134A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173398_HBc_P-B Product feature CHAIN KJ173398_HBc_P-B of FT:mat_peptide KJ173398_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-C(134B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173399_HBc_P-B Product feature CHAIN KJ173399_HBc_P-B of FT:mat_peptide KJ173399_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-M(4161A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173400_HBc_P-B Product feature CHAIN KJ173400_HBc_P-B of FT:mat_peptide KJ173400_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-C(4230B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173401_HBc_P-B Product feature CHAIN KJ173401_HBc_P-B of FT:mat_peptide KJ173401_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-M(6720A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173402_HBc_P-B Product feature CHAIN KJ173402_HBc_P-B of FT:mat_peptide KJ173402_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-C(3733B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173403_HBc_P-B Product feature CHAIN KJ173403_HBc_P-B of FT:mat_peptide KJ173403_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-M(6641M)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173404_HBc_P-B Product feature CHAIN KJ173404_HBc_P-B of FT:mat_peptide KJ173404_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-C(3953B)). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173405_HBc_P-B Product feature CHAIN KJ173405_HBc_P-B of FT:mat_peptide KJ173405_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-M(6642A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173406_HBc_P-B Product feature CHAIN KJ173406_HBc_P-B of FT:mat_peptide KJ173406_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-C(3965B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173407_HBc_P-B Product feature CHAIN KJ173407_HBc_P-B of FT:mat_peptide KJ173407_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-M(6650A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173408_HBc_P-B Product feature CHAIN KJ173408_HBc_P-B of FT:mat_peptide KJ173408_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-C(4198B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173409_HBc_P-B Product feature CHAIN KJ173409_HBc_P-B of FT:mat_peptide KJ173409_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-M(6692A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173410_HBc_P-B Product feature CHAIN KJ173410_HBc_P-B of FT:mat_peptide KJ173410_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-C(4171B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173411_HBc_P-B Product feature CHAIN KJ173411_HBc_P-B of FT:mat_peptide KJ173411_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-M(6579A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173412_HBc_P-B Product feature CHAIN KJ173412_HBc_P-B of FT:mat_peptide KJ173412_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-C(4159b)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173413_HBc_P-B Product feature CHAIN KJ173413_HBc_P-B of FT:mat_peptide KJ173413_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173414_HBc_P-B Product feature CHAIN KJ173414_HBc_P-B of FT:mat_peptide KJ173414_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_C(FY137B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173415_HBc_P-B Product feature CHAIN KJ173415_HBc_P-B of FT:mat_peptide KJ173415_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-V(FY137C)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173416_HBc_P-B Product feature CHAIN KJ173416_HBc_P-B of FT:mat_peptide KJ173416_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201M(e401)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173417_HBc_P-B Product feature CHAIN KJ173417_HBc_P-B of FT:mat_peptide KJ173417_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201C(e402)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173418_HBc_P-B Product feature CHAIN KJ173418_HBc_P-B of FT:mat_peptide KJ173418_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N202M(e403)). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173419_HBc_P-B Product feature CHAIN KJ173419_HBc_P-B of FT:mat_peptide KJ173419_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N202C(e404)). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173420_HBc_P-B Product feature CHAIN KJ173420_HBc_P-B of FT:mat_peptide KJ173420_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203M(e405)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173421_HBc_P-B Product feature CHAIN KJ173421_HBc_P-B of FT:mat_peptide KJ173421_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203C(e406)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173422_HBc_P-B Product feature CHAIN KJ173422_HBc_P-B of FT:mat_peptide KJ173422_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204M(e407)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173423_HBc_P-B Product feature CHAIN KJ173423_HBc_P-B of FT:mat_peptide KJ173423_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204C(e408)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173424_HBc_P-B Product feature CHAIN KJ173424_HBc_P-B of FT:mat_peptide KJ173424_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205M(e409)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173425_HBc_P-B Product feature CHAIN KJ173425_HBc_P-B of FT:mat_peptide KJ173425_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205C(e410)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410490_HBc_P-B Product feature CHAIN KJ410490_HBc_P-B of FT:mat_peptide KJ410490_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HK_1329). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KJ410500_HBc_P-B Product feature CHAIN KJ410500_HBc_P-B of FT:mat_peptide KJ410500_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK321). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNSNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KJ410502_HBc_P-B Product feature CHAIN KJ410502_HBc_P-B of FT:mat_peptide KJ410502_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK318). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVIRRRSRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KJ410507_HBc_P-B Product feature CHAIN KJ410507_HBc_P-B of FT:mat_peptide KJ410507_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK6840). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410516_HBc_P-B Product feature CHAIN KJ410516_HBc_P-B of FT:mat_peptide KJ410516_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4777). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410517_HBc_P-B Product feature CHAIN KJ410517_HBc_P-B of FT:mat_peptide KJ410517_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4901). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ790200_HBc_P-B Product feature CHAIN KJ790200_HBc_P-B of FT:mat_peptide KJ790200_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KJ803752_HBc_P-B Product feature CHAIN KJ803752_HBc_P-B of FT:mat_peptide KJ803752_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY155693). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRCRSPRRRT
PSPRRQRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803755_HBc_P-B Product feature CHAIN KJ803755_HBc_P-B of FT:mat_peptide KJ803755_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY247131). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRSRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KJ803756_HBc_P-B Product feature CHAIN KJ803756_HBc_P-B of FT:mat_peptide KJ803756_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727495). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSSHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803758_HBc_P-B Product feature CHAIN KJ803758_HBc_P-B of FT:mat_peptide KJ803758_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY484998). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRSRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KJ803763_HBc_P-B Product feature CHAIN KJ803763_HBc_P-B of FT:mat_peptide KJ803763_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY790800). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803764_HBc_P-B Product feature CHAIN KJ803764_HBc_P-B of FT:mat_peptide KJ803764_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY043147). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRQRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803768_HBc_P-B Product feature CHAIN KJ803768_HBc_P-B of FT:mat_peptide KJ803768_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY495063). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ803773_HBc_P-B Product feature CHAIN KJ803773_HBc_P-B of FT:mat_peptide KJ803773_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727093). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTALALYREALDSPEHCSPHHTAIRQAIVCWGEVMNLATWVGSNLEDPG
SRELVVNYVNVNMGLKMRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRPRGRSPRRRT
PSPRRRRTQSPRRRRSRSRESQC
>gnl|hbvpro|KJ803775_HBc_P-B Product feature CHAIN KJ803775_HBc_P-B of FT:mat_peptide KJ803775_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY741196). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRPRGRSPRRRT
PSPRRRRTQSPRRRRSRSRESQC
>gnl|hbvpro|KJ803781_HBc_P-B Product feature CHAIN KJ803781_HBc_P-B of FT:mat_peptide KJ803781_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY799421). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNDNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803783_HBc_P-B Product feature CHAIN KJ803783_HBc_P-B of FT:mat_peptide KJ803783_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY266289). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803784_HBc_P-B Product feature CHAIN KJ803784_HBc_P-B of FT:mat_peptide KJ803784_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY781114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803786_HBc_P-B Product feature CHAIN KJ803786_HBc_P-B of FT:mat_peptide KJ803786_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY846440). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVNYVNVNMGLKMRQLLWFHISCFTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803787_HBc_P-B Product feature CHAIN KJ803787_HBc_P-B of FT:mat_peptide KJ803787_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY853571). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPLRRRSQSRESQC
>gnl|hbvpro|KJ803789_HBc_P-B Product feature CHAIN KJ803789_HBc_P-B of FT:mat_peptide KJ803789_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY303852). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803795_HBc_P-B Product feature CHAIN KJ803795_HBc_P-B of FT:mat_peptide KJ803795_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY789421). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNGNMGLKIRQLLWFQISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803796_HBc_P-B Product feature CHAIN KJ803796_HBc_P-B of FT:mat_peptide KJ803796_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY711763). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNGNMGLKIRQLLWFHISCLTFGIETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KJ803797_HBc_P-B Product feature CHAIN KJ803797_HBc_P-B of FT:mat_peptide KJ803797_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY775775). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCRDALESPEHVSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRTQSPLRRRSQSRESQS
>gnl|hbvpro|KJ803805_HBc_P-B Product feature CHAIN KJ803805_HBc_P-B of FT:mat_peptide KJ803805_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY491666). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMDLISFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KJ803808_HBc_P-B Product feature CHAIN KJ803808_HBc_P-B of FT:mat_peptide KJ803808_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY571290). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSHSRESQC
>gnl|hbvpro|KJ803816_HBc_P-B Product feature CHAIN KJ803816_HBc_P-B of FT:mat_peptide KJ803816_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY540630). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFYPSIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMSLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPLRRRSQSRDPQC
>gnl|hbvpro|KJ803817_HBc_P-B Product feature CHAIN KJ803817_HBc_P-B of FT:mat_peptide KJ803817_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY241913). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ803819_HBc_P-B Product feature CHAIN KJ803819_HBc_P-B of FT:mat_peptide KJ803819_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY131767). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLEDPG
SRELVVGYVNVNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803820_HBc_P-B Product feature CHAIN KJ803820_HBc_P-B of FT:mat_peptide KJ803820_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY081397). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ803821_HBc_P-B Product feature CHAIN KJ803821_HBc_P-B of FT:mat_peptide KJ803821_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY500621). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPHDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVRHRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803824_HBc_P-B Product feature CHAIN KJ803824_HBc_P-B of FT:mat_peptide KJ803824_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY502457). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFLPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGGLMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILLLHISCLTFGRETVLEYLVSFGVWIRTPPPYRPTNAPILSTLPETAVVRQRSRSLRRRT
PSPRRRRSQSPRRRRSKSRESGC
>gnl|hbvpro|KJ803825_HBc_P-B Product feature CHAIN KJ803825_HBc_P-B of FT:mat_peptide KJ803825_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY381508). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ843165_HBc_P-B Product feature CHAIN KJ843165_HBc_P-B of FT:mat_peptide KJ843165_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ag03). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM213032_HBc_P-B Product feature CHAIN KM213032_HBc_P-B of FT:mat_peptide KM213032_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LRF-k1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM213034_HBc_P-B Product feature CHAIN KM213034_HBc_P-B of FT:mat_peptide KM213034_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYG-k1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KM213035_HBc_P-B Product feature CHAIN KM213035_HBc_P-B of FT:mat_peptide KM213035_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MRG-k1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM213036_HBc_P-B Product feature CHAIN KM213036_HBc_P-B of FT:mat_peptide KM213036_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CSW-k1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM359440_HBc_P-B Product feature CHAIN KM359440_HBc_P-B of FT:mat_peptide KM359440_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FF3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM392072_HBc_P-B Product feature CHAIN KM392072_HBc_P-B of FT:mat_peptide KM392072_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM392083_HBc_P-B Product feature CHAIN KM392083_HBc_P-B of FT:mat_peptide KM392083_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM392084_HBc_P-B Product feature CHAIN KM392084_HBc_P-B of FT:mat_peptide KM392084_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V42). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRXRSQSRESQC
>gnl|hbvpro|KM526747_HBc_P-B Product feature CHAIN KM526747_HBc_P-B of FT:mat_peptide KM526747_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Waitina/Sanana). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526748_HBc_P-B Product feature CHAIN KM526748_HBc_P-B of FT:mat_peptide KM526748_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mentawai). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526749_HBc_P-B Product feature CHAIN KM526749_HBc_P-B of FT:mat_peptide KM526749_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mentawai). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KM526750_HBc_P-B Product feature CHAIN KM526750_HBc_P-B of FT:mat_peptide KM526750_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mentawai). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526751_HBc_P-B Product feature CHAIN KM526751_HBc_P-B of FT:mat_peptide KM526751_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mentawai). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526752_HBc_P-B Product feature CHAIN KM526752_HBc_P-B of FT:mat_peptide KM526752_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mentawai). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526754_HBc_P-B Product feature CHAIN KM526754_HBc_P-B of FT:mat_peptide KM526754_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Nias). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526755_HBc_P-B Product feature CHAIN KM526755_HBc_P-B of FT:mat_peptide KM526755_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Nias). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASEELLSFLPSDFFPSIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGTNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526756_HBc_P-B Product feature CHAIN KM526756_HBc_P-B of FT:mat_peptide KM526756_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Nias). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLEDPA
SRDLIVGYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526757_HBc_P-B Product feature CHAIN KM526757_HBc_P-B of FT:mat_peptide KM526757_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Nias). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCIIFGREIVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526758_HBc_P-B Product feature CHAIN KM526758_HBc_P-B of FT:mat_peptide KM526758_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alorese). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526759_HBc_P-B Product feature CHAIN KM526759_HBc_P-B of FT:mat_peptide KM526759_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Makian). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875416_HBc_P-B Product feature CHAIN KM875416_HBc_P-B of FT:mat_peptide KM875416_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt9N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875417_HBc_P-B Product feature CHAIN KM875417_HBc_P-B of FT:mat_peptide KM875417_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt9T). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGMWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875418_HBc_P-B Product feature CHAIN KM875418_HBc_P-B of FT:mat_peptide KM875418_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt10N). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGASVELLSFLPTDFFPNIRDLLDTATALYREALESPEHWSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPPYRPANAPILSTLPEITVVRGRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KM875420_HBc_P-B Product feature CHAIN KM875420_HBc_P-B of FT:mat_peptide KM875420_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt11N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875426_HBc_P-B Product feature CHAIN KM875426_HBc_P-B of FT:mat_peptide KM875426_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt14N). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KM875427_HBc_P-B Product feature CHAIN KM875427_HBc_P-B of FT:mat_peptide KM875427_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt14T). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILATLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP036970_HBc_P-B Product feature CHAIN KP036970_HBc_P-B of FT:mat_peptide KP036970_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-YA). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP148314_HBc_P-B Product feature CHAIN KP148314_HBc_P-B of FT:mat_peptide KP148314_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP148317_HBc_P-B Product feature CHAIN KP148317_HBc_P-B of FT:mat_peptide KP148317_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148318_HBc_P-B Product feature CHAIN KP148318_HBc_P-B of FT:mat_peptide KP148318_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148319_HBc_P-B Product feature CHAIN KP148319_HBc_P-B of FT:mat_peptide KP148319_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148320_HBc_P-B Product feature CHAIN KP148320_HBc_P-B of FT:mat_peptide KP148320_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148321_HBc_P-B Product feature CHAIN KP148321_HBc_P-B of FT:mat_peptide KP148321_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148322_HBc_P-B Product feature CHAIN KP148322_HBc_P-B of FT:mat_peptide KP148322_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148323_HBc_P-B Product feature CHAIN KP148323_HBc_P-B of FT:mat_peptide KP148323_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP148324_HBc_P-B Product feature CHAIN KP148324_HBc_P-B of FT:mat_peptide KP148324_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148325_HBc_P-B Product feature CHAIN KP148325_HBc_P-B of FT:mat_peptide KP148325_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148326_HBc_P-B Product feature CHAIN KP148326_HBc_P-B of FT:mat_peptide KP148326_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148327_HBc_P-B Product feature CHAIN KP148327_HBc_P-B of FT:mat_peptide KP148327_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148328_HBc_P-B Product feature CHAIN KP148328_HBc_P-B of FT:mat_peptide KP148328_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-94). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148330_HBc_P-B Product feature CHAIN KP148330_HBc_P-B of FT:mat_peptide KP148330_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-104). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148331_HBc_P-B Product feature CHAIN KP148331_HBc_P-B of FT:mat_peptide KP148331_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148332_HBc_P-B Product feature CHAIN KP148332_HBc_P-B of FT:mat_peptide KP148332_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-122). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHAALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148333_HBc_P-B Product feature CHAIN KP148333_HBc_P-B of FT:mat_peptide KP148333_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-124). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148334_HBc_P-B Product feature CHAIN KP148334_HBc_P-B of FT:mat_peptide KP148334_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-126). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP148335_HBc_P-B Product feature CHAIN KP148335_HBc_P-B of FT:mat_peptide KP148335_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-130). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLLETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148336_HBc_P-B Product feature CHAIN KP148336_HBc_P-B of FT:mat_peptide KP148336_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148338_HBc_P-B Product feature CHAIN KP148338_HBc_P-B of FT:mat_peptide KP148338_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148339_HBc_P-B Product feature CHAIN KP148339_HBc_P-B of FT:mat_peptide KP148339_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148340_HBc_P-B Product feature CHAIN KP148340_HBc_P-B of FT:mat_peptide KP148340_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148341_HBc_P-B Product feature CHAIN KP148341_HBc_P-B of FT:mat_peptide KP148341_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-7). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQCQ
>gnl|hbvpro|KP148342_HBc_P-B Product feature CHAIN KP148342_HBc_P-B of FT:mat_peptide KP148342_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148343_HBc_P-B Product feature CHAIN KP148343_HBc_P-B of FT:mat_peptide KP148343_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148344_HBc_P-B Product feature CHAIN KP148344_HBc_P-B of FT:mat_peptide KP148344_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148345_HBc_P-B Product feature CHAIN KP148345_HBc_P-B of FT:mat_peptide KP148345_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDIFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAAWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148346_HBc_P-B Product feature CHAIN KP148346_HBc_P-B of FT:mat_peptide KP148346_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148347_HBc_P-B Product feature CHAIN KP148347_HBc_P-B of FT:mat_peptide KP148347_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148348_HBc_P-B Product feature CHAIN KP148348_HBc_P-B of FT:mat_peptide KP148348_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148349_HBc_P-B Product feature CHAIN KP148349_HBc_P-B of FT:mat_peptide KP148349_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148356_HBc_P-B Product feature CHAIN KP148356_HBc_P-B of FT:mat_peptide KP148356_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148357_HBc_P-B Product feature CHAIN KP148357_HBc_P-B of FT:mat_peptide KP148357_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148359_HBc_P-B Product feature CHAIN KP148359_HBc_P-B of FT:mat_peptide KP148359_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148360_HBc_P-B Product feature CHAIN KP148360_HBc_P-B of FT:mat_peptide KP148360_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148361_HBc_P-B Product feature CHAIN KP148361_HBc_P-B of FT:mat_peptide KP148361_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148362_HBc_P-B Product feature CHAIN KP148362_HBc_P-B of FT:mat_peptide KP148362_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-73). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148363_HBc_P-B Product feature CHAIN KP148363_HBc_P-B of FT:mat_peptide KP148363_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148364_HBc_P-B Product feature CHAIN KP148364_HBc_P-B of FT:mat_peptide KP148364_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRALLDTASALYREALESPEHCSPHHTALRQAILCWGELMDLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148365_HBc_P-B Product feature CHAIN KP148365_HBc_P-B of FT:mat_peptide KP148365_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148366_HBc_P-B Product feature CHAIN KP148366_HBc_P-B of FT:mat_peptide KP148366_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-110). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPYHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148367_HBc_P-B Product feature CHAIN KP148367_HBc_P-B of FT:mat_peptide KP148367_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148368_HBc_P-B Product feature CHAIN KP148368_HBc_P-B of FT:mat_peptide KP148368_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148369_HBc_P-B Product feature CHAIN KP148369_HBc_P-B of FT:mat_peptide KP148369_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148370_HBc_P-B Product feature CHAIN KP148370_HBc_P-B of FT:mat_peptide KP148370_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148371_HBc_P-B Product feature CHAIN KP148371_HBc_P-B of FT:mat_peptide KP148371_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148372_HBc_P-B Product feature CHAIN KP148372_HBc_P-B of FT:mat_peptide KP148372_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148373_HBc_P-B Product feature CHAIN KP148373_HBc_P-B of FT:mat_peptide KP148373_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148374_HBc_P-B Product feature CHAIN KP148374_HBc_P-B of FT:mat_peptide KP148374_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148375_HBc_P-B Product feature CHAIN KP148375_HBc_P-B of FT:mat_peptide KP148375_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148376_HBc_P-B Product feature CHAIN KP148376_HBc_P-B of FT:mat_peptide KP148376_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148377_HBc_P-B Product feature CHAIN KP148377_HBc_P-B of FT:mat_peptide KP148377_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148378_HBc_P-B Product feature CHAIN KP148378_HBc_P-B of FT:mat_peptide KP148378_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148379_HBc_P-B Product feature CHAIN KP148379_HBc_P-B of FT:mat_peptide KP148379_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148380_HBc_P-B Product feature CHAIN KP148380_HBc_P-B of FT:mat_peptide KP148380_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148382_HBc_P-B Product feature CHAIN KP148382_HBc_P-B of FT:mat_peptide KP148382_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148383_HBc_P-B Product feature CHAIN KP148383_HBc_P-B of FT:mat_peptide KP148383_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148384_HBc_P-B Product feature CHAIN KP148384_HBc_P-B of FT:mat_peptide KP148384_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148385_HBc_P-B Product feature CHAIN KP148385_HBc_P-B of FT:mat_peptide KP148385_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148386_HBc_P-B Product feature CHAIN KP148386_HBc_P-B of FT:mat_peptide KP148386_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148387_HBc_P-B Product feature CHAIN KP148387_HBc_P-B of FT:mat_peptide KP148387_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148388_HBc_P-B Product feature CHAIN KP148388_HBc_P-B of FT:mat_peptide KP148388_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGALMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148389_HBc_P-B Product feature CHAIN KP148389_HBc_P-B of FT:mat_peptide KP148389_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148390_HBc_P-B Product feature CHAIN KP148390_HBc_P-B of FT:mat_peptide KP148390_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148391_HBc_P-B Product feature CHAIN KP148391_HBc_P-B of FT:mat_peptide KP148391_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWGGSNLEDPA
SRELVVSYVNVNMGQKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148392_HBc_P-B Product feature CHAIN KP148392_HBc_P-B of FT:mat_peptide KP148392_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVESLSFLPSDFFPPIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148394_HBc_P-B Product feature CHAIN KP148394_HBc_P-B of FT:mat_peptide KP148394_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEATVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148395_HBc_P-B Product feature CHAIN KP148395_HBc_P-B of FT:mat_peptide KP148395_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148396_HBc_P-B Product feature CHAIN KP148396_HBc_P-B of FT:mat_peptide KP148396_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148397_HBc_P-B Product feature CHAIN KP148397_HBc_P-B of FT:mat_peptide KP148397_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148398_HBc_P-B Product feature CHAIN KP148398_HBc_P-B of FT:mat_peptide KP148398_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-60). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148400_HBc_P-B Product feature CHAIN KP148400_HBc_P-B of FT:mat_peptide KP148400_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-65). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148401_HBc_P-B Product feature CHAIN KP148401_HBc_P-B of FT:mat_peptide KP148401_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148402_HBc_P-B Product feature CHAIN KP148402_HBc_P-B of FT:mat_peptide KP148402_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-70). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148403_HBc_P-B Product feature CHAIN KP148403_HBc_P-B of FT:mat_peptide KP148403_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-71). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148405_HBc_P-B Product feature CHAIN KP148405_HBc_P-B of FT:mat_peptide KP148405_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148406_HBc_P-B Product feature CHAIN KP148406_HBc_P-B of FT:mat_peptide KP148406_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148407_HBc_P-B Product feature CHAIN KP148407_HBc_P-B of FT:mat_peptide KP148407_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCPPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148409_HBc_P-B Product feature CHAIN KP148409_HBc_P-B of FT:mat_peptide KP148409_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148410_HBc_P-B Product feature CHAIN KP148410_HBc_P-B of FT:mat_peptide KP148410_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELAVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148411_HBc_P-B Product feature CHAIN KP148411_HBc_P-B of FT:mat_peptide KP148411_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148413_HBc_P-B Product feature CHAIN KP148413_HBc_P-B of FT:mat_peptide KP148413_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILRWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148414_HBc_P-B Product feature CHAIN KP148414_HBc_P-B of FT:mat_peptide KP148414_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVIMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148415_HBc_P-B Product feature CHAIN KP148415_HBc_P-B of FT:mat_peptide KP148415_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148416_HBc_P-B Product feature CHAIN KP148416_HBc_P-B of FT:mat_peptide KP148416_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTLGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148418_HBc_P-B Product feature CHAIN KP148418_HBc_P-B of FT:mat_peptide KP148418_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETIVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148419_HBc_P-B Product feature CHAIN KP148419_HBc_P-B of FT:mat_peptide KP148419_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148420_HBc_P-B Product feature CHAIN KP148420_HBc_P-B of FT:mat_peptide KP148420_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-66). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCFTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148421_HBc_P-B Product feature CHAIN KP148421_HBc_P-B of FT:mat_peptide KP148421_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-72). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLGTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148423_HBc_P-B Product feature CHAIN KP148423_HBc_P-B of FT:mat_peptide KP148423_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148424_HBc_P-B Product feature CHAIN KP148424_HBc_P-B of FT:mat_peptide KP148424_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-89). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148425_HBc_P-B Product feature CHAIN KP148425_HBc_P-B of FT:mat_peptide KP148425_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-90). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148427_HBc_P-B Product feature CHAIN KP148427_HBc_P-B of FT:mat_peptide KP148427_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-94). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148429_HBc_P-B Product feature CHAIN KP148429_HBc_P-B of FT:mat_peptide KP148429_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-104). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148430_HBc_P-B Product feature CHAIN KP148430_HBc_P-B of FT:mat_peptide KP148430_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148432_HBc_P-B Product feature CHAIN KP148432_HBc_P-B of FT:mat_peptide KP148432_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-80). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148433_HBc_P-B Product feature CHAIN KP148433_HBc_P-B of FT:mat_peptide KP148433_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCPPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148435_HBc_P-B Product feature CHAIN KP148435_HBc_P-B of FT:mat_peptide KP148435_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIPCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148437_HBc_P-B Product feature CHAIN KP148437_HBc_P-B of FT:mat_peptide KP148437_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148438_HBc_P-B Product feature CHAIN KP148438_HBc_P-B of FT:mat_peptide KP148438_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|KP148439_HBc_P-B Product feature CHAIN KP148439_HBc_P-B of FT:mat_peptide KP148439_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148440_HBc_P-B Product feature CHAIN KP148440_HBc_P-B of FT:mat_peptide KP148440_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148451_HBc_P-B Product feature CHAIN KP148451_HBc_P-B of FT:mat_peptide KP148451_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y147-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148452_HBc_P-B Product feature CHAIN KP148452_HBc_P-B of FT:mat_peptide KP148452_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDTDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148453_HBc_P-B Product feature CHAIN KP148453_HBc_P-B of FT:mat_peptide KP148453_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-20). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRFQSPRRRRSQSRESQC
>gnl|hbvpro|KP148455_HBc_P-B Product feature CHAIN KP148455_HBc_P-B of FT:mat_peptide KP148455_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148456_HBc_P-B Product feature CHAIN KP148456_HBc_P-B of FT:mat_peptide KP148456_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148457_HBc_P-B Product feature CHAIN KP148457_HBc_P-B of FT:mat_peptide KP148457_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148458_HBc_P-B Product feature CHAIN KP148458_HBc_P-B of FT:mat_peptide KP148458_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148459_HBc_P-B Product feature CHAIN KP148459_HBc_P-B of FT:mat_peptide KP148459_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILPTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|KP148460_HBc_P-B Product feature CHAIN KP148460_HBc_P-B of FT:mat_peptide KP148460_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-20). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148461_HBc_P-B Product feature CHAIN KP148461_HBc_P-B of FT:mat_peptide KP148461_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148579_HBc_P-B Product feature CHAIN KP148579_HBc_P-B of FT:mat_peptide KP148579_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148580_HBc_P-B Product feature CHAIN KP148580_HBc_P-B of FT:mat_peptide KP148580_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148581_HBc_P-B Product feature CHAIN KP148581_HBc_P-B of FT:mat_peptide KP148581_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSWESQC
>gnl|hbvpro|KP148582_HBc_P-B Product feature CHAIN KP148582_HBc_P-B of FT:mat_peptide KP148582_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHYSPHHTALGQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148583_HBc_P-B Product feature CHAIN KP148583_HBc_P-B of FT:mat_peptide KP148583_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-24). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406162_HBc_P-B Product feature CHAIN KP406162_HBc_P-B of FT:mat_peptide KP406162_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406163_HBc_P-B Product feature CHAIN KP406163_HBc_P-B of FT:mat_peptide KP406163_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406164_HBc_P-B Product feature CHAIN KP406164_HBc_P-B of FT:mat_peptide KP406164_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPFKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406165_HBc_P-B Product feature CHAIN KP406165_HBc_P-B of FT:mat_peptide KP406165_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406166_HBc_P-B Product feature CHAIN KP406166_HBc_P-B of FT:mat_peptide KP406166_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPFKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SKELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406167_HBc_P-B Product feature CHAIN KP406167_HBc_P-B of FT:mat_peptide KP406167_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406168_HBc_P-B Product feature CHAIN KP406168_HBc_P-B of FT:mat_peptide KP406168_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNDNTGLKIRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406169_HBc_P-B Product feature CHAIN KP406169_HBc_P-B of FT:mat_peptide KP406169_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNDNTGLKIRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406170_HBc_P-B Product feature CHAIN KP406170_HBc_P-B of FT:mat_peptide KP406170_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNDNTGLKIRHLLWFHNSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406171_HBc_P-B Product feature CHAIN KP406171_HBc_P-B of FT:mat_peptide KP406171_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406172_HBc_P-B Product feature CHAIN KP406172_HBc_P-B of FT:mat_peptide KP406172_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNDNTALKIRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406173_HBc_P-B Product feature CHAIN KP406173_HBc_P-B of FT:mat_peptide KP406173_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406174_HBc_P-B Product feature CHAIN KP406174_HBc_P-B of FT:mat_peptide KP406174_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_8). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNDNTGLKIRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406175_HBc_P-B Product feature CHAIN KP406175_HBc_P-B of FT:mat_peptide KP406175_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_9). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPA
SRELVVSYVNDNTGLKIRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406176_HBc_P-B Product feature CHAIN KP406176_HBc_P-B of FT:mat_peptide KP406176_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406177_HBc_P-B Product feature CHAIN KP406177_HBc_P-B of FT:mat_peptide KP406177_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406178_HBc_P-B Product feature CHAIN KP406178_HBc_P-B of FT:mat_peptide KP406178_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406179_HBc_P-B Product feature CHAIN KP406179_HBc_P-B of FT:mat_peptide KP406179_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406180_HBc_P-B Product feature CHAIN KP406180_HBc_P-B of FT:mat_peptide KP406180_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406181_HBc_P-B Product feature CHAIN KP406181_HBc_P-B of FT:mat_peptide KP406181_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406182_HBc_P-B Product feature CHAIN KP406182_HBc_P-B of FT:mat_peptide KP406182_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406183_HBc_P-B Product feature CHAIN KP406183_HBc_P-B of FT:mat_peptide KP406183_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406184_HBc_P-B Product feature CHAIN KP406184_HBc_P-B of FT:mat_peptide KP406184_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLXLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406185_HBc_P-B Product feature CHAIN KP406185_HBc_P-B of FT:mat_peptide KP406185_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_1_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406186_HBc_P-B Product feature CHAIN KP406186_HBc_P-B of FT:mat_peptide KP406186_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406187_HBc_P-B Product feature CHAIN KP406187_HBc_P-B of FT:mat_peptide KP406187_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406188_HBc_P-B Product feature CHAIN KP406188_HBc_P-B of FT:mat_peptide KP406188_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406189_HBc_P-B Product feature CHAIN KP406189_HBc_P-B of FT:mat_peptide KP406189_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406190_HBc_P-B Product feature CHAIN KP406190_HBc_P-B of FT:mat_peptide KP406190_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406191_HBc_P-B Product feature CHAIN KP406191_HBc_P-B of FT:mat_peptide KP406191_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406192_HBc_P-B Product feature CHAIN KP406192_HBc_P-B of FT:mat_peptide KP406192_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406193_HBc_P-B Product feature CHAIN KP406193_HBc_P-B of FT:mat_peptide KP406193_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406194_HBc_P-B Product feature CHAIN KP406194_HBc_P-B of FT:mat_peptide KP406194_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406195_HBc_P-B Product feature CHAIN KP406195_HBc_P-B of FT:mat_peptide KP406195_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406196_HBc_P-B Product feature CHAIN KP406196_HBc_P-B of FT:mat_peptide KP406196_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406197_HBc_P-B Product feature CHAIN KP406197_HBc_P-B of FT:mat_peptide KP406197_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406198_HBc_P-B Product feature CHAIN KP406198_HBc_P-B of FT:mat_peptide KP406198_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406199_HBc_P-B Product feature CHAIN KP406199_HBc_P-B of FT:mat_peptide KP406199_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_14). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406200_HBc_P-B Product feature CHAIN KP406200_HBc_P-B of FT:mat_peptide KP406200_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_15). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406201_HBc_P-B Product feature CHAIN KP406201_HBc_P-B of FT:mat_peptide KP406201_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406202_HBc_P-B Product feature CHAIN KP406202_HBc_P-B of FT:mat_peptide KP406202_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_17). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406203_HBc_P-B Product feature CHAIN KP406203_HBc_P-B of FT:mat_peptide KP406203_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_18). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406204_HBc_P-B Product feature CHAIN KP406204_HBc_P-B of FT:mat_peptide KP406204_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_19). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406205_HBc_P-B Product feature CHAIN KP406205_HBc_P-B of FT:mat_peptide KP406205_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_20). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406206_HBc_P-B Product feature CHAIN KP406206_HBc_P-B of FT:mat_peptide KP406206_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_21). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406207_HBc_P-B Product feature CHAIN KP406207_HBc_P-B of FT:mat_peptide KP406207_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_22). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406208_HBc_P-B Product feature CHAIN KP406208_HBc_P-B of FT:mat_peptide KP406208_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_23). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406209_HBc_P-B Product feature CHAIN KP406209_HBc_P-B of FT:mat_peptide KP406209_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_24). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406210_HBc_P-B Product feature CHAIN KP406210_HBc_P-B of FT:mat_peptide KP406210_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_25). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406211_HBc_P-B Product feature CHAIN KP406211_HBc_P-B of FT:mat_peptide KP406211_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_26). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406212_HBc_P-B Product feature CHAIN KP406212_HBc_P-B of FT:mat_peptide KP406212_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_27). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406213_HBc_P-B Product feature CHAIN KP406213_HBc_P-B of FT:mat_peptide KP406213_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_28). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406214_HBc_P-B Product feature CHAIN KP406214_HBc_P-B of FT:mat_peptide KP406214_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_29). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406215_HBc_P-B Product feature CHAIN KP406215_HBc_P-B of FT:mat_peptide KP406215_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_30). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406216_HBc_P-B Product feature CHAIN KP406216_HBc_P-B of FT:mat_peptide KP406216_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_31). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406217_HBc_P-B Product feature CHAIN KP406217_HBc_P-B of FT:mat_peptide KP406217_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_32). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406218_HBc_P-B Product feature CHAIN KP406218_HBc_P-B of FT:mat_peptide KP406218_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_33). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406219_HBc_P-B Product feature CHAIN KP406219_HBc_P-B of FT:mat_peptide KP406219_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3_2_34). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDQA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406220_HBc_P-B Product feature CHAIN KP406220_HBc_P-B of FT:mat_peptide KP406220_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406221_HBc_P-B Product feature CHAIN KP406221_HBc_P-B of FT:mat_peptide KP406221_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406222_HBc_P-B Product feature CHAIN KP406222_HBc_P-B of FT:mat_peptide KP406222_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406223_HBc_P-B Product feature CHAIN KP406223_HBc_P-B of FT:mat_peptide KP406223_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406224_HBc_P-B Product feature CHAIN KP406224_HBc_P-B of FT:mat_peptide KP406224_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406225_HBc_P-B Product feature CHAIN KP406225_HBc_P-B of FT:mat_peptide KP406225_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406227_HBc_P-B Product feature CHAIN KP406227_HBc_P-B of FT:mat_peptide KP406227_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406228_HBc_P-B Product feature CHAIN KP406228_HBc_P-B of FT:mat_peptide KP406228_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406229_HBc_P-B Product feature CHAIN KP406229_HBc_P-B of FT:mat_peptide KP406229_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406230_HBc_P-B Product feature CHAIN KP406230_HBc_P-B of FT:mat_peptide KP406230_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406231_HBc_P-B Product feature CHAIN KP406231_HBc_P-B of FT:mat_peptide KP406231_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_1_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406232_HBc_P-B Product feature CHAIN KP406232_HBc_P-B of FT:mat_peptide KP406232_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406233_HBc_P-B Product feature CHAIN KP406233_HBc_P-B of FT:mat_peptide KP406233_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406234_HBc_P-B Product feature CHAIN KP406234_HBc_P-B of FT:mat_peptide KP406234_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406235_HBc_P-B Product feature CHAIN KP406235_HBc_P-B of FT:mat_peptide KP406235_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406236_HBc_P-B Product feature CHAIN KP406236_HBc_P-B of FT:mat_peptide KP406236_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406237_HBc_P-B Product feature CHAIN KP406237_HBc_P-B of FT:mat_peptide KP406237_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406238_HBc_P-B Product feature CHAIN KP406238_HBc_P-B of FT:mat_peptide KP406238_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406240_HBc_P-B Product feature CHAIN KP406240_HBc_P-B of FT:mat_peptide KP406240_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406241_HBc_P-B Product feature CHAIN KP406241_HBc_P-B of FT:mat_peptide KP406241_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406242_HBc_P-B Product feature CHAIN KP406242_HBc_P-B of FT:mat_peptide KP406242_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406243_HBc_P-B Product feature CHAIN KP406243_HBc_P-B of FT:mat_peptide KP406243_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1_2_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406244_HBc_P-B Product feature CHAIN KP406244_HBc_P-B of FT:mat_peptide KP406244_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406245_HBc_P-B Product feature CHAIN KP406245_HBc_P-B of FT:mat_peptide KP406245_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406246_HBc_P-B Product feature CHAIN KP406246_HBc_P-B of FT:mat_peptide KP406246_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406247_HBc_P-B Product feature CHAIN KP406247_HBc_P-B of FT:mat_peptide KP406247_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406248_HBc_P-B Product feature CHAIN KP406248_HBc_P-B of FT:mat_peptide KP406248_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406249_HBc_P-B Product feature CHAIN KP406249_HBc_P-B of FT:mat_peptide KP406249_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406250_HBc_P-B Product feature CHAIN KP406250_HBc_P-B of FT:mat_peptide KP406250_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406251_HBc_P-B Product feature CHAIN KP406251_HBc_P-B of FT:mat_peptide KP406251_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406252_HBc_P-B Product feature CHAIN KP406252_HBc_P-B of FT:mat_peptide KP406252_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406253_HBc_P-B Product feature CHAIN KP406253_HBc_P-B of FT:mat_peptide KP406253_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406254_HBc_P-B Product feature CHAIN KP406254_HBc_P-B of FT:mat_peptide KP406254_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406255_HBc_P-B Product feature CHAIN KP406255_HBc_P-B of FT:mat_peptide KP406255_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406256_HBc_P-B Product feature CHAIN KP406256_HBc_P-B of FT:mat_peptide KP406256_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406257_HBc_P-B Product feature CHAIN KP406257_HBc_P-B of FT:mat_peptide KP406257_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDQA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|KP406258_HBc_P-B Product feature CHAIN KP406258_HBc_P-B of FT:mat_peptide KP406258_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRERQC
>gnl|hbvpro|KP406259_HBc_P-B Product feature CHAIN KP406259_HBc_P-B of FT:mat_peptide KP406259_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406260_HBc_P-B Product feature CHAIN KP406260_HBc_P-B of FT:mat_peptide KP406260_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQY
>gnl|hbvpro|KP406261_HBc_P-B Product feature CHAIN KP406261_HBc_P-B of FT:mat_peptide KP406261_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406262_HBc_P-B Product feature CHAIN KP406262_HBc_P-B of FT:mat_peptide KP406262_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGGETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406263_HBc_P-B Product feature CHAIN KP406263_HBc_P-B of FT:mat_peptide KP406263_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406264_HBc_P-B Product feature CHAIN KP406264_HBc_P-B of FT:mat_peptide KP406264_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNLGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406265_HBc_P-B Product feature CHAIN KP406265_HBc_P-B of FT:mat_peptide KP406265_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406266_HBc_P-B Product feature CHAIN KP406266_HBc_P-B of FT:mat_peptide KP406266_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406267_HBc_P-B Product feature CHAIN KP406267_HBc_P-B of FT:mat_peptide KP406267_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP406268_HBc_P-B Product feature CHAIN KP406268_HBc_P-B of FT:mat_peptide KP406268_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406269_HBc_P-B Product feature CHAIN KP406269_HBc_P-B of FT:mat_peptide KP406269_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_15). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406270_HBc_P-B Product feature CHAIN KP406270_HBc_P-B of FT:mat_peptide KP406270_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_16). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406271_HBc_P-B Product feature CHAIN KP406271_HBc_P-B of FT:mat_peptide KP406271_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_17). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406272_HBc_P-B Product feature CHAIN KP406272_HBc_P-B of FT:mat_peptide KP406272_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406273_HBc_P-B Product feature CHAIN KP406273_HBc_P-B of FT:mat_peptide KP406273_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGKETVLGYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406275_HBc_P-B Product feature CHAIN KP406275_HBc_P-B of FT:mat_peptide KP406275_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_21). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
SSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406276_HBc_P-B Product feature CHAIN KP406276_HBc_P-B of FT:mat_peptide KP406276_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_22). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
SSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406277_HBc_P-B Product feature CHAIN KP406277_HBc_P-B of FT:mat_peptide KP406277_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_23). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406278_HBc_P-B Product feature CHAIN KP406278_HBc_P-B of FT:mat_peptide KP406278_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406279_HBc_P-B Product feature CHAIN KP406279_HBc_P-B of FT:mat_peptide KP406279_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLAFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406280_HBc_P-B Product feature CHAIN KP406280_HBc_P-B of FT:mat_peptide KP406280_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2_26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|KP406281_HBc_P-B Product feature CHAIN KP406281_HBc_P-B of FT:mat_peptide KP406281_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406284_HBc_P-B Product feature CHAIN KP406284_HBc_P-B of FT:mat_peptide KP406284_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406285_HBc_P-B Product feature CHAIN KP406285_HBc_P-B of FT:mat_peptide KP406285_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406286_HBc_P-B Product feature CHAIN KP406286_HBc_P-B of FT:mat_peptide KP406286_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406287_HBc_P-B Product feature CHAIN KP406287_HBc_P-B of FT:mat_peptide KP406287_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406288_HBc_P-B Product feature CHAIN KP406288_HBc_P-B of FT:mat_peptide KP406288_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406289_HBc_P-B Product feature CHAIN KP406289_HBc_P-B of FT:mat_peptide KP406289_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406292_HBc_P-B Product feature CHAIN KP406292_HBc_P-B of FT:mat_peptide KP406292_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406293_HBc_P-B Product feature CHAIN KP406293_HBc_P-B of FT:mat_peptide KP406293_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406294_HBc_P-B Product feature CHAIN KP406294_HBc_P-B of FT:mat_peptide KP406294_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_1_14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQANLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP406296_HBc_P-B Product feature CHAIN KP406296_HBc_P-B of FT:mat_peptide KP406296_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406297_HBc_P-B Product feature CHAIN KP406297_HBc_P-B of FT:mat_peptide KP406297_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406298_HBc_P-B Product feature CHAIN KP406298_HBc_P-B of FT:mat_peptide KP406298_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406299_HBc_P-B Product feature CHAIN KP406299_HBc_P-B of FT:mat_peptide KP406299_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406300_HBc_P-B Product feature CHAIN KP406300_HBc_P-B of FT:mat_peptide KP406300_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406301_HBc_P-B Product feature CHAIN KP406301_HBc_P-B of FT:mat_peptide KP406301_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406302_HBc_P-B Product feature CHAIN KP406302_HBc_P-B of FT:mat_peptide KP406302_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406303_HBc_P-B Product feature CHAIN KP406303_HBc_P-B of FT:mat_peptide KP406303_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_2_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFXPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406304_HBc_P-B Product feature CHAIN KP406304_HBc_P-B of FT:mat_peptide KP406304_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406305_HBc_P-B Product feature CHAIN KP406305_HBc_P-B of FT:mat_peptide KP406305_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406306_HBc_P-B Product feature CHAIN KP406306_HBc_P-B of FT:mat_peptide KP406306_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406307_HBc_P-B Product feature CHAIN KP406307_HBc_P-B of FT:mat_peptide KP406307_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406308_HBc_P-B Product feature CHAIN KP406308_HBc_P-B of FT:mat_peptide KP406308_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406309_HBc_P-B Product feature CHAIN KP406309_HBc_P-B of FT:mat_peptide KP406309_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406310_HBc_P-B Product feature CHAIN KP406310_HBc_P-B of FT:mat_peptide KP406310_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406311_HBc_P-B Product feature CHAIN KP406311_HBc_P-B of FT:mat_peptide KP406311_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406312_HBc_P-B Product feature CHAIN KP406312_HBc_P-B of FT:mat_peptide KP406312_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406313_HBc_P-B Product feature CHAIN KP406313_HBc_P-B of FT:mat_peptide KP406313_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406314_HBc_P-B Product feature CHAIN KP406314_HBc_P-B of FT:mat_peptide KP406314_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406315_HBc_P-B Product feature CHAIN KP406315_HBc_P-B of FT:mat_peptide KP406315_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406316_HBc_P-B Product feature CHAIN KP406316_HBc_P-B of FT:mat_peptide KP406316_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406317_HBc_P-B Product feature CHAIN KP406317_HBc_P-B of FT:mat_peptide KP406317_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD2_3_14). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP406318_HBc_P-B Product feature CHAIN KP406318_HBc_P-B of FT:mat_peptide KP406318_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406319_HBc_P-B Product feature CHAIN KP406319_HBc_P-B of FT:mat_peptide KP406319_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406320_HBc_P-B Product feature CHAIN KP406320_HBc_P-B of FT:mat_peptide KP406320_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406321_HBc_P-B Product feature CHAIN KP406321_HBc_P-B of FT:mat_peptide KP406321_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406322_HBc_P-B Product feature CHAIN KP406322_HBc_P-B of FT:mat_peptide KP406322_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406324_HBc_P-B Product feature CHAIN KP406324_HBc_P-B of FT:mat_peptide KP406324_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406325_HBc_P-B Product feature CHAIN KP406325_HBc_P-B of FT:mat_peptide KP406325_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406326_HBc_P-B Product feature CHAIN KP406326_HBc_P-B of FT:mat_peptide KP406326_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406327_HBc_P-B Product feature CHAIN KP406327_HBc_P-B of FT:mat_peptide KP406327_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406328_HBc_P-B Product feature CHAIN KP406328_HBc_P-B of FT:mat_peptide KP406328_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406329_HBc_P-B Product feature CHAIN KP406329_HBc_P-B of FT:mat_peptide KP406329_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_1_12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406330_HBc_P-B Product feature CHAIN KP406330_HBc_P-B of FT:mat_peptide KP406330_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406332_HBc_P-B Product feature CHAIN KP406332_HBc_P-B of FT:mat_peptide KP406332_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406333_HBc_P-B Product feature CHAIN KP406333_HBc_P-B of FT:mat_peptide KP406333_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406334_HBc_P-B Product feature CHAIN KP406334_HBc_P-B of FT:mat_peptide KP406334_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406335_HBc_P-B Product feature CHAIN KP406335_HBc_P-B of FT:mat_peptide KP406335_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GD3_2_6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP659219_HBc_P-B Product feature CHAIN KP659219_HBc_P-B of FT:mat_peptide KP659219_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASSDLLSFLPNDFFPSVRDLLDTAAALYREDLESPQHCSPHHTAIRQAVLCWGELSTLASWVNNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHVSCIIFGRNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP659220_HBc_P-B Product feature CHAIN KP659220_HBc_P-B of FT:mat_peptide KP659220_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659221_HBc_P-B Product feature CHAIN KP659221_HBc_P-B of FT:mat_peptide KP659221_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-8). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASEELLSFLPSDFFPSARDLLDTASALFREALESPEHCSAHHTALRQAILCWGEVTTLGTWVGTNLQDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRGSQSPRRRRSKSREPQC
>gnl|hbvpro|KP659223_HBc_P-B Product feature CHAIN KP659223_HBc_P-B of FT:mat_peptide KP659223_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPHDFYPSVRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659224_HBc_P-B Product feature CHAIN KP659224_HBc_P-B of FT:mat_peptide KP659224_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCSPHHTAIRQAILCWGELMTLATWVGSNLDDPA
SRDLVVNYVNINMGLKIRQLLWFHLSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659234_HBc_P-B Product feature CHAIN KP659234_HBc_P-B of FT:mat_peptide KP659234_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1500). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLKDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPKRRT
PSPRKRKSQSPRRKKSQSRESQC
>gnl|hbvpro|KP659235_HBc_P-B Product feature CHAIN KP659235_HBc_P-B of FT:mat_peptide KP659235_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1602). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPXRRT
PSPRRRRSQSPRRXXSQSRESQC
>gnl|hbvpro|KP659237_HBc_P-B Product feature CHAIN KP659237_HBc_P-B of FT:mat_peptide KP659237_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-2456). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP659239_HBc_P-B Product feature CHAIN KP659239_HBc_P-B of FT:mat_peptide KP659239_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-3870). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPLDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHLSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRPRSKSPRRRRSQSREPQC
>gnl|hbvpro|KP659240_HBc_P-B Product feature CHAIN KP659240_HBc_P-B of FT:mat_peptide KP659240_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-2111_2012). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPADFFPSVRDLLDTAXALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGXNLQDPA
SRDQVVXYVNTNMGLKIRQLLWYHLSCITFGKDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRXSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659244_HBc_P-B Product feature CHAIN KP659244_HBc_P-B of FT:mat_peptide KP659244_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-621). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFYPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659245_HBc_P-B Product feature CHAIN KP659245_HBc_P-B of FT:mat_peptide KP659245_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-571_2012). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPIDFYPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETXIIRRRGRSPRRRT
PSPRRPRSQSPRRRRTRSRDSQC
>gnl|hbvpro|KP659246_HBc_P-B Product feature CHAIN KP659246_HBc_P-B of FT:mat_peptide KP659246_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-2611). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP659247_HBc_P-B Product feature CHAIN KP659247_HBc_P-B of FT:mat_peptide KP659247_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-1290). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP659248_HBc_P-B Product feature CHAIN KP659248_HBc_P-B of FT:mat_peptide KP659248_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU268). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSAHHTAIRQAVLCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659249_HBc_P-B Product feature CHAIN KP659249_HBc_P-B of FT:mat_peptide KP659249_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU389). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPTDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCIIFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659250_HBc_P-B Product feature CHAIN KP659250_HBc_P-B of FT:mat_peptide KP659250_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU2128). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPLDFFPSARDLLDTAAALYREALESPEHCSHHHTAIRQAVLCWGELMTLASWVGNNLDDPA
SRDLVVDYVNNNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVWIRTPPPYRPPNAPILSMLPETXVVRRRHRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP659251_HBc_P-B Product feature CHAIN KP659251_HBc_P-B of FT:mat_peptide KP659251_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU75). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSXHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659252_HBc_P-B Product feature CHAIN KP659252_HBc_P-B of FT:mat_peptide KP659252_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU795). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPNDFFPSARDLLDTASALYREALESPEHCSAHHTALRQAILCWGELTTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHXSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659253_HBc_P-B Product feature CHAIN KP659253_HBc_P-B of FT:mat_peptide KP659253_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU817). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLANWVGNNLQDPA
SRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659254_HBc_P-B Product feature CHAIN KP659254_HBc_P-B of FT:mat_peptide KP659254_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU1163). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPQHCSPHHTAIRQAILCWGELTTLATWVGSNLDDQP
SRDLVVNYVNTNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP659255_HBc_P-B Product feature CHAIN KP659255_HBc_P-B of FT:mat_peptide KP659255_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU2144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTAAALYRESLESPEHCSPHHTALRHVVLCWGDVTTLGTWVGNNLXDQE
SRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRQTVLDYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPGRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KR152339_HBc_P-B Product feature CHAIN KR152339_HBc_P-B of FT:mat_peptide KR152339_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR232337_HBc_P-B Product feature CHAIN KR232337_HBc_P-B of FT:mat_peptide KR232337_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749820_HBc_P-B Product feature CHAIN KT749820_HBc_P-B of FT:mat_peptide KT749820_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FL22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFYPSIRDLLDTATALYREALESPEHFSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KT749851_HBc_P-B Product feature CHAIN KT749851_HBc_P-B of FT:mat_peptide KT749851_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FL17b). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU234318_HBc_P-B Product feature CHAIN KU234318_HBc_P-B of FT:mat_peptide KU234318_HBc_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575921_HBc_P-B Product feature CHAIN KU575921_HBc_P-B of FT:mat_peptide KU575921_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575922_HBc_P-B Product feature CHAIN KU575922_HBc_P-B of FT:mat_peptide KU575922_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCRGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQCW
>gnl|hbvpro|KU575927_HBc_P-B Product feature CHAIN KU575927_HBc_P-B of FT:mat_peptide KU575927_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGXSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575928_HBc_P-B Product feature CHAIN KU575928_HBc_P-B of FT:mat_peptide KU575928_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575937_HBc_P-B Product feature CHAIN KU575937_HBc_P-B of FT:mat_peptide KU575937_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575938_HBc_P-B Product feature CHAIN KU575938_HBc_P-B of FT:mat_peptide KU575938_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575940_HBc_P-B Product feature CHAIN KU575940_HBc_P-B of FT:mat_peptide KU575940_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575941_HBc_P-B Product feature CHAIN KU575941_HBc_P-B of FT:mat_peptide KU575941_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575942_HBc_P-B Product feature CHAIN KU575942_HBc_P-B of FT:mat_peptide KU575942_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575945_HBc_P-B Product feature CHAIN KU575945_HBc_P-B of FT:mat_peptide KU575945_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575953_HBc_P-B Product feature CHAIN KU575953_HBc_P-B of FT:mat_peptide KU575953_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575959_HBc_P-B Product feature CHAIN KU575959_HBc_P-B of FT:mat_peptide KU575959_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7-1-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREFFF
>gnl|hbvpro|KU575966_HBc_P-B Product feature CHAIN KU575966_HBc_P-B of FT:mat_peptide KU575966_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575971_HBc_P-B Product feature CHAIN KU575971_HBc_P-B of FT:mat_peptide KU575971_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSMRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575973_HBc_P-B Product feature CHAIN KU575973_HBc_P-B of FT:mat_peptide KU575973_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575974_HBc_P-B Product feature CHAIN KU575974_HBc_P-B of FT:mat_peptide KU575974_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575975_HBc_P-B Product feature CHAIN KU575975_HBc_P-B of FT:mat_peptide KU575975_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575976_HBc_P-B Product feature CHAIN KU575976_HBc_P-B of FT:mat_peptide KU575976_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHRSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575977_HBc_P-B Product feature CHAIN KU575977_HBc_P-B of FT:mat_peptide KU575977_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPERCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575978_HBc_P-B Product feature CHAIN KU575978_HBc_P-B of FT:mat_peptide KU575978_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575979_HBc_P-B Product feature CHAIN KU575979_HBc_P-B of FT:mat_peptide KU575979_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNPPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575980_HBc_P-B Product feature CHAIN KU575980_HBc_P-B of FT:mat_peptide KU575980_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575981_HBc_P-B Product feature CHAIN KU575981_HBc_P-B of FT:mat_peptide KU575981_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVVLLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SGELVVNYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQR
>gnl|hbvpro|KU575982_HBc_P-B Product feature CHAIN KU575982_HBc_P-B of FT:mat_peptide KU575982_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLLETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575983_HBc_P-B Product feature CHAIN KU575983_HBc_P-B of FT:mat_peptide KU575983_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPTLSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575984_HBc_P-B Product feature CHAIN KU575984_HBc_P-B of FT:mat_peptide KU575984_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576015_HBc_P-B Product feature CHAIN KU576015_HBc_P-B of FT:mat_peptide KU576015_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576018_HBc_P-B Product feature CHAIN KU576018_HBc_P-B of FT:mat_peptide KU576018_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576020_HBc_P-B Product feature CHAIN KU576020_HBc_P-B of FT:mat_peptide KU576020_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576022_HBc_P-B Product feature CHAIN KU576022_HBc_P-B of FT:mat_peptide KU576022_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCPTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576024_HBc_P-B Product feature CHAIN KU576024_HBc_P-B of FT:mat_peptide KU576024_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576026_HBc_P-B Product feature CHAIN KU576026_HBc_P-B of FT:mat_peptide KU576026_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYEEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576038_HBc_P-B Product feature CHAIN KU576038_HBc_P-B of FT:mat_peptide KU576038_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576039_HBc_P-B Product feature CHAIN KU576039_HBc_P-B of FT:mat_peptide KU576039_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576041_HBc_P-B Product feature CHAIN KU576041_HBc_P-B of FT:mat_peptide KU576041_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCPPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576042_HBc_P-B Product feature CHAIN KU576042_HBc_P-B of FT:mat_peptide KU576042_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYREFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576043_HBc_P-B Product feature CHAIN KU576043_HBc_P-B of FT:mat_peptide KU576043_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSLHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576045_HBc_P-B Product feature CHAIN KU576045_HBc_P-B of FT:mat_peptide KU576045_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576046_HBc_P-B Product feature CHAIN KU576046_HBc_P-B of FT:mat_peptide KU576046_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576051_HBc_P-B Product feature CHAIN KU576051_HBc_P-B of FT:mat_peptide KU576051_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKAFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576052_HBc_P-B Product feature CHAIN KU576052_HBc_P-B of FT:mat_peptide KU576052_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576053_HBc_P-B Product feature CHAIN KU576053_HBc_P-B of FT:mat_peptide KU576053_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576054_HBc_P-B Product feature CHAIN KU576054_HBc_P-B of FT:mat_peptide KU576054_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16zc-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576064_HBc_P-B Product feature CHAIN KU576064_HBc_P-B of FT:mat_peptide KU576064_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 18-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576069_HBc_P-B Product feature CHAIN KU576069_HBc_P-B of FT:mat_peptide KU576069_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALEAPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRDTVLGYLVSFGVWIRTPPAYRPPNAPILSTLPEPAVVRCRGRSTRRRT
PSPRRRRSRSPRRRRSQSRESQC
>gnl|hbvpro|KU576070_HBc_P-B Product feature CHAIN KU576070_HBc_P-B of FT:mat_peptide KU576070_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALEAPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRDTVLGYLVSFGVWIRTPPAYRPPNAPILSTLPEPAVVRCRGRSTRRRT
PSPRRRRSRSPRRRRSQSRESQC
>gnl|hbvpro|KU576084_HBc_P-B Product feature CHAIN KU576084_HBc_P-B of FT:mat_peptide KU576084_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVFFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576085_HBc_P-B Product feature CHAIN KU576085_HBc_P-B of FT:mat_peptide KU576085_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576086_HBc_P-B Product feature CHAIN KU576086_HBc_P-B of FT:mat_peptide KU576086_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFRISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576087_HBc_P-B Product feature CHAIN KU576087_HBc_P-B of FT:mat_peptide KU576087_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-6-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQASLCWGELMNLVTWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPSNAPILSTLPETTVVRCRGRSSRRRT
PSPRRRRSQSPRRSRSQSRESQC
>gnl|hbvpro|KU576088_HBc_P-B Product feature CHAIN KU576088_HBc_P-B of FT:mat_peptide KU576088_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAFVELLSFLPSDFFPSIRDLLDTASALYRETLESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576090_HBc_P-B Product feature CHAIN KU576090_HBc_P-B of FT:mat_peptide KU576090_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALCREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576096_HBc_P-B Product feature CHAIN KU576096_HBc_P-B of FT:mat_peptide KU576096_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576100_HBc_P-B Product feature CHAIN KU576100_HBc_P-B of FT:mat_peptide KU576100_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576101_HBc_P-B Product feature CHAIN KU576101_HBc_P-B of FT:mat_peptide KU576101_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-1-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKQFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHVSHHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576105_HBc_P-B Product feature CHAIN KU576105_HBc_P-B of FT:mat_peptide KU576105_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTLGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSRSREPQC
>gnl|hbvpro|KU576106_HBc_P-B Product feature CHAIN KU576106_HBc_P-B of FT:mat_peptide KU576106_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYNEFGASAELLSFLPSDFFPSIRDLLDTASALYREALQSPEHCSYHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576107_HBc_P-B Product feature CHAIN KU576107_HBc_P-B of FT:mat_peptide KU576107_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MNIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSREPQC
>gnl|hbvpro|KU576108_HBc_P-B Product feature CHAIN KU576108_HBc_P-B of FT:mat_peptide KU576108_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKQFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHVSHHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSREPQC
>gnl|hbvpro|KU576109_HBc_P-B Product feature CHAIN KU576109_HBc_P-B of FT:mat_peptide KU576109_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKQFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHVSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSREPQC
>gnl|hbvpro|KU576111_HBc_P-B Product feature CHAIN KU576111_HBc_P-B of FT:mat_peptide KU576111_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKQFGASVDLLSFLPSDFFPSIRDLLDTASALYREALESPEHVSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGPQC
>gnl|hbvpro|KU576112_HBc_P-B Product feature CHAIN KU576112_HBc_P-B of FT:mat_peptide KU576112_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKQFGASVELLSFLPADFFPSIRDLLDTASALFREALESPEHVSHHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTAVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSREPQC
>gnl|hbvpro|KU576113_HBc_P-B Product feature CHAIN KU576113_HBc_P-B of FT:mat_peptide KU576113_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKQFEASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNANMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSREPQC
>gnl|hbvpro|KU576114_HBc_P-B Product feature CHAIN KU576114_HBc_P-B of FT:mat_peptide KU576114_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKQFGASVDLLSFLPSDFFPSIRDLLDTASALYREALESPEHVSHRHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRKPQC
>gnl|hbvpro|KU576125_HBc_P-B Product feature CHAIN KU576125_HBc_P-B of FT:mat_peptide KU576125_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 26-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSSHHTALRQAILCWGELMNLASWVGGNLDDPA
SREAVVNYVNVNMGLKLRQILWFHISCLTFGRDIVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576126_HBc_P-B Product feature CHAIN KU576126_HBc_P-B of FT:mat_peptide KU576126_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 26-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSSHHTALRQAILCWGELMNLASWVGGNLDDPA
SREAVVNYVNVNMGLKLRQILWFHISCLTFGRDIVLEYLVSFGVWIRTPAAYRPQNAPILSTLPEIAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576127_HBc_P-B Product feature CHAIN KU576127_HBc_P-B of FT:mat_peptide KU576127_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 26-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHVSSHHTALRQAILCWGELMNLASWVGGNLDDPA
FREAVVNYVNVNMGLKLRQILWFHISCLTFGRDIVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576130_HBc_P-B Product feature CHAIN KU576130_HBc_P-B of FT:mat_peptide KU576130_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 26-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSSHHTALRRAILCWGELMNLASWVGGNLDDPA
SREAVVNYVNVNMGLKLRQILWFHISCLTFGRDIVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576131_HBc_P-B Product feature CHAIN KU576131_HBc_P-B of FT:mat_peptide KU576131_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 26-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSSHHTALRQAILCWGELMNLASWVGGNLDDPA
SREAVVNYVNVNMGLKLRQILWFHISCLTFGRDIVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576132_HBc_P-B Product feature CHAIN KU576132_HBc_P-B of FT:mat_peptide KU576132_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 27-4-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQASLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576145_HBc_P-B Product feature CHAIN KU576145_HBc_P-B of FT:mat_peptide KU576145_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASLELLSFLPGDFYPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVVCWGELMNLTTWVGINLEDPA
SRELVVGYVNANMGIKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576146_HBc_P-B Product feature CHAIN KU576146_HBc_P-B of FT:mat_peptide KU576146_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576148_HBc_P-B Product feature CHAIN KU576148_HBc_P-B of FT:mat_peptide KU576148_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASLELLSFLPTDFFSSIRVLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEATVVRRRGRSPRRRT
PXPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576149_HBc_P-B Product feature CHAIN KU576149_HBc_P-B of FT:mat_peptide KU576149_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576150_HBc_P-B Product feature CHAIN KU576150_HBc_P-B of FT:mat_peptide KU576150_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576151_HBc_P-B Product feature CHAIN KU576151_HBc_P-B of FT:mat_peptide KU576151_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576153_HBc_P-B Product feature CHAIN KU576153_HBc_P-B of FT:mat_peptide KU576153_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576154_HBc_P-B Product feature CHAIN KU576154_HBc_P-B of FT:mat_peptide KU576154_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576155_HBc_P-B Product feature CHAIN KU576155_HBc_P-B of FT:mat_peptide KU576155_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRXSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576165_HBc_P-B Product feature CHAIN KU576165_HBc_P-B of FT:mat_peptide KU576165_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576173_HBc_P-B Product feature CHAIN KU576173_HBc_P-B of FT:mat_peptide KU576173_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576185_HBc_P-B Product feature CHAIN KU576185_HBc_P-B of FT:mat_peptide KU576185_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576189_HBc_P-B Product feature CHAIN KU576189_HBc_P-B of FT:mat_peptide KU576189_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 36-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLVTWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETIVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576191_HBc_P-B Product feature CHAIN KU576191_HBc_P-B of FT:mat_peptide KU576191_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 36-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576240_HBc_P-B Product feature CHAIN KU576240_HBc_P-B of FT:mat_peptide KU576240_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576251_HBc_P-B Product feature CHAIN KU576251_HBc_P-B of FT:mat_peptide KU576251_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 46-7). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576254_HBc_P-B Product feature CHAIN KU576254_HBc_P-B of FT:mat_peptide KU576254_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 46-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576255_HBc_P-B Product feature CHAIN KU576255_HBc_P-B of FT:mat_peptide KU576255_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 46-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576277_HBc_P-B Product feature CHAIN KU576277_HBc_P-B of FT:mat_peptide KU576277_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 50-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576279_HBc_P-B Product feature CHAIN KU576279_HBc_P-B of FT:mat_peptide KU576279_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 50-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELVSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576280_HBc_P-B Product feature CHAIN KU576280_HBc_P-B of FT:mat_peptide KU576280_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 51-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDVFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRCRRSQSRGSQC
>gnl|hbvpro|KU576283_HBc_P-B Product feature CHAIN KU576283_HBc_P-B of FT:mat_peptide KU576283_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 51-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRSRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576287_HBc_P-B Product feature CHAIN KU576287_HBc_P-B of FT:mat_peptide KU576287_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 51-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDVFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRKT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576288_HBc_P-B Product feature CHAIN KU576288_HBc_P-B of FT:mat_peptide KU576288_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPPIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576289_HBc_P-B Product feature CHAIN KU576289_HBc_P-B of FT:mat_peptide KU576289_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 52-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576290_HBc_P-B Product feature CHAIN KU576290_HBc_P-B of FT:mat_peptide KU576290_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 52-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRETVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576291_HBc_P-B Product feature CHAIN KU576291_HBc_P-B of FT:mat_peptide KU576291_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 52-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576292_HBc_P-B Product feature CHAIN KU576292_HBc_P-B of FT:mat_peptide KU576292_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 52-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576295_HBc_P-B Product feature CHAIN KU576295_HBc_P-B of FT:mat_peptide KU576295_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576297_HBc_P-B Product feature CHAIN KU576297_HBc_P-B of FT:mat_peptide KU576297_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576299_HBc_P-B Product feature CHAIN KU576299_HBc_P-B of FT:mat_peptide KU576299_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPEIAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576300_HBc_P-B Product feature CHAIN KU576300_HBc_P-B of FT:mat_peptide KU576300_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVSVNMGLKLRQLLWFHISCLSFGRDIVLEYLVSFGVWIRIPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576301_HBc_P-B Product feature CHAIN KU576301_HBc_P-B of FT:mat_peptide KU576301_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAFVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576302_HBc_P-B Product feature CHAIN KU576302_HBc_P-B of FT:mat_peptide KU576302_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576303_HBc_P-B Product feature CHAIN KU576303_HBc_P-B of FT:mat_peptide KU576303_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-4). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHAALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLSFGRDIVLEYLVSFGVWIRTPPAYRPQNVPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576304_HBc_P-B Product feature CHAIN KU576304_HBc_P-B of FT:mat_peptide KU576304_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576306_HBc_P-B Product feature CHAIN KU576306_HBc_P-B of FT:mat_peptide KU576306_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRGLVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576307_HBc_P-B Product feature CHAIN KU576307_HBc_P-B of FT:mat_peptide KU576307_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVKRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576308_HBc_P-B Product feature CHAIN KU576308_HBc_P-B of FT:mat_peptide KU576308_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576309_HBc_P-B Product feature CHAIN KU576309_HBc_P-B of FT:mat_peptide KU576309_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576310_HBc_P-B Product feature CHAIN KU576310_HBc_P-B of FT:mat_peptide KU576310_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576319_HBc_P-B Product feature CHAIN KU576319_HBc_P-B of FT:mat_peptide KU576319_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576320_HBc_P-B Product feature CHAIN KU576320_HBc_P-B of FT:mat_peptide KU576320_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576321_HBc_P-B Product feature CHAIN KU576321_HBc_P-B of FT:mat_peptide KU576321_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576322_HBc_P-B Product feature CHAIN KU576322_HBc_P-B of FT:mat_peptide KU576322_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHRTALRQAILCWGGLMNLATWVGSNLEDPA
SRELVVSYVNVNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRGSQSRESQC
>gnl|hbvpro|KU576324_HBc_P-B Product feature CHAIN KU576324_HBc_P-B of FT:mat_peptide KU576324_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576325_HBc_P-B Product feature CHAIN KU576325_HBc_P-B of FT:mat_peptide KU576325_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRKGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576326_HBc_P-B Product feature CHAIN KU576326_HBc_P-B of FT:mat_peptide KU576326_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576327_HBc_P-B Product feature CHAIN KU576327_HBc_P-B of FT:mat_peptide KU576327_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576328_HBc_P-B Product feature CHAIN KU576328_HBc_P-B of FT:mat_peptide KU576328_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576331_HBc_P-B Product feature CHAIN KU576331_HBc_P-B of FT:mat_peptide KU576331_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 58-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHISPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576338_HBc_P-B Product feature CHAIN KU576338_HBc_P-B of FT:mat_peptide KU576338_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 59-6-1). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTLGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQCW
>gnl|hbvpro|KU576380_HBc_P-B Product feature CHAIN KU576380_HBc_P-B of FT:mat_peptide KU576380_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 66-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRGSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576381_HBc_P-B Product feature CHAIN KU576381_HBc_P-B of FT:mat_peptide KU576381_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 66-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCPPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPANAPILSTLPETAVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576383_HBc_P-B Product feature CHAIN KU576383_HBc_P-B of FT:mat_peptide KU576383_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 66-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPANAPILPTLPETAVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576385_HBc_P-B Product feature CHAIN KU576385_HBc_P-B of FT:mat_peptide KU576385_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 66-10). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPTAYRPANAPILSTLPETAVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576386_HBc_P-B Product feature CHAIN KU576386_HBc_P-B of FT:mat_peptide KU576386_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 67-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLHDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576387_HBc_P-B Product feature CHAIN KU576387_HBc_P-B of FT:mat_peptide KU576387_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 67-7). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVFEYLVSFGVWIRTPPAYRPPNAPILSTLPVTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576389_HBc_P-B Product feature CHAIN KU576389_HBc_P-B of FT:mat_peptide KU576389_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 68-5). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576390_HBc_P-B Product feature CHAIN KU576390_HBc_P-B of FT:mat_peptide KU576390_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 68-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576391_HBc_P-B Product feature CHAIN KU576391_HBc_P-B of FT:mat_peptide KU576391_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 68-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576392_HBc_P-B Product feature CHAIN KU576392_HBc_P-B of FT:mat_peptide KU576392_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 68-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSTQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMKLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576393_HBc_P-B Product feature CHAIN KU576393_HBc_P-B of FT:mat_peptide KU576393_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 68-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSTQDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMKLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576394_HBc_P-B Product feature CHAIN KU576394_HBc_P-B of FT:mat_peptide KU576394_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 68-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576395_HBc_P-B Product feature CHAIN KU576395_HBc_P-B of FT:mat_peptide KU576395_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576397_HBc_P-B Product feature CHAIN KU576397_HBc_P-B of FT:mat_peptide KU576397_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIGSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPKTTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576398_HBc_P-B Product feature CHAIN KU576398_HBc_P-B of FT:mat_peptide KU576398_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGGLMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPTLSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQCL
>gnl|hbvpro|KU576399_HBc_P-B Product feature CHAIN KU576399_HBc_P-B of FT:mat_peptide KU576399_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576400_HBc_P-B Product feature CHAIN KU576400_HBc_P-B of FT:mat_peptide KU576400_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576401_HBc_P-B Product feature CHAIN KU576401_HBc_P-B of FT:mat_peptide KU576401_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 70-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576402_HBc_P-B Product feature CHAIN KU576402_HBc_P-B of FT:mat_peptide KU576402_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 70-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILPTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576406_HBc_P-B Product feature CHAIN KU576406_HBc_P-B of FT:mat_peptide KU576406_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 70-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576408_HBc_P-B Product feature CHAIN KU576408_HBc_P-B of FT:mat_peptide KU576408_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 70-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576411_HBc_P-B Product feature CHAIN KU576411_HBc_P-B of FT:mat_peptide KU576411_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 71-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLKYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576412_HBc_P-B Product feature CHAIN KU576412_HBc_P-B of FT:mat_peptide KU576412_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 71-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576414_HBc_P-B Product feature CHAIN KU576414_HBc_P-B of FT:mat_peptide KU576414_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 72-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDHPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRGRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576415_HBc_P-B Product feature CHAIN KU576415_HBc_P-B of FT:mat_peptide KU576415_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 72-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDHPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRGRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576416_HBc_P-B Product feature CHAIN KU576416_HBc_P-B of FT:mat_peptide KU576416_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 72-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDHPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRGRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576417_HBc_P-B Product feature CHAIN KU576417_HBc_P-B of FT:mat_peptide KU576417_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 72-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDHPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRGRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576418_HBc_P-B Product feature CHAIN KU576418_HBc_P-B of FT:mat_peptide KU576418_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 72-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSVRDLLDTAAALYRKALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDHPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRGRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576419_HBc_P-B Product feature CHAIN KU576419_HBc_P-B of FT:mat_peptide KU576419_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 73-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576420_HBc_P-B Product feature CHAIN KU576420_HBc_P-B of FT:mat_peptide KU576420_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 73-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVDMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRDSQC
>gnl|hbvpro|KU576460_HBc_P-B Product feature CHAIN KU576460_HBc_P-B of FT:mat_peptide KU576460_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 79-3). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576466_HBc_P-B Product feature CHAIN KU576466_HBc_P-B of FT:mat_peptide KU576466_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 80-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLPWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576467_HBc_P-B Product feature CHAIN KU576467_HBc_P-B of FT:mat_peptide KU576467_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 80-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELPSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576470_HBc_P-B Product feature CHAIN KU576470_HBc_P-B of FT:mat_peptide KU576470_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 80-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576493_HBc_P-B Product feature CHAIN KU576493_HBc_P-B of FT:mat_peptide KU576493_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 83-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576495_HBc_P-B Product feature CHAIN KU576495_HBc_P-B of FT:mat_peptide KU576495_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 84-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDPA
SRDAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576496_HBc_P-B Product feature CHAIN KU576496_HBc_P-B of FT:mat_peptide KU576496_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 84-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDLFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLPDPA
SREAVVGYVNVNMGLKTRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576499_HBc_P-B Product feature CHAIN KU576499_HBc_P-B of FT:mat_peptide KU576499_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 84-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576501_HBc_P-B Product feature CHAIN KU576501_HBc_P-B of FT:mat_peptide KU576501_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 84-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAILCWGELMNLATWVGSSLPDPA
SREAVVGYVNVNMGLKTRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576507_HBc_P-B Product feature CHAIN KU576507_HBc_P-B of FT:mat_peptide KU576507_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 85-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLPDPA
SREAVVGYVNVNMGLKTRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576522_HBc_P-B Product feature CHAIN KU576522_HBc_P-B of FT:mat_peptide KU576522_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 88-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLDHPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576597_HBc_P-B Product feature CHAIN KU576597_HBc_P-B of FT:mat_peptide KU576597_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 99-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576598_HBc_P-B Product feature CHAIN KU576598_HBc_P-B of FT:mat_peptide KU576598_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 99-5). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576600_HBc_P-B Product feature CHAIN KU576600_HBc_P-B of FT:mat_peptide KU576600_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 99-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSPHHTALRQAILCWVELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576606_HBc_P-B Product feature CHAIN KU576606_HBc_P-B of FT:mat_peptide KU576606_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 100-5). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576609_HBc_P-B Product feature CHAIN KU576609_HBc_P-B of FT:mat_peptide KU576609_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 100-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576611_HBc_P-B Product feature CHAIN KU576611_HBc_P-B of FT:mat_peptide KU576611_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 101-1). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNGNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576612_HBc_P-B Product feature CHAIN KU576612_HBc_P-B of FT:mat_peptide KU576612_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 101-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576613_HBc_P-B Product feature CHAIN KU576613_HBc_P-B of FT:mat_peptide KU576613_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 101-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNGNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576614_HBc_P-B Product feature CHAIN KU576614_HBc_P-B of FT:mat_peptide KU576614_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 101-5). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETILEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576616_HBc_P-B Product feature CHAIN KU576616_HBc_P-B of FT:mat_peptide KU576616_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 101-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNGNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576617_HBc_P-B Product feature CHAIN KU576617_HBc_P-B of FT:mat_peptide KU576617_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 101-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGXSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576618_HBc_P-B Product feature CHAIN KU576618_HBc_P-B of FT:mat_peptide KU576618_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 101-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSPHHTALRQAILCWVELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSWESQC
>gnl|hbvpro|KU576619_HBc_P-B Product feature CHAIN KU576619_HBc_P-B of FT:mat_peptide KU576619_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576620_HBc_P-B Product feature CHAIN KU576620_HBc_P-B of FT:mat_peptide KU576620_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576621_HBc_P-B Product feature CHAIN KU576621_HBc_P-B of FT:mat_peptide KU576621_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576622_HBc_P-B Product feature CHAIN KU576622_HBc_P-B of FT:mat_peptide KU576622_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-11). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELINLATWVGSNLEDPA
SRELVVSYVNGNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576623_HBc_P-B Product feature CHAIN KU576623_HBc_P-B of FT:mat_peptide KU576623_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYGEALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576624_HBc_P-B Product feature CHAIN KU576624_HBc_P-B of FT:mat_peptide KU576624_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 103-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSPHHTALRQAILCWVELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRDSQC
>gnl|hbvpro|KU576626_HBc_P-B Product feature CHAIN KU576626_HBc_P-B of FT:mat_peptide KU576626_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 103-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDPLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVYFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576628_HBc_P-B Product feature CHAIN KU576628_HBc_P-B of FT:mat_peptide KU576628_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 104-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDMDTYKEFGASLELPSFLPGDFYPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVVCWGELMNLTTWVGINLEDPA
SRELVVGYVNANMGIKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576629_HBc_P-B Product feature CHAIN KU576629_HBc_P-B of FT:mat_peptide KU576629_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 104-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576630_HBc_P-B Product feature CHAIN KU576630_HBc_P-B of FT:mat_peptide KU576630_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 104-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576633_HBc_P-B Product feature CHAIN KU576633_HBc_P-B of FT:mat_peptide KU576633_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 105-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576636_HBc_P-B Product feature CHAIN KU576636_HBc_P-B of FT:mat_peptide KU576636_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 106-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGLWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576637_HBc_P-B Product feature CHAIN KU576637_HBc_P-B of FT:mat_peptide KU576637_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 106-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPRC
>gnl|hbvpro|KU576638_HBc_P-B Product feature CHAIN KU576638_HBc_P-B of FT:mat_peptide KU576638_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 106-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPS
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576639_HBc_P-B Product feature CHAIN KU576639_HBc_P-B of FT:mat_peptide KU576639_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 106-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDMDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPS
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576640_HBc_P-B Product feature CHAIN KU576640_HBc_P-B of FT:mat_peptide KU576640_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576641_HBc_P-B Product feature CHAIN KU576641_HBc_P-B of FT:mat_peptide KU576641_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576645_HBc_P-B Product feature CHAIN KU576645_HBc_P-B of FT:mat_peptide KU576645_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576647_HBc_P-B Product feature CHAIN KU576647_HBc_P-B of FT:mat_peptide KU576647_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLNTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576648_HBc_P-B Product feature CHAIN KU576648_HBc_P-B of FT:mat_peptide KU576648_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 108-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576653_HBc_P-B Product feature CHAIN KU576653_HBc_P-B of FT:mat_peptide KU576653_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 108-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576654_HBc_P-B Product feature CHAIN KU576654_HBc_P-B of FT:mat_peptide KU576654_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 108-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576655_HBc_P-B Product feature CHAIN KU576655_HBc_P-B of FT:mat_peptide KU576655_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 108-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576656_HBc_P-B Product feature CHAIN KU576656_HBc_P-B of FT:mat_peptide KU576656_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 109-2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576681_HBc_P-B Product feature CHAIN KU576681_HBc_P-B of FT:mat_peptide KU576681_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 114-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576691_HBc_P-B Product feature CHAIN KU576691_HBc_P-B of FT:mat_peptide KU576691_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 115-8-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSPHYTALRQAILCWGDLMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576692_HBc_P-B Product feature CHAIN KU576692_HBc_P-B of FT:mat_peptide KU576692_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 116-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSLLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHIPCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576693_HBc_P-B Product feature CHAIN KU576693_HBc_P-B of FT:mat_peptide KU576693_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 116-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576698_HBc_P-B Product feature CHAIN KU576698_HBc_P-B of FT:mat_peptide KU576698_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 116-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576702_HBc_P-B Product feature CHAIN KU576702_HBc_P-B of FT:mat_peptide KU576702_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576703_HBc_P-B Product feature CHAIN KU576703_HBc_P-B of FT:mat_peptide KU576703_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWVRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576704_HBc_P-B Product feature CHAIN KU576704_HBc_P-B of FT:mat_peptide KU576704_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576707_HBc_P-B Product feature CHAIN KU576707_HBc_P-B of FT:mat_peptide KU576707_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576713_HBc_P-B Product feature CHAIN KU576713_HBc_P-B of FT:mat_peptide KU576713_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 118-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYANVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTSAAYRPPNAPILSTLPETTVVRQRGRTPRRRT
LSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576714_HBc_P-B Product feature CHAIN KU576714_HBc_P-B of FT:mat_peptide KU576714_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 118-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576718_HBc_P-B Product feature CHAIN KU576718_HBc_P-B of FT:mat_peptide KU576718_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 118-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576736_HBc_P-B Product feature CHAIN KU576736_HBc_P-B of FT:mat_peptide KU576736_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 121-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASLELLSFLPGDFYPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVVCWGELMNLTTWVGINLEDPA
SRELVVGYVNANMGIKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576738_HBc_P-B Product feature CHAIN KU576738_HBc_P-B of FT:mat_peptide KU576738_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 121-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576746_HBc_P-B Product feature CHAIN KU576746_HBc_P-B of FT:mat_peptide KU576746_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 122-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGQETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576748_HBc_P-B Product feature CHAIN KU576748_HBc_P-B of FT:mat_peptide KU576748_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576749_HBc_P-B Product feature CHAIN KU576749_HBc_P-B of FT:mat_peptide KU576749_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASLELLSFLPGDFYPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVVCWGELMNLTTWVGINLEDPA
SRELVVGYVNANMGIKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRQRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576750_HBc_P-B Product feature CHAIN KU576750_HBc_P-B of FT:mat_peptide KU576750_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLRIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576751_HBc_P-B Product feature CHAIN KU576751_HBc_P-B of FT:mat_peptide KU576751_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576753_HBc_P-B Product feature CHAIN KU576753_HBc_P-B of FT:mat_peptide KU576753_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASLELLSFLPGDFYPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576754_HBc_P-B Product feature CHAIN KU576754_HBc_P-B of FT:mat_peptide KU576754_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMSLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576765_HBc_P-B Product feature CHAIN KU576765_HBc_P-B of FT:mat_peptide KU576765_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576766_HBc_P-B Product feature CHAIN KU576766_HBc_P-B of FT:mat_peptide KU576766_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576773_HBc_P-B Product feature CHAIN KU576773_HBc_P-B of FT:mat_peptide KU576773_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 126-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETILEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576777_HBc_P-B Product feature CHAIN KU576777_HBc_P-B of FT:mat_peptide KU576777_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576778_HBc_P-B Product feature CHAIN KU576778_HBc_P-B of FT:mat_peptide KU576778_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576780_HBc_P-B Product feature CHAIN KU576780_HBc_P-B of FT:mat_peptide KU576780_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576781_HBc_P-B Product feature CHAIN KU576781_HBc_P-B of FT:mat_peptide KU576781_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576782_HBc_P-B Product feature CHAIN KU576782_HBc_P-B of FT:mat_peptide KU576782_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576783_HBc_P-B Product feature CHAIN KU576783_HBc_P-B of FT:mat_peptide KU576783_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576784_HBc_P-B Product feature CHAIN KU576784_HBc_P-B of FT:mat_peptide KU576784_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576785_HBc_P-B Product feature CHAIN KU576785_HBc_P-B of FT:mat_peptide KU576785_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576788_HBc_P-B Product feature CHAIN KU576788_HBc_P-B of FT:mat_peptide KU576788_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576792_HBc_P-B Product feature CHAIN KU576792_HBc_P-B of FT:mat_peptide KU576792_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAAVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576793_HBc_P-B Product feature CHAIN KU576793_HBc_P-B of FT:mat_peptide KU576793_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576794_HBc_P-B Product feature CHAIN KU576794_HBc_P-B of FT:mat_peptide KU576794_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWAGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576803_HBc_P-B Product feature CHAIN KU576803_HBc_P-B of FT:mat_peptide KU576803_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576804_HBc_P-B Product feature CHAIN KU576804_HBc_P-B of FT:mat_peptide KU576804_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576806_HBc_P-B Product feature CHAIN KU576806_HBc_P-B of FT:mat_peptide KU576806_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQCQ
>gnl|hbvpro|KU576807_HBc_P-B Product feature CHAIN KU576807_HBc_P-B of FT:mat_peptide KU576807_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTVSALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576808_HBc_P-B Product feature CHAIN KU576808_HBc_P-B of FT:mat_peptide KU576808_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576809_HBc_P-B Product feature CHAIN KU576809_HBc_P-B of FT:mat_peptide KU576809_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576843_HBc_P-B Product feature CHAIN KU576843_HBc_P-B of FT:mat_peptide KU576843_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 137-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELINLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576845_HBc_P-B Product feature CHAIN KU576845_HBc_P-B of FT:mat_peptide KU576845_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 137-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576848_HBc_P-B Product feature CHAIN KU576848_HBc_P-B of FT:mat_peptide KU576848_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 138-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576854_HBc_P-B Product feature CHAIN KU576854_HBc_P-B of FT:mat_peptide KU576854_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 138-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576856_HBc_P-B Product feature CHAIN KU576856_HBc_P-B of FT:mat_peptide KU576856_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 139-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDSA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576866_HBc_P-B Product feature CHAIN KU576866_HBc_P-B of FT:mat_peptide KU576866_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576867_HBc_P-B Product feature CHAIN KU576867_HBc_P-B of FT:mat_peptide KU576867_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576868_HBc_P-B Product feature CHAIN KU576868_HBc_P-B of FT:mat_peptide KU576868_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576869_HBc_P-B Product feature CHAIN KU576869_HBc_P-B of FT:mat_peptide KU576869_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576870_HBc_P-B Product feature CHAIN KU576870_HBc_P-B of FT:mat_peptide KU576870_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576871_HBc_P-B Product feature CHAIN KU576871_HBc_P-B of FT:mat_peptide KU576871_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576872_HBc_P-B Product feature CHAIN KU576872_HBc_P-B of FT:mat_peptide KU576872_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576873_HBc_P-B Product feature CHAIN KU576873_HBc_P-B of FT:mat_peptide KU576873_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576874_HBc_P-B Product feature CHAIN KU576874_HBc_P-B of FT:mat_peptide KU576874_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576875_HBc_P-B Product feature CHAIN KU576875_HBc_P-B of FT:mat_peptide KU576875_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576876_HBc_P-B Product feature CHAIN KU576876_HBc_P-B of FT:mat_peptide KU576876_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-5). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576877_HBc_P-B Product feature CHAIN KU576877_HBc_P-B of FT:mat_peptide KU576877_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576879_HBc_P-B Product feature CHAIN KU576879_HBc_P-B of FT:mat_peptide KU576879_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSLRRRRSQSRESQC
>gnl|hbvpro|KU576886_HBc_P-B Product feature CHAIN KU576886_HBc_P-B of FT:mat_peptide KU576886_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 145-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576887_HBc_P-B Product feature CHAIN KU576887_HBc_P-B of FT:mat_peptide KU576887_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 145-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPS
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576888_HBc_P-B Product feature CHAIN KU576888_HBc_P-B of FT:mat_peptide KU576888_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 145-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEGPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576890_HBc_P-B Product feature CHAIN KU576890_HBc_P-B of FT:mat_peptide KU576890_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 145-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTIIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576891_HBc_P-B Product feature CHAIN KU576891_HBc_P-B of FT:mat_peptide KU576891_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 145-10). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576892_HBc_P-B Product feature CHAIN KU576892_HBc_P-B of FT:mat_peptide KU576892_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 146-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576894_HBc_P-B Product feature CHAIN KU576894_HBc_P-B of FT:mat_peptide KU576894_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 146-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576895_HBc_P-B Product feature CHAIN KU576895_HBc_P-B of FT:mat_peptide KU576895_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 146-5). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576896_HBc_P-B Product feature CHAIN KU576896_HBc_P-B of FT:mat_peptide KU576896_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 146-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVVLLSFLPSDFFPSIRDLLDTASALYREALESPEHLPAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576897_HBc_P-B Product feature CHAIN KU576897_HBc_P-B of FT:mat_peptide KU576897_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 146-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRPPPRGSQC
>gnl|hbvpro|KU576898_HBc_P-B Product feature CHAIN KU576898_HBc_P-B of FT:mat_peptide KU576898_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 146-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHLSAHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576921_HBc_P-B Product feature CHAIN KU576921_HBc_P-B of FT:mat_peptide KU576921_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 156-1). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPADFSPSIRDLLDTASALYREALESPEHCTPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVDMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576924_HBc_P-B Product feature CHAIN KU576924_HBc_P-B of FT:mat_peptide KU576924_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 158-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTIVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576939_HBc_P-B Product feature CHAIN KU576939_HBc_P-B of FT:mat_peptide KU576939_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 165-11). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576940_HBc_P-B Product feature CHAIN KU576940_HBc_P-B of FT:mat_peptide KU576940_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 166-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWAGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576950_HBc_P-B Product feature CHAIN KU576950_HBc_P-B of FT:mat_peptide KU576950_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 171-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYQETLECPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576968_HBc_P-B Product feature CHAIN KU576968_HBc_P-B of FT:mat_peptide KU576968_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 183-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVPEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576969_HBc_P-B Product feature CHAIN KU576969_HBc_P-B of FT:mat_peptide KU576969_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 183-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576970_HBc_P-B Product feature CHAIN KU576970_HBc_P-B of FT:mat_peptide KU576970_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 183-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576975_HBc_P-B Product feature CHAIN KU576975_HBc_P-B of FT:mat_peptide KU576975_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 185-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576978_HBc_P-B Product feature CHAIN KU576978_HBc_P-B of FT:mat_peptide KU576978_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576979_HBc_P-B Product feature CHAIN KU576979_HBc_P-B of FT:mat_peptide KU576979_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFRISCLTFGRETVLEYLVPFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQCW
>gnl|hbvpro|KU576980_HBc_P-B Product feature CHAIN KU576980_HBc_P-B of FT:mat_peptide KU576980_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-4). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576981_HBc_P-B Product feature CHAIN KU576981_HBc_P-B of FT:mat_peptide KU576981_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-5). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576982_HBc_P-B Product feature CHAIN KU576982_HBc_P-B of FT:mat_peptide KU576982_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-6). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576983_HBc_P-B Product feature CHAIN KU576983_HBc_P-B of FT:mat_peptide KU576983_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576984_HBc_P-B Product feature CHAIN KU576984_HBc_P-B of FT:mat_peptide KU576984_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576985_HBc_P-B Product feature CHAIN KU576985_HBc_P-B of FT:mat_peptide KU576985_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 186-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576988_HBc_P-B Product feature CHAIN KU576988_HBc_P-B of FT:mat_peptide KU576988_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 187-9). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576989_HBc_P-B Product feature CHAIN KU576989_HBc_P-B of FT:mat_peptide KU576989_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 187-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577003_HBc_P-B Product feature CHAIN KU577003_HBc_P-B of FT:mat_peptide KU577003_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 192-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577004_HBc_P-B Product feature CHAIN KU577004_HBc_P-B of FT:mat_peptide KU577004_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 192-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFLSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577046_HBc_P-B Product feature CHAIN KU577046_HBc_P-B of FT:mat_peptide KU577046_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 203-3). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFFPNMRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577047_HBc_P-B Product feature CHAIN KU577047_HBc_P-B of FT:mat_peptide KU577047_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 203-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFFPNMRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLVDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577048_HBc_P-B Product feature CHAIN KU577048_HBc_P-B of FT:mat_peptide KU577048_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 203-8). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFFPNMRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577081_HBc_P-B Product feature CHAIN KU577081_HBc_P-B of FT:mat_peptide KU577081_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 27-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577088_HBc_P-B Product feature CHAIN KU577088_HBc_P-B of FT:mat_peptide KU577088_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 52-2). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU577089_HBc_P-B Product feature CHAIN KU577089_HBc_P-B of FT:mat_peptide KU577089_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 52-8-1). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALCRDALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCXSPRRRT
PSPRRRXSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577107_HBc_P-B Product feature CHAIN KU577107_HBc_P-B of FT:mat_peptide KU577107_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 112-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KU577111_HBc_P-B Product feature CHAIN KU577111_HBc_P-B of FT:mat_peptide KU577111_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 133-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577115_HBc_P-B Product feature CHAIN KU577115_HBc_P-B of FT:mat_peptide KU577115_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 134-4). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577117_HBc_P-B Product feature CHAIN KU577117_HBc_P-B of FT:mat_peptide KU577117_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 134-7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577120_HBc_P-B Product feature CHAIN KU577120_HBc_P-B of FT:mat_peptide KU577120_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 134-11). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577121_HBc_P-B Product feature CHAIN KU577121_HBc_P-B of FT:mat_peptide KU577121_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 134-12). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667412_HBc_P-B Product feature CHAIN KU667412_HBc_P-B of FT:mat_peptide KU667412_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-00c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELFSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALWQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
LSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667420_HBc_P-B Product feature CHAIN KU667420_HBc_P-B of FT:mat_peptide KU667420_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 50-01c). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYEEFGASVELLSFLPTDFFPSIRDPLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRGRSSRRRT
PSPRRRTSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667422_HBc_P-B Product feature CHAIN KU667422_HBc_P-B of FT:mat_peptide KU667422_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-01c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREFVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRTRMSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667427_HBc_P-B Product feature CHAIN KU667427_HBc_P-B of FT:mat_peptide KU667427_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29-02c). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667438_HBc_P-B Product feature CHAIN KU667438_HBc_P-B of FT:mat_peptide KU667438_HBc_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-03c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPAYRPPNAPILSALPETTVVRRRGRSPRRRT
PSPRRRRPQSPRHRRSQSRESQC
>gnl|hbvpro|KU667439_HBc_P-