HBVdb

Dataset for protein HBe of genotype B

[Download (right click)] [Alignment] [Repertoires]

1573 sequence(s)

>gnl|hbvpro|AB010289_HBe_P-B Product feature CHAIN AB010289_HBe_P-B of FT:mat_peptide AB010289_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033554_HBe_P-B Product feature CHAIN AB033554_HBe_P-B of FT:mat_peptide AB033554_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB033555_HBe_P-B Product feature CHAIN AB033555_HBe_P-B of FT:mat_peptide AB033555_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB048705_HBe_P-B Product feature CHAIN AB048705_HBe_P-B of FT:mat_peptide AB048705_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073821_HBe_P-B Product feature CHAIN AB073821_HBe_P-B of FT:mat_peptide AB073821_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRXRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB073822_HBe_P-B Product feature CHAIN AB073822_HBe_P-B of FT:mat_peptide AB073822_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073825_HBe_P-B Product feature CHAIN AB073825_HBe_P-B of FT:mat_peptide AB073825_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPA
YRPANAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB073826_HBe_P-B Product feature CHAIN AB073826_HBe_P-B of FT:mat_peptide AB073826_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073827_HBe_P-B Product feature CHAIN AB073827_HBe_P-B of FT:mat_peptide AB073827_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073828_HBe_P-B Product feature CHAIN AB073828_HBe_P-B of FT:mat_peptide AB073828_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073829_HBe_P-B Product feature CHAIN AB073829_HBe_P-B of FT:mat_peptide AB073829_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073831_HBe_P-B Product feature CHAIN AB073831_HBe_P-B of FT:mat_peptide AB073831_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073833_HBe_P-B Product feature CHAIN AB073833_HBe_P-B of FT:mat_peptide AB073833_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073834_HBe_P-B Product feature CHAIN AB073834_HBe_P-B of FT:mat_peptide AB073834_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073840_HBe_P-B Product feature CHAIN AB073840_HBe_P-B of FT:mat_peptide AB073840_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALDREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073846_HBe_P-B Product feature CHAIN AB073846_HBe_P-B of FT:mat_peptide AB073846_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073848_HBe_P-B Product feature CHAIN AB073848_HBe_P-B of FT:mat_peptide AB073848_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB073850_HBe_P-B Product feature CHAIN AB073850_HBe_P-B of FT:mat_peptide AB073850_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=212 residues).
TQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPVHCSPH
HTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB073851_HBe_P-B Product feature CHAIN AB073851_HBe_P-B of FT:mat_peptide AB073851_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB100695_HBe_P-B Product feature CHAIN AB100695_HBe_P-B of FT:mat_peptide AB100695_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFEFCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSPLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB115551_HBe_P-B Product feature CHAIN AB115551_HBe_P-B of FT:mat_peptide AB115551_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFEFCLVISRSCPTVQASKLCLGWLWAMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195933_HBe_P-B Product feature CHAIN AB195933_HBe_P-B of FT:mat_peptide AB195933_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195934_HBe_P-B Product feature CHAIN AB195934_HBe_P-B of FT:mat_peptide AB195934_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195935_HBe_P-B Product feature CHAIN AB195935_HBe_P-B of FT:mat_peptide AB195935_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205119_HBe_P-B Product feature CHAIN AB205119_HBe_P-B of FT:mat_peptide AB205119_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205121_HBe_P-B Product feature CHAIN AB205121_HBe_P-B of FT:mat_peptide AB205121_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB212625_HBe_P-B Product feature CHAIN AB212625_HBe_P-B of FT:mat_peptide AB212625_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLSFLPSDFFPTIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRTGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB212626_HBe_P-B Product feature CHAIN AB212626_HBe_P-B of FT:mat_peptide AB212626_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219426_HBe_P-B Product feature CHAIN AB219426_HBe_P-B of FT:mat_peptide AB219426_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219428_HBe_C-B Product feature CHAIN AB219428_HBe_C-B of FT:mat_peptide AB219428_HBe_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219429_HBe_P-B Product feature CHAIN AB219429_HBe_P-B of FT:mat_peptide AB219429_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB219430_HBe_P-B Product feature CHAIN AB219430_HBe_P-B of FT:mat_peptide AB219430_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB231909_HBe_P-B Product feature CHAIN AB231909_HBe_P-B of FT:mat_peptide AB231909_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTAPRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRFQSPRRRRSQSRESQC
>gnl|hbvpro|AB241116_HBe_P-B Product feature CHAIN AB241116_HBe_P-B of FT:mat_peptide AB241116_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241117_HBe_P-B Product feature CHAIN AB241117_HBe_P-B of FT:mat_peptide AB241117_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246339_HBe_P-B Product feature CHAIN AB246339_HBe_P-B of FT:mat_peptide AB246339_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246340_HBe_P-B Product feature CHAIN AB246340_HBe_P-B of FT:mat_peptide AB246340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246341_HBe_P-B Product feature CHAIN AB246341_HBe_P-B of FT:mat_peptide AB246341_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246342_HBe_P-B Product feature CHAIN AB246342_HBe_P-B of FT:mat_peptide AB246342_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246343_HBe_P-B Product feature CHAIN AB246343_HBe_P-B of FT:mat_peptide AB246343_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWVELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287314_HBe_P-B Product feature CHAIN AB287314_HBe_P-B of FT:mat_peptide AB287314_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287315_HBe_P-B Product feature CHAIN AB287315_HBe_P-B of FT:mat_peptide AB287315_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287328_HBe_P-B Product feature CHAIN AB287328_HBe_P-B of FT:mat_peptide AB287328_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB287329_HBe_P-B Product feature CHAIN AB287329_HBe_P-B of FT:mat_peptide AB287329_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300364_HBe_P-B Product feature CHAIN AB300364_HBe_P-B of FT:mat_peptide AB300364_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334299_HBe_P-B Product feature CHAIN AB334299_HBe_P-B of FT:mat_peptide AB334299_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334300_HBe_P-B Product feature CHAIN AB334300_HBe_P-B of FT:mat_peptide AB334300_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334301_HBe_P-B Product feature CHAIN AB334301_HBe_P-B of FT:mat_peptide AB334301_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334302_HBe_P-B Product feature CHAIN AB334302_HBe_P-B of FT:mat_peptide AB334302_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB334303_HBe_P-B Product feature CHAIN AB334303_HBe_P-B of FT:mat_peptide AB334303_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB355453_HBe_P-B Product feature CHAIN AB355453_HBe_P-B of FT:mat_peptide AB355453_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB355454_HBe_P-B Product feature CHAIN AB355454_HBe_P-B of FT:mat_peptide AB355454_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB355455_HBe_P-B Product feature CHAIN AB355455_HBe_P-B of FT:mat_peptide AB355455_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIITCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471854_HBe_P-B Product feature CHAIN AB471854_HBe_P-B of FT:mat_peptide AB471854_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471855_HBe_P-B Product feature CHAIN AB471855_HBe_P-B of FT:mat_peptide AB471855_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB493827_HBe_P-B Product feature CHAIN AB493827_HBe_P-B of FT:mat_peptide AB493827_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRXLLNPVLVLYRGALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB493833_HBe_P-B Product feature CHAIN AB493833_HBe_P-B of FT:mat_peptide AB493833_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTGQASNLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB493835_HBe_P-B Product feature CHAIN AB493835_HBe_P-B of FT:mat_peptide AB493835_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDAASALYREALESPEHCSPH
HTALRQAILCWGELRNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB675676_HBe_P-B Product feature CHAIN AB675676_HBe_P-B of FT:mat_peptide AB675676_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713527_HBe_P-B Product feature CHAIN AB713527_HBe_P-B of FT:mat_peptide AB713527_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713528_HBe_P-B Product feature CHAIN AB713528_HBe_P-B of FT:mat_peptide AB713528_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713530_HBe_P-B Product feature CHAIN AB713530_HBe_P-B of FT:mat_peptide AB713530_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLLHLSLIISGSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALKQAILCWGELMNLATWVGSNLEDPACRDLIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713531_HBe_P-B Product feature CHAIN AB713531_HBe_P-B of FT:mat_peptide AB713531_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB713532_HBe_P-B Product feature CHAIN AB713532_HBe_P-B of FT:mat_peptide AB713532_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv132). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQLLGVPIFGRTFRRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB900110_HBe_P-B Product feature CHAIN AB900110_HBe_P-B of FT:mat_peptide AB900110_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTAIRQAIICWGELMNLATWVGSNLEDPSSREAVVGYVNVNMGIKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPAA
YRPANAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB900112_HBe_P-B Product feature CHAIN AB900112_HBe_P-B of FT:mat_peptide AB900112_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
TQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPQDFYPSVRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB908299_HBe_P-B Product feature CHAIN AB908299_HBe_P-B of FT:mat_peptide AB908299_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB908300_HBe_P-B Product feature CHAIN AB908300_HBe_P-B of FT:mat_peptide AB908300_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB908303_HBe_P-B Product feature CHAIN AB908303_HBe_P-B of FT:mat_peptide AB908303_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESLEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB908304_HBe_P-B Product feature CHAIN AB908304_HBe_P-B of FT:mat_peptide AB908304_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AF100308_HBe_P-B Product feature CHAIN AF100308_HBe_P-B of FT:mat_peptide AF100308_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRGALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF100309_HBe_P-B Product feature CHAIN AF100309_HBe_P-B of FT:mat_peptide AF100309_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121243_HBe_P-B Product feature CHAIN AF121243_HBe_P-B of FT:mat_peptide AF121243_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121244_HBe_P-B Product feature CHAIN AF121244_HBe_P-B of FT:mat_peptide AF121244_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121245_HBe_P-B Product feature CHAIN AF121245_HBe_P-B of FT:mat_peptide AF121245_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121246_HBe_P-B Product feature CHAIN AF121246_HBe_P-B of FT:mat_peptide AF121246_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121247_HBe_P-B Product feature CHAIN AF121247_HBe_P-B of FT:mat_peptide AF121247_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121249_HBe_P-B Product feature CHAIN AF121249_HBe_P-B of FT:mat_peptide AF121249_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF157020_HBe_P-B Product feature CHAIN AF157020_HBe_P-B of FT:mat_peptide AF157020_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWICTPPA
YRPPNAPILSTLPDTTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF157023_HBe_P-B Product feature CHAIN AF157023_HBe_P-B of FT:mat_peptide AF157023_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHRCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF157024_HBe_P-B Product feature CHAIN AF157024_HBe_P-B of FT:mat_peptide AF157024_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|AF233235_HBe_P-B Product feature CHAIN AF233235_HBe_P-B of FT:mat_peptide AF233235_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV263c). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF233237_HBe_P-B Product feature CHAIN AF233237_HBe_P-B of FT:mat_peptide AF233237_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV4c). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF282917_HBe_P-B Product feature CHAIN AF282917_HBe_P-B of FT:mat_peptide AF282917_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHSSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGQNFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF282918_HBe_P-B Product feature CHAIN AF282918_HBe_P-B of FT:mat_peptide AF282918_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNANMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335738_HBe_P-B Product feature CHAIN AF335738_HBe_P-B of FT:mat_peptide AF335738_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCPIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335740_HBe_P-B Product feature CHAIN AF335740_HBe_P-B of FT:mat_peptide AF335740_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335741_HBe_P-B Product feature CHAIN AF335741_HBe_P-B of FT:mat_peptide AF335741_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335746_HBe_P-B Product feature CHAIN AF335746_HBe_P-B of FT:mat_peptide AF335746_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRGRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335748_HBe_P-B Product feature CHAIN AF335748_HBe_P-B of FT:mat_peptide AF335748_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIQCWGEVMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF335754_HBe_P-B Product feature CHAIN AF335754_HBe_P-B of FT:mat_peptide AF335754_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF479684_HBe_P-B Product feature CHAIN AF479684_HBe_P-B of FT:mat_peptide AF479684_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASVLYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480337_HBe_P-B Product feature CHAIN AF480337_HBe_P-B of FT:mat_peptide AF480337_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQASLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480338_HBe_P-B Product feature CHAIN AF480338_HBe_P-B of FT:mat_peptide AF480338_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPLPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480339_HBe_P-B Product feature CHAIN AF480339_HBe_P-B of FT:mat_peptide AF480339_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480340_HBe_P-B Product feature CHAIN AF480340_HBe_P-B of FT:mat_peptide AF480340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480341_HBe_P-B Product feature CHAIN AF480341_HBe_P-B of FT:mat_peptide AF480341_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDFIDTASALYREALESSEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480342_HBe_P-B Product feature CHAIN AF480342_HBe_P-B of FT:mat_peptide AF480342_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480343_HBe_P-B Product feature CHAIN AF480343_HBe_P-B of FT:mat_peptide AF480343_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480344_HBe_P-B Product feature CHAIN AF480344_HBe_P-B of FT:mat_peptide AF480344_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480345_HBe_P-B Product feature CHAIN AF480345_HBe_P-B of FT:mat_peptide AF480345_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480346_HBe_P-B Product feature CHAIN AF480346_HBe_P-B of FT:mat_peptide AF480346_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCPTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480347_HBe_P-B Product feature CHAIN AF480347_HBe_P-B of FT:mat_peptide AF480347_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480348_HBe_P-B Product feature CHAIN AF480348_HBe_P-B of FT:mat_peptide AF480348_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLLHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480349_HBe_P-B Product feature CHAIN AF480349_HBe_P-B of FT:mat_peptide AF480349_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISRLTFGRETVLEYLVSLGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480350_HBe_P-B Product feature CHAIN AF480350_HBe_P-B of FT:mat_peptide AF480350_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVRASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480351_HBe_P-B Product feature CHAIN AF480351_HBe_P-B of FT:mat_peptide AF480351_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLTTWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRGSQSRESQC
>gnl|hbvpro|AF480352_HBe_P-B Product feature CHAIN AF480352_HBe_P-B of FT:mat_peptide AF480352_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSLGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480353_HBe_P-B Product feature CHAIN AF480353_HBe_P-B of FT:mat_peptide AF480353_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQNILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|AF480354_HBe_P-B Product feature CHAIN AF480354_HBe_P-B of FT:mat_peptide AF480354_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480355_HBe_P-B Product feature CHAIN AF480355_HBe_P-B of FT:mat_peptide AF480355_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480356_HBe_P-B Product feature CHAIN AF480356_HBe_P-B of FT:mat_peptide AF480356_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480357_HBe_P-B Product feature CHAIN AF480357_HBe_P-B of FT:mat_peptide AF480357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480358_HBe_P-B Product feature CHAIN AF480358_HBe_P-B of FT:mat_peptide AF480358_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGGSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480359_HBe_P-B Product feature CHAIN AF480359_HBe_P-B of FT:mat_peptide AF480359_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480360_HBe_P-B Product feature CHAIN AF480360_HBe_P-B of FT:mat_peptide AF480360_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480361_HBe_P-B Product feature CHAIN AF480361_HBe_P-B of FT:mat_peptide AF480361_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWCELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480362_HBe_P-B Product feature CHAIN AF480362_HBe_P-B of FT:mat_peptide AF480362_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480363_HBe_P-B Product feature CHAIN AF480363_HBe_P-B of FT:mat_peptide AF480363_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF480364_HBe_P-B Product feature CHAIN AF480364_HBe_P-B of FT:mat_peptide AF480364_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYIEFRASGELLSFLPSDFFPSIRDLLDTASALYREALQSPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM888201_HBe_P-B Product feature CHAIN AM888201_HBe_P-B of FT:mat_peptide AM888201_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BM1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGPSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPV
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011084_HBe_P-B Product feature CHAIN AP011084_HBe_P-B of FT:mat_peptide AP011084_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011085_HBe_P-B Product feature CHAIN AP011085_HBe_P-B of FT:mat_peptide AP011085_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011086_HBe_P-B Product feature CHAIN AP011086_HBe_P-B of FT:mat_peptide AP011086_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011087_HBe_P-B Product feature CHAIN AP011087_HBe_P-B of FT:mat_peptide AP011087_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011088_HBe_P-B Product feature CHAIN AP011088_HBe_P-B of FT:mat_peptide AP011088_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011089_HBe_P-B Product feature CHAIN AP011089_HBe_P-B of FT:mat_peptide AP011089_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011090_HBe_P-B Product feature CHAIN AP011090_HBe_P-B of FT:mat_peptide AP011090_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011091_HBe_P-B Product feature CHAIN AP011091_HBe_P-B of FT:mat_peptide AP011091_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011092_HBe_P-B Product feature CHAIN AP011092_HBe_P-B of FT:mat_peptide AP011092_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011095_HBe_P-B Product feature CHAIN AP011095_HBe_P-B of FT:mat_peptide AP011095_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011096_HBe_P-B Product feature CHAIN AP011096_HBe_P-B of FT:mat_peptide AP011096_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY033072_HBe_P-B Product feature CHAIN AY033072_HBe_P-B of FT:mat_peptide AY033072_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY033073_HBe_P-B Product feature CHAIN AY033073_HBe_P-B of FT:mat_peptide AY033073_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167089_HBe_P-B Product feature CHAIN AY167089_HBe_P-B of FT:mat_peptide AY167089_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167098_HBe_P-B Product feature CHAIN AY167098_HBe_P-B of FT:mat_peptide AY167098_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNAGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY217359_HBe_P-B Product feature CHAIN AY217359_HBe_P-B of FT:mat_peptide AY217359_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY217360_HBe_P-B Product feature CHAIN AY217360_HBe_P-B of FT:mat_peptide AY217360_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPHRRRSQSRESQC
>gnl|hbvpro|AY220698_HBe_P-B Product feature CHAIN AY220698_HBe_P-B of FT:mat_peptide AY220698_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY220703_HBe_P-B Product feature CHAIN AY220703_HBe_P-B of FT:mat_peptide AY220703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY220704_HBe_P-B Product feature CHAIN AY220704_HBe_P-B of FT:mat_peptide AY220704_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269091_HBe_P-B Product feature CHAIN AY269091_HBe_P-B of FT:mat_peptide AY269091_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269093_HBe_P-B Product feature CHAIN AY269093_HBe_P-B of FT:mat_peptide AY269093_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
FQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269095_HBe_P-B Product feature CHAIN AY269095_HBe_P-B of FT:mat_peptide AY269095_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFSPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269097_HBe_P-B Product feature CHAIN AY269097_HBe_P-B of FT:mat_peptide AY269097_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269100_HBe_P-B Product feature CHAIN AY269100_HBe_P-B of FT:mat_peptide AY269100_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269102_HBe_P-B Product feature CHAIN AY269102_HBe_P-B of FT:mat_peptide AY269102_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVDYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVIRQRGRSTRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY269105_HBe_P-B Product feature CHAIN AY269105_HBe_P-B of FT:mat_peptide AY269105_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPSNAPILSTLPETAVVRCRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269108_HBe_P-B Product feature CHAIN AY269108_HBe_P-B of FT:mat_peptide AY269108_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRELLDTASAQYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269109_HBe_P-B Product feature CHAIN AY269109_HBe_P-B of FT:mat_peptide AY269109_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFRASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPTNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269110_HBe_P-B Product feature CHAIN AY269110_HBe_P-B of FT:mat_peptide AY269110_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269115_HBe_P-B Product feature CHAIN AY269115_HBe_P-B of FT:mat_peptide AY269115_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269120_HBe_P-B Product feature CHAIN AY269120_HBe_P-B of FT:mat_peptide AY269120_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFYLCLIISCSCSTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269128_HBe_P-B Product feature CHAIN AY269128_HBe_P-B of FT:mat_peptide AY269128_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPSSRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPENTVVRQRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQCL
>gnl|hbvpro|AY269131_HBe_P-B Product feature CHAIN AY269131_HBe_P-B of FT:mat_peptide AY269131_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269135_HBe_P-B Product feature CHAIN AY269135_HBe_P-B of FT:mat_peptide AY269135_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY293309_HBe_P-B Product feature CHAIN AY293309_HBe_P-B of FT:mat_peptide AY293309_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY518556_HBe_P-B Product feature CHAIN AY518556_HBe_P-B of FT:mat_peptide AY518556_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596102_HBe_P-B Product feature CHAIN AY596102_HBe_P-B of FT:mat_peptide AY596102_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596110_HBe_P-B Product feature CHAIN AY596110_HBe_P-B of FT:mat_peptide AY596110_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596111_HBe_P-B Product feature CHAIN AY596111_HBe_P-B of FT:mat_peptide AY596111_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSSH
HTALRQAIVCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFRQILWFHISCLTFGKETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVIRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY766463_HBe_P-B Product feature CHAIN AY766463_HBe_P-B of FT:mat_peptide AY766463_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00329_HBe_P-B Product feature CHAIN D00329_HBe_P-B of FT:mat_peptide D00329_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALKSPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLWWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00330_HBe_P-B Product feature CHAIN D00330_HBe_P-B of FT:mat_peptide D00330_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00331_HBe_C-B Product feature CHAIN D00331_HBe_C-B of FT:mat_peptide D00331_HBe_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144550_HBe_P-B Product feature CHAIN DQ144550_HBe_P-B of FT:mat_peptide DQ144550_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFSPSIRDLLDTASALYREALESPEHCSPH
HTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPHRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144560_HBe_P-B Product feature CHAIN DQ144560_HBe_P-B of FT:mat_peptide DQ144560_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLVHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144561_HBe_P-B Product feature CHAIN DQ144561_HBe_P-B of FT:mat_peptide DQ144561_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATRVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|DQ144564_HBe_P-B Product feature CHAIN DQ144564_HBe_P-B of FT:mat_peptide DQ144564_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144594_HBe_P-B Product feature CHAIN DQ144594_HBe_P-B of FT:mat_peptide DQ144594_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144597_HBe_P-B Product feature CHAIN DQ144597_HBe_P-B of FT:mat_peptide DQ144597_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-C3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLVHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144598_HBe_P-B Product feature CHAIN DQ144598_HBe_P-B of FT:mat_peptide DQ144598_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-D7). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATRVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|DQ144599_HBe_P-B Product feature CHAIN DQ144599_HBe_P-B of FT:mat_peptide DQ144599_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-7). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ361535_HBe_P-B Product feature CHAIN DQ361535_HBe_P-B of FT:mat_peptide DQ361535_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448619_HBe_P-B Product feature CHAIN DQ448619_HBe_P-B of FT:mat_peptide DQ448619_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448620_HBe_P-B Product feature CHAIN DQ448620_HBe_P-B of FT:mat_peptide DQ448620_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448621_HBe_P-B Product feature CHAIN DQ448621_HBe_P-B of FT:mat_peptide DQ448621_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448622_HBe_P-B Product feature CHAIN DQ448622_HBe_P-B of FT:mat_peptide DQ448622_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448623_HBe_P-B Product feature CHAIN DQ448623_HBe_P-B of FT:mat_peptide DQ448623_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQACKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448624_HBe_P-B Product feature CHAIN DQ448624_HBe_P-B of FT:mat_peptide DQ448624_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448625_HBe_P-B Product feature CHAIN DQ448625_HBe_P-B of FT:mat_peptide DQ448625_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=212 residues).
MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448626_HBe_P-B Product feature CHAIN DQ448626_HBe_P-B of FT:mat_peptide DQ448626_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448627_HBe_P-B Product feature CHAIN DQ448627_HBe_P-B of FT:mat_peptide DQ448627_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ448628_HBe_P-B Product feature CHAIN DQ448628_HBe_P-B of FT:mat_peptide DQ448628_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREAQC
>gnl|hbvpro|DQ904357_HBe_P-B Product feature CHAIN DQ904357_HBe_P-B of FT:mat_peptide DQ904357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETCVVRRRGRSPRRRAPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ975271_HBe_P-B Product feature CHAIN DQ975271_HBe_P-B of FT:mat_peptide DQ975271_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993687_HBe_P-B Product feature CHAIN DQ993687_HBe_P-B of FT:mat_peptide DQ993687_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGSSAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLTQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993694_HBe_P-B Product feature CHAIN DQ993694_HBe_P-B of FT:mat_peptide DQ993694_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 234). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993696_HBe_P-B Product feature CHAIN DQ993696_HBe_P-B of FT:mat_peptide DQ993696_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFNLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993697_HBe_P-B Product feature CHAIN DQ993697_HBe_P-B of FT:mat_peptide DQ993697_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFNLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993700_HBe_P-B Product feature CHAIN DQ993700_HBe_P-B of FT:mat_peptide DQ993700_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993701_HBe_P-B Product feature CHAIN DQ993701_HBe_P-B of FT:mat_peptide DQ993701_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993703_HBe_P-B Product feature CHAIN DQ993703_HBe_P-B of FT:mat_peptide DQ993703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993706_HBe_P-B Product feature CHAIN DQ993706_HBe_P-B of FT:mat_peptide DQ993706_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993707_HBe_P-B Product feature CHAIN DQ993707_HBe_P-B of FT:mat_peptide DQ993707_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEAPEHCSPH
HTALRQALLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993708_HBe_P-B Product feature CHAIN DQ993708_HBe_P-B of FT:mat_peptide DQ993708_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIPDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993709_HBe_P-B Product feature CHAIN DQ993709_HBe_P-B of FT:mat_peptide DQ993709_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993711_HBe_P-B Product feature CHAIN DQ993711_HBe_P-B of FT:mat_peptide DQ993711_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|DQ995801_HBe_P-B Product feature CHAIN DQ995801_HBe_P-B of FT:mat_peptide DQ995801_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPANAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ995805_HBe_P-B Product feature CHAIN DQ995805_HBe_P-B of FT:mat_peptide DQ995805_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-2.5KB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDPLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPA
YRPANAPILSTLPETTVVRCRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|EF134945_HBe_P-B Product feature CHAIN EF134945_HBe_P-B of FT:mat_peptide EF134945_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF134946_HBe_P-B Product feature CHAIN EF134946_HBe_P-B of FT:mat_peptide EF134946_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473972_HBe_P-B Product feature CHAIN EF473972_HBe_P-B of FT:mat_peptide EF473972_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPSVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473973_HBe_P-B Product feature CHAIN EF473973_HBe_P-B of FT:mat_peptide EF473973_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDSFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILGWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPGRRRSQSRESQC
>gnl|hbvpro|EF473974_HBe_P-B Product feature CHAIN EF473974_HBe_P-B of FT:mat_peptide EF473974_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLHTASALNREALESPEHCSPH
HTALRQAILGWGELMNLATWVGRNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGEWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSSGRRRSQSRESQC
>gnl|hbvpro|EF473975_HBe_P-B Product feature CHAIN EF473975_HBe_P-B of FT:mat_peptide EF473975_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473976_HBe_P-B Product feature CHAIN EF473976_HBe_P-B of FT:mat_peptide EF473976_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLNISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF473977_HBe_P-B Product feature CHAIN EF473977_HBe_P-B of FT:mat_peptide EF473977_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRIPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494380_HBe_P-B Product feature CHAIN EF494380_HBe_P-B of FT:mat_peptide EF494380_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494381_HBe_P-B Product feature CHAIN EF494381_HBe_P-B of FT:mat_peptide EF494381_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494382_HBe_P-B Product feature CHAIN EF494382_HBe_P-B of FT:mat_peptide EF494382_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTFQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTANALYREALESPEHCSAH
HTALRQAIVCWGELMNLATWVGGNLEDPGSRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRQRGRTPRRRTPSPRRRRSKSPRRKRSQSRDSQC
>gnl|hbvpro|EU139543_HBe_P-B Product feature CHAIN EU139543_HBe_P-B of FT:mat_peptide EU139543_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305547_HBe_P-B Product feature CHAIN EU305547_HBe_P-B of FT:mat_peptide EU305547_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305548_HBe_P-B Product feature CHAIN EU305548_HBe_P-B of FT:mat_peptide EU305548_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306677_HBe_P-B Product feature CHAIN EU306677_HBe_P-B of FT:mat_peptide EU306677_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306695_HBe_P-B Product feature CHAIN EU306695_HBe_P-B of FT:mat_peptide EU306695_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306696_HBe_P-B Product feature CHAIN EU306696_HBe_P-B of FT:mat_peptide EU306696_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPAPRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306697_HBe_P-B Product feature CHAIN EU306697_HBe_P-B of FT:mat_peptide EU306697_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306698_HBe_P-B Product feature CHAIN EU306698_HBe_P-B of FT:mat_peptide EU306698_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306699_HBe_P-B Product feature CHAIN EU306699_HBe_P-B of FT:mat_peptide EU306699_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIITCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDFLDTASALYREALESPEHCSPH
HTALRQAILCWGVLMNLATWVGSNLENPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306700_HBe_P-B Product feature CHAIN EU306700_HBe_P-B of FT:mat_peptide EU306700_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306701_HBe_P-B Product feature CHAIN EU306701_HBe_P-B of FT:mat_peptide EU306701_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306702_HBe_P-B Product feature CHAIN EU306702_HBe_P-B of FT:mat_peptide EU306702_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306703_HBe_P-B Product feature CHAIN EU306703_HBe_P-B of FT:mat_peptide EU306703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYGNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|EU306704_HBe_P-B Product feature CHAIN EU306704_HBe_P-B of FT:mat_peptide EU306704_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306705_HBe_P-B Product feature CHAIN EU306705_HBe_P-B of FT:mat_peptide EU306705_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306706_HBe_P-B Product feature CHAIN EU306706_HBe_P-B of FT:mat_peptide EU306706_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306707_HBe_P-B Product feature CHAIN EU306707_HBe_P-B of FT:mat_peptide EU306707_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306708_HBe_P-B Product feature CHAIN EU306708_HBe_P-B of FT:mat_peptide EU306708_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306709_HBe_P-B Product feature CHAIN EU306709_HBe_P-B of FT:mat_peptide EU306709_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQPLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306710_HBe_P-B Product feature CHAIN EU306710_HBe_P-B of FT:mat_peptide EU306710_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306712_HBe_P-B Product feature CHAIN EU306712_HBe_P-B of FT:mat_peptide EU306712_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330989_HBe_P-B Product feature CHAIN EU330989_HBe_P-B of FT:mat_peptide EU330989_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330990_HBe_P-B Product feature CHAIN EU330990_HBe_P-B of FT:mat_peptide EU330990_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330992_HBe_P-B Product feature CHAIN EU330992_HBe_P-B of FT:mat_peptide EU330992_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330994_HBe_P-B Product feature CHAIN EU330994_HBe_P-B of FT:mat_peptide EU330994_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330996_HBe_P-B Product feature CHAIN EU330996_HBe_P-B of FT:mat_peptide EU330996_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKISQLLWFHISCLTFGRETVLEYLVSFGVRIRTTPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330997_HBe_P-B Product feature CHAIN EU330997_HBe_P-B of FT:mat_peptide EU330997_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDPYKGFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330998_HBe_P-B Product feature CHAIN EU330998_HBe_P-B of FT:mat_peptide EU330998_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU330999_HBe_P-B Product feature CHAIN EU330999_HBe_P-B of FT:mat_peptide EU330999_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU331000_HBe_P-B Product feature CHAIN EU331000_HBe_P-B of FT:mat_peptide EU331000_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU331001_HBe_P-B Product feature CHAIN EU331001_HBe_P-B of FT:mat_peptide EU331001_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU350409_HBe_P-B Product feature CHAIN EU350409_HBe_P-B of FT:mat_peptide EU350409_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439018_HBe_P-B Product feature CHAIN EU439018_HBe_P-B of FT:mat_peptide EU439018_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439020_HBe_P-B Product feature CHAIN EU439020_HBe_P-B of FT:mat_peptide EU439020_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439021_HBe_P-B Product feature CHAIN EU439021_HBe_P-B of FT:mat_peptide EU439021_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLXLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439022_HBe_P-B Product feature CHAIN EU439022_HBe_P-B of FT:mat_peptide EU439022_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439023_HBe_P-B Product feature CHAIN EU439023_HBe_P-B of FT:mat_peptide EU439023_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLRLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU487256_HBe_P-B Product feature CHAIN EU487256_HBe_P-B of FT:mat_peptide EU487256_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAMLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570069_HBe_P-B Product feature CHAIN EU570069_HBe_P-B of FT:mat_peptide EU570069_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVGRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570070_HBe_P-B Product feature CHAIN EU570070_HBe_P-B of FT:mat_peptide EU570070_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPAPRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570071_HBe_P-B Product feature CHAIN EU570071_HBe_P-B of FT:mat_peptide EU570071_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU660224_HBe_P-B Product feature CHAIN EU660224_HBe_P-B of FT:mat_peptide EU660224_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796066_HBe_P-B Product feature CHAIN EU796066_HBe_P-B of FT:mat_peptide EU796066_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU796067_HBe_P-B Product feature CHAIN EU796067_HBe_P-B of FT:mat_peptide EU796067_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796068_HBe_P-B Product feature CHAIN EU796068_HBe_P-B of FT:mat_peptide EU796068_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796071_HBe_P-B Product feature CHAIN EU796071_HBe_P-B of FT:mat_peptide EU796071_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU881998_HBe_P-B Product feature CHAIN EU881998_HBe_P-B of FT:mat_peptide EU881998_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFYLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU882004_HBe_P-B Product feature CHAIN EU882004_HBe_P-B of FT:mat_peptide EU882004_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU919171_HBe_P-B Product feature CHAIN EU919171_HBe_P-B of FT:mat_peptide EU919171_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=212 residues).
LQFFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPDHVSAH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSQSREPRC
>gnl|hbvpro|EU939559_HBe_P-B Product feature CHAIN EU939559_HBe_P-B of FT:mat_peptide EU939559_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPIVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|EU939633_HBe_P-B Product feature CHAIN EU939633_HBe_P-B of FT:mat_peptide EU939633_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNAGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939634_HBe_P-B Product feature CHAIN EU939634_HBe_P-B of FT:mat_peptide EU939634_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNAGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939639_HBe_P-B Product feature CHAIN EU939639_HBe_P-B of FT:mat_peptide EU939639_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939666_HBe_P-B Product feature CHAIN EU939666_HBe_P-B of FT:mat_peptide EU939666_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939669_HBe_P-B Product feature CHAIN EU939669_HBe_P-B of FT:mat_peptide EU939669_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939676_HBe_P-B Product feature CHAIN EU939676_HBe_P-B of FT:mat_peptide EU939676_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023569_HBe_P-B Product feature CHAIN FJ023569_HBe_P-B of FT:mat_peptide FJ023569_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0081). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023573_HBe_P-B Product feature CHAIN FJ023573_HBe_P-B of FT:mat_peptide FJ023573_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSLLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023575_HBe_P-B Product feature CHAIN FJ023575_HBe_P-B of FT:mat_peptide FJ023575_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0990). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023576_HBe_P-B Product feature CHAIN FJ023576_HBe_P-B of FT:mat_peptide FJ023576_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-1046). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ023605_HBe_P-B Product feature CHAIN FJ023605_HBe_P-B of FT:mat_peptide FJ023605_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023606_HBe_P-B Product feature CHAIN FJ023606_HBe_P-B of FT:mat_peptide FJ023606_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023607_HBe_P-B Product feature CHAIN FJ023607_HBe_P-B of FT:mat_peptide FJ023607_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023608_HBe_P-B Product feature CHAIN FJ023608_HBe_P-B of FT:mat_peptide FJ023608_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETGLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023609_HBe_P-B Product feature CHAIN FJ023609_HBe_P-B of FT:mat_peptide FJ023609_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023610_HBe_P-B Product feature CHAIN FJ023610_HBe_P-B of FT:mat_peptide FJ023610_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASGDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023611_HBe_P-B Product feature CHAIN FJ023611_HBe_P-B of FT:mat_peptide FJ023611_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023612_HBe_P-B Product feature CHAIN FJ023612_HBe_P-B of FT:mat_peptide FJ023612_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023613_HBe_P-B Product feature CHAIN FJ023613_HBe_P-B of FT:mat_peptide FJ023613_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|FJ023614_HBe_P-B Product feature CHAIN FJ023614_HBe_P-B of FT:mat_peptide FJ023614_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023617_HBe_P-B Product feature CHAIN FJ023617_HBe_P-B of FT:mat_peptide FJ023617_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPGRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|FJ023618_HBe_P-B Product feature CHAIN FJ023618_HBe_P-B of FT:mat_peptide FJ023618_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPGRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023620_HBe_P-B Product feature CHAIN FJ023620_HBe_P-B of FT:mat_peptide FJ023620_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTIPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023627_HBe_P-B Product feature CHAIN FJ023627_HBe_P-B of FT:mat_peptide FJ023627_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023628_HBe_P-B Product feature CHAIN FJ023628_HBe_P-B of FT:mat_peptide FJ023628_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023629_HBe_P-B Product feature CHAIN FJ023629_HBe_P-B of FT:mat_peptide FJ023629_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023630_HBe_P-B Product feature CHAIN FJ023630_HBe_P-B of FT:mat_peptide FJ023630_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|FJ023633_HBe_P-B Product feature CHAIN FJ023633_HBe_P-B of FT:mat_peptide FJ023633_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023634_HBe_P-B Product feature CHAIN FJ023634_HBe_P-B of FT:mat_peptide FJ023634_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023635_HBe_P-B Product feature CHAIN FJ023635_HBe_P-B of FT:mat_peptide FJ023635_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023636_HBe_P-B Product feature CHAIN FJ023636_HBe_P-B of FT:mat_peptide FJ023636_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023637_HBe_P-B Product feature CHAIN FJ023637_HBe_P-B of FT:mat_peptide FJ023637_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSXSRESQC
>gnl|hbvpro|FJ023638_HBe_P-B Product feature CHAIN FJ023638_HBe_P-B of FT:mat_peptide FJ023638_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032349_HBe_P-B Product feature CHAIN FJ032349_HBe_P-B of FT:mat_peptide FJ032349_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032352_HBe_P-B Product feature CHAIN FJ032352_HBe_P-B of FT:mat_peptide FJ032352_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFLPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032353_HBe_P-B Product feature CHAIN FJ032353_HBe_P-B of FT:mat_peptide FJ032353_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLFLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLGDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032354_HBe_P-B Product feature CHAIN FJ032354_HBe_P-B of FT:mat_peptide FJ032354_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032357_HBe_P-B Product feature CHAIN FJ032357_HBe_P-B of FT:mat_peptide FJ032357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032358_HBe_P-B Product feature CHAIN FJ032358_HBe_P-B of FT:mat_peptide FJ032358_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349236_HBe_P-B Product feature CHAIN FJ349236_HBe_P-B of FT:mat_peptide FJ349236_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386582_HBe_P-B Product feature CHAIN FJ386582_HBe_P-B of FT:mat_peptide FJ386582_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386583_HBe_P-B Product feature CHAIN FJ386583_HBe_P-B of FT:mat_peptide FJ386583_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386584_HBe_P-B Product feature CHAIN FJ386584_HBe_P-B of FT:mat_peptide FJ386584_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386600_HBe_P-B Product feature CHAIN FJ386600_HBe_P-B of FT:mat_peptide FJ386600_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKENGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386610_HBe_P-B Product feature CHAIN FJ386610_HBe_P-B of FT:mat_peptide FJ386610_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386636_HBe_P-B Product feature CHAIN FJ386636_HBe_P-B of FT:mat_peptide FJ386636_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386642_HBe_P-B Product feature CHAIN FJ386642_HBe_P-B of FT:mat_peptide FJ386642_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386648_HBe_P-B Product feature CHAIN FJ386648_HBe_P-B of FT:mat_peptide FJ386648_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPVHCTPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPANAPILSTLPETTVVRPRGRSPRRRTPSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|FJ386654_HBe_P-B Product feature CHAIN FJ386654_HBe_P-B of FT:mat_peptide FJ386654_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386655_HBe_P-B Product feature CHAIN FJ386655_HBe_P-B of FT:mat_peptide FJ386655_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386660_HBe_P-B Product feature CHAIN FJ386660_HBe_P-B of FT:mat_peptide FJ386660_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRQRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386666_HBe_P-B Product feature CHAIN FJ386666_HBe_P-B of FT:mat_peptide FJ386666_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386668_HBe_P-B Product feature CHAIN FJ386668_HBe_P-B of FT:mat_peptide FJ386668_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386675_HBe_P-B Product feature CHAIN FJ386675_HBe_P-B of FT:mat_peptide FJ386675_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386676_HBe_P-B Product feature CHAIN FJ386676_HBe_P-B of FT:mat_peptide FJ386676_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386684_HBe_P-B Product feature CHAIN FJ386684_HBe_P-B of FT:mat_peptide FJ386684_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386688_HBe_P-B Product feature CHAIN FJ386688_HBe_P-B of FT:mat_peptide FJ386688_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ518812_HBe_P-B Product feature CHAIN FJ518812_HBe_P-B of FT:mat_peptide FJ518812_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562224_HBe_P-B Product feature CHAIN FJ562224_HBe_P-B of FT:mat_peptide FJ562224_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562253_HBe_P-B Product feature CHAIN FJ562253_HBe_P-B of FT:mat_peptide FJ562253_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562257_HBe_P-B Product feature CHAIN FJ562257_HBe_P-B of FT:mat_peptide FJ562257_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562289_HBe_P-B Product feature CHAIN FJ562289_HBe_P-B of FT:mat_peptide FJ562289_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562296_HBe_P-B Product feature CHAIN FJ562296_HBe_P-B of FT:mat_peptide FJ562296_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLSFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVIRGRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562311_HBe_P-B Product feature CHAIN FJ562311_HBe_P-B of FT:mat_peptide FJ562311_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDQGSRDLVVGYVNVNMGIKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRGRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562322_HBe_P-B Product feature CHAIN FJ562322_HBe_P-B of FT:mat_peptide FJ562322_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ667207_HBe_P-B Product feature CHAIN FJ667207_HBe_P-B of FT:mat_peptide FJ667207_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mars_RJ_8803658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ751767_HBe_P-B Product feature CHAIN FJ751767_HBe_P-B of FT:mat_peptide FJ751767_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, LHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ751769_HBe_P-B Product feature CHAIN FJ751769_HBe_P-B of FT:mat_peptide FJ751769_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|FJ755833_HBe_P-B Product feature CHAIN FJ755833_HBe_P-B of FT:mat_peptide FJ755833_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQ
>gnl|hbvpro|FJ787444_HBe_P-B Product feature CHAIN FJ787444_HBe_P-B of FT:mat_peptide FJ787444_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899779_HBe_P-B Product feature CHAIN FJ899779_HBe_P-B of FT:mat_peptide FJ899779_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358136_HBe_P-B Product feature CHAIN GQ358136_HBe_P-B of FT:mat_peptide GQ358136_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358137_HBe_P-B Product feature CHAIN GQ358137_HBe_P-B of FT:mat_peptide GQ358137_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFPLCLNISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRYQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358138_HBe_P-B Product feature CHAIN GQ358138_HBe_P-B of FT:mat_peptide GQ358138_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358141_HBe_P-B Product feature CHAIN GQ358141_HBe_P-B of FT:mat_peptide GQ358141_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358142_HBe_P-B Product feature CHAIN GQ358142_HBe_P-B of FT:mat_peptide GQ358142_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358143_HBe_P-B Product feature CHAIN GQ358143_HBe_P-B of FT:mat_peptide GQ358143_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETSVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358144_HBe_P-B Product feature CHAIN GQ358144_HBe_P-B of FT:mat_peptide GQ358144_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFPLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRKAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358145_HBe_P-B Product feature CHAIN GQ358145_HBe_P-B of FT:mat_peptide GQ358145_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWLGSNLKDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRGRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358147_HBe_P-B Product feature CHAIN GQ358147_HBe_P-B of FT:mat_peptide GQ358147_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWIWGMDIDPYKEFGASVEVLSFLPSDSFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWLGSNLKDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358148_HBe_P-B Product feature CHAIN GQ358148_HBe_P-B of FT:mat_peptide GQ358148_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASKELVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358149_HBe_P-B Product feature CHAIN GQ358149_HBe_P-B of FT:mat_peptide GQ358149_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358150_HBe_P-B Product feature CHAIN GQ358150_HBe_P-B of FT:mat_peptide GQ358150_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358151_HBe_P-B Product feature CHAIN GQ358151_HBe_P-B of FT:mat_peptide GQ358151_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358152_HBe_P-B Product feature CHAIN GQ358152_HBe_P-B of FT:mat_peptide GQ358152_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377519_HBe_P-B Product feature CHAIN GQ377519_HBe_P-B of FT:mat_peptide GQ377519_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377525_HBe_P-B Product feature CHAIN GQ377525_HBe_P-B of FT:mat_peptide GQ377525_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377537_HBe_P-B Product feature CHAIN GQ377537_HBe_P-B of FT:mat_peptide GQ377537_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377542_HBe_P-B Product feature CHAIN GQ377542_HBe_P-B of FT:mat_peptide GQ377542_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377558_HBe_P-B Product feature CHAIN GQ377558_HBe_P-B of FT:mat_peptide GQ377558_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377561_HBe_P-B Product feature CHAIN GQ377561_HBe_P-B of FT:mat_peptide GQ377561_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377566_HBe_P-B Product feature CHAIN GQ377566_HBe_P-B of FT:mat_peptide GQ377566_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377568_HBe_P-B Product feature CHAIN GQ377568_HBe_P-B of FT:mat_peptide GQ377568_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377569_HBe_P-B Product feature CHAIN GQ377569_HBe_P-B of FT:mat_peptide GQ377569_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377587_HBe_P-B Product feature CHAIN GQ377587_HBe_P-B of FT:mat_peptide GQ377587_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPANAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377588_HBe_P-B Product feature CHAIN GQ377588_HBe_P-B of FT:mat_peptide GQ377588_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377612_HBe_P-B Product feature CHAIN GQ377612_HBe_P-B of FT:mat_peptide GQ377612_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377625_HBe_P-B Product feature CHAIN GQ377625_HBe_P-B of FT:mat_peptide GQ377625_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|GQ377629_HBe_P-B Product feature CHAIN GQ377629_HBe_P-B of FT:mat_peptide GQ377629_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377638_HBe_P-B Product feature CHAIN GQ377638_HBe_P-B of FT:mat_peptide GQ377638_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377639_HBe_P-B Product feature CHAIN GQ377639_HBe_P-B of FT:mat_peptide GQ377639_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377641_HBe_P-B Product feature CHAIN GQ377641_HBe_P-B of FT:mat_peptide GQ377641_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377643_HBe_P-B Product feature CHAIN GQ377643_HBe_P-B of FT:mat_peptide GQ377643_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377644_HBe_P-B Product feature CHAIN GQ377644_HBe_P-B of FT:mat_peptide GQ377644_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQCILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRGRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475340_HBe_P-B Product feature CHAIN GQ475340_HBe_P-B of FT:mat_peptide GQ475340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855522_HBe_P-B Product feature CHAIN GQ855522_HBe_P-B of FT:mat_peptide GQ855522_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 23). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855526_HBe_P-B Product feature CHAIN GQ855526_HBe_P-B of FT:mat_peptide GQ855526_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 103). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRKSQSPESQC
>gnl|hbvpro|GQ855532_HBe_P-B Product feature CHAIN GQ855532_HBe_P-B of FT:mat_peptide GQ855532_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 210). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924603_HBe_P-B Product feature CHAIN GQ924603_HBe_P-B of FT:mat_peptide GQ924603_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924605_HBe_P-B Product feature CHAIN GQ924605_HBe_P-B of FT:mat_peptide GQ924605_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEXLVSFGVWIRTXPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRGRRSQSRESQC
>gnl|hbvpro|GQ924606_HBe_P-B Product feature CHAIN GQ924606_HBe_P-B of FT:mat_peptide GQ924606_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASXLYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924607_HBe_P-B Product feature CHAIN GQ924607_HBe_P-B of FT:mat_peptide GQ924607_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQWPRRRRSQSRESQC
>gnl|hbvpro|GQ924608_HBe_P-B Product feature CHAIN GQ924608_HBe_P-B of FT:mat_peptide GQ924608_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924610_HBe_P-B Product feature CHAIN GQ924610_HBe_P-B of FT:mat_peptide GQ924610_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDRYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924611_HBe_P-B Product feature CHAIN GQ924611_HBe_P-B of FT:mat_peptide GQ924611_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924621_HBe_P-B Product feature CHAIN GQ924621_HBe_P-B of FT:mat_peptide GQ924621_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924624_HBe_P-B Product feature CHAIN GQ924624_HBe_P-B of FT:mat_peptide GQ924624_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924627_HBe_P-B Product feature CHAIN GQ924627_HBe_P-B of FT:mat_peptide GQ924627_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924631_HBe_P-B Product feature CHAIN GQ924631_HBe_P-B of FT:mat_peptide GQ924631_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924634_HBe_P-B Product feature CHAIN GQ924634_HBe_P-B of FT:mat_peptide GQ924634_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924635_HBe_P-B Product feature CHAIN GQ924635_HBe_P-B of FT:mat_peptide GQ924635_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCITFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVIRQGSRSPRRRTPSPRRRRSQSPRRRRFQCRECQC
>gnl|hbvpro|GQ924638_HBe_P-B Product feature CHAIN GQ924638_HBe_P-B of FT:mat_peptide GQ924638_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKLRQILWFHLSCLTFGREVVLEYLVSFGVWIRTPSA
YRPQNAPILSTLPETTVVRGRGRSPRRRTPSRRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924640_HBe_P-B Product feature CHAIN GQ924640_HBe_P-B of FT:mat_peptide GQ924640_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924651_HBe_P-B Product feature CHAIN GQ924651_HBe_P-B of FT:mat_peptide GQ924651_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924653_HBe_P-B Product feature CHAIN GQ924653_HBe_P-B of FT:mat_peptide GQ924653_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924654_HBe_P-B Product feature CHAIN GQ924654_HBe_P-B of FT:mat_peptide GQ924654_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU357842_HBe_P-B Product feature CHAIN GU357842_HBe_P-B of FT:mat_peptide GU357842_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU434372_HBe_P-B Product feature CHAIN GU434372_HBe_P-B of FT:mat_peptide GU434372_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU434373_HBe_P-B Product feature CHAIN GU434373_HBe_P-B of FT:mat_peptide GU434373_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU451682_HBe_P-B Product feature CHAIN GU451682_HBe_P-B of FT:mat_peptide GU451682_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815548_HBe_P-B Product feature CHAIN GU815548_HBe_P-B of FT:mat_peptide GU815548_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815549_HBe_P-B Product feature CHAIN GU815549_HBe_P-B of FT:mat_peptide GU815549_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815550_HBe_P-B Product feature CHAIN GU815550_HBe_P-B of FT:mat_peptide GU815550_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815551_HBe_P-B Product feature CHAIN GU815551_HBe_P-B of FT:mat_peptide GU815551_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815552_HBe_P-B Product feature CHAIN GU815552_HBe_P-B of FT:mat_peptide GU815552_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815553_HBe_P-B Product feature CHAIN GU815553_HBe_P-B of FT:mat_peptide GU815553_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815554_HBe_P-B Product feature CHAIN GU815554_HBe_P-B of FT:mat_peptide GU815554_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815555_HBe_P-B Product feature CHAIN GU815555_HBe_P-B of FT:mat_peptide GU815555_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815556_HBe_P-B Product feature CHAIN GU815556_HBe_P-B of FT:mat_peptide GU815556_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815557_HBe_P-B Product feature CHAIN GU815557_HBe_P-B of FT:mat_peptide GU815557_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815558_HBe_P-B Product feature CHAIN GU815558_HBe_P-B of FT:mat_peptide GU815558_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGVDIDPYKEFGASVELLSFLPSDFFPPIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815559_HBe_P-B Product feature CHAIN GU815559_HBe_P-B of FT:mat_peptide GU815559_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815560_HBe_P-B Product feature CHAIN GU815560_HBe_P-B of FT:mat_peptide GU815560_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815561_HBe_P-B Product feature CHAIN GU815561_HBe_P-B of FT:mat_peptide GU815561_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815562_HBe_P-B Product feature CHAIN GU815562_HBe_P-B of FT:mat_peptide GU815562_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815563_HBe_P-B Product feature CHAIN GU815563_HBe_P-B of FT:mat_peptide GU815563_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815564_HBe_P-B Product feature CHAIN GU815564_HBe_P-B of FT:mat_peptide GU815564_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815565_HBe_P-B Product feature CHAIN GU815565_HBe_P-B of FT:mat_peptide GU815565_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815566_HBe_P-B Product feature CHAIN GU815566_HBe_P-B of FT:mat_peptide GU815566_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815567_HBe_P-B Product feature CHAIN GU815567_HBe_P-B of FT:mat_peptide GU815567_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815568_HBe_P-B Product feature CHAIN GU815568_HBe_P-B of FT:mat_peptide GU815568_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815569_HBe_P-B Product feature CHAIN GU815569_HBe_P-B of FT:mat_peptide GU815569_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815570_HBe_P-B Product feature CHAIN GU815570_HBe_P-B of FT:mat_peptide GU815570_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815571_HBe_P-B Product feature CHAIN GU815571_HBe_P-B of FT:mat_peptide GU815571_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815572_HBe_P-B Product feature CHAIN GU815572_HBe_P-B of FT:mat_peptide GU815572_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPEATVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU815573_HBe_P-B Product feature CHAIN GU815573_HBe_P-B of FT:mat_peptide GU815573_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815574_HBe_P-B Product feature CHAIN GU815574_HBe_P-B of FT:mat_peptide GU815574_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815575_HBe_P-B Product feature CHAIN GU815575_HBe_P-B of FT:mat_peptide GU815575_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815576_HBe_P-B Product feature CHAIN GU815576_HBe_P-B of FT:mat_peptide GU815576_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815577_HBe_P-B Product feature CHAIN GU815577_HBe_P-B of FT:mat_peptide GU815577_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815579_HBe_P-B Product feature CHAIN GU815579_HBe_P-B of FT:mat_peptide GU815579_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815581_HBe_P-B Product feature CHAIN GU815581_HBe_P-B of FT:mat_peptide GU815581_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815584_HBe_P-B Product feature CHAIN GU815584_HBe_P-B of FT:mat_peptide GU815584_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815585_HBe_P-B Product feature CHAIN GU815585_HBe_P-B of FT:mat_peptide GU815585_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815586_HBe_P-B Product feature CHAIN GU815586_HBe_P-B of FT:mat_peptide GU815586_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815587_HBe_P-B Product feature CHAIN GU815587_HBe_P-B of FT:mat_peptide GU815587_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSKLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815588_HBe_P-B Product feature CHAIN GU815588_HBe_P-B of FT:mat_peptide GU815588_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815590_HBe_P-B Product feature CHAIN GU815590_HBe_P-B of FT:mat_peptide GU815590_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815593_HBe_P-B Product feature CHAIN GU815593_HBe_P-B of FT:mat_peptide GU815593_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815595_HBe_P-B Product feature CHAIN GU815595_HBe_P-B of FT:mat_peptide GU815595_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815596_HBe_P-B Product feature CHAIN GU815596_HBe_P-B of FT:mat_peptide GU815596_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815597_HBe_P-B Product feature CHAIN GU815597_HBe_P-B of FT:mat_peptide GU815597_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815598_HBe_P-B Product feature CHAIN GU815598_HBe_P-B of FT:mat_peptide GU815598_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815599_HBe_P-B Product feature CHAIN GU815599_HBe_P-B of FT:mat_peptide GU815599_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815600_HBe_P-B Product feature CHAIN GU815600_HBe_P-B of FT:mat_peptide GU815600_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815601_HBe_P-B Product feature CHAIN GU815601_HBe_P-B of FT:mat_peptide GU815601_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815602_HBe_P-B Product feature CHAIN GU815602_HBe_P-B of FT:mat_peptide GU815602_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815603_HBe_P-B Product feature CHAIN GU815603_HBe_P-B of FT:mat_peptide GU815603_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815604_HBe_P-B Product feature CHAIN GU815604_HBe_P-B of FT:mat_peptide GU815604_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815605_HBe_P-B Product feature CHAIN GU815605_HBe_P-B of FT:mat_peptide GU815605_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815606_HBe_P-B Product feature CHAIN GU815606_HBe_P-B of FT:mat_peptide GU815606_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815607_HBe_P-B Product feature CHAIN GU815607_HBe_P-B of FT:mat_peptide GU815607_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815608_HBe_P-B Product feature CHAIN GU815608_HBe_P-B of FT:mat_peptide GU815608_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815610_HBe_P-B Product feature CHAIN GU815610_HBe_P-B of FT:mat_peptide GU815610_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQPLHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815611_HBe_P-B Product feature CHAIN GU815611_HBe_P-B of FT:mat_peptide GU815611_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815612_HBe_P-B Product feature CHAIN GU815612_HBe_P-B of FT:mat_peptide GU815612_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDPLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815613_HBe_P-B Product feature CHAIN GU815613_HBe_P-B of FT:mat_peptide GU815613_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815614_HBe_P-B Product feature CHAIN GU815614_HBe_P-B of FT:mat_peptide GU815614_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815616_HBe_P-B Product feature CHAIN GU815616_HBe_P-B of FT:mat_peptide GU815616_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815617_HBe_P-B Product feature CHAIN GU815617_HBe_P-B of FT:mat_peptide GU815617_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815618_HBe_P-B Product feature CHAIN GU815618_HBe_P-B of FT:mat_peptide GU815618_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815619_HBe_P-B Product feature CHAIN GU815619_HBe_P-B of FT:mat_peptide GU815619_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISYLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815620_HBe_P-B Product feature CHAIN GU815620_HBe_P-B of FT:mat_peptide GU815620_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815621_HBe_P-B Product feature CHAIN GU815621_HBe_P-B of FT:mat_peptide GU815621_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815622_HBe_P-B Product feature CHAIN GU815622_HBe_P-B of FT:mat_peptide GU815622_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815623_HBe_P-B Product feature CHAIN GU815623_HBe_P-B of FT:mat_peptide GU815623_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815624_HBe_P-B Product feature CHAIN GU815624_HBe_P-B of FT:mat_peptide GU815624_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815625_HBe_P-B Product feature CHAIN GU815625_HBe_P-B of FT:mat_peptide GU815625_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815626_HBe_P-B Product feature CHAIN GU815626_HBe_P-B of FT:mat_peptide GU815626_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815627_HBe_P-B Product feature CHAIN GU815627_HBe_P-B of FT:mat_peptide GU815627_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815628_HBe_P-B Product feature CHAIN GU815628_HBe_P-B of FT:mat_peptide GU815628_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815631_HBe_P-B Product feature CHAIN GU815631_HBe_P-B of FT:mat_peptide GU815631_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815632_HBe_P-B Product feature CHAIN GU815632_HBe_P-B of FT:mat_peptide GU815632_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815633_HBe_P-B Product feature CHAIN GU815633_HBe_P-B of FT:mat_peptide GU815633_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815634_HBe_P-B Product feature CHAIN GU815634_HBe_P-B of FT:mat_peptide GU815634_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-10). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815635_HBe_P-B Product feature CHAIN GU815635_HBe_P-B of FT:mat_peptide GU815635_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815636_HBe_P-B Product feature CHAIN GU815636_HBe_P-B of FT:mat_peptide GU815636_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815637_HBe_P-B Product feature CHAIN GU815637_HBe_P-B of FT:mat_peptide GU815637_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815638_HBe_P-B Product feature CHAIN GU815638_HBe_P-B of FT:mat_peptide GU815638_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815639_HBe_P-B Product feature CHAIN GU815639_HBe_P-B of FT:mat_peptide GU815639_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815640_HBe_P-B Product feature CHAIN GU815640_HBe_P-B of FT:mat_peptide GU815640_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815642_HBe_P-B Product feature CHAIN GU815642_HBe_P-B of FT:mat_peptide GU815642_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815643_HBe_P-B Product feature CHAIN GU815643_HBe_P-B of FT:mat_peptide GU815643_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815644_HBe_P-B Product feature CHAIN GU815644_HBe_P-B of FT:mat_peptide GU815644_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815645_HBe_P-B Product feature CHAIN GU815645_HBe_P-B of FT:mat_peptide GU815645_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815646_HBe_P-B Product feature CHAIN GU815646_HBe_P-B of FT:mat_peptide GU815646_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815647_HBe_P-B Product feature CHAIN GU815647_HBe_P-B of FT:mat_peptide GU815647_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815648_HBe_P-B Product feature CHAIN GU815648_HBe_P-B of FT:mat_peptide GU815648_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815649_HBe_P-B Product feature CHAIN GU815649_HBe_P-B of FT:mat_peptide GU815649_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815650_HBe_P-B Product feature CHAIN GU815650_HBe_P-B of FT:mat_peptide GU815650_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815651_HBe_P-B Product feature CHAIN GU815651_HBe_P-B of FT:mat_peptide GU815651_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815652_HBe_P-B Product feature CHAIN GU815652_HBe_P-B of FT:mat_peptide GU815652_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815653_HBe_P-B Product feature CHAIN GU815653_HBe_P-B of FT:mat_peptide GU815653_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815654_HBe_P-B Product feature CHAIN GU815654_HBe_P-B of FT:mat_peptide GU815654_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815656_HBe_P-B Product feature CHAIN GU815656_HBe_P-B of FT:mat_peptide GU815656_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815657_HBe_P-B Product feature CHAIN GU815657_HBe_P-B of FT:mat_peptide GU815657_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISRLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815658_HBe_P-B Product feature CHAIN GU815658_HBe_P-B of FT:mat_peptide GU815658_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815659_HBe_P-B Product feature CHAIN GU815659_HBe_P-B of FT:mat_peptide GU815659_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815660_HBe_P-B Product feature CHAIN GU815660_HBe_P-B of FT:mat_peptide GU815660_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815661_HBe_P-B Product feature CHAIN GU815661_HBe_P-B of FT:mat_peptide GU815661_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815662_HBe_P-B Product feature CHAIN GU815662_HBe_P-B of FT:mat_peptide GU815662_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSRSPRRRRSQSRESQC
>gnl|hbvpro|GU815663_HBe_P-B Product feature CHAIN GU815663_HBe_P-B of FT:mat_peptide GU815663_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815664_HBe_P-B Product feature CHAIN GU815664_HBe_P-B of FT:mat_peptide GU815664_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815665_HBe_P-B Product feature CHAIN GU815665_HBe_P-B of FT:mat_peptide GU815665_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815666_HBe_P-B Product feature CHAIN GU815666_HBe_P-B of FT:mat_peptide GU815666_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815667_HBe_P-B Product feature CHAIN GU815667_HBe_P-B of FT:mat_peptide GU815667_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815668_HBe_P-B Product feature CHAIN GU815668_HBe_P-B of FT:mat_peptide GU815668_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815669_HBe_P-B Product feature CHAIN GU815669_HBe_P-B of FT:mat_peptide GU815669_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815670_HBe_P-B Product feature CHAIN GU815670_HBe_P-B of FT:mat_peptide GU815670_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815672_HBe_P-B Product feature CHAIN GU815672_HBe_P-B of FT:mat_peptide GU815672_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815673_HBe_P-B Product feature CHAIN GU815673_HBe_P-B of FT:mat_peptide GU815673_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815674_HBe_P-B Product feature CHAIN GU815674_HBe_P-B of FT:mat_peptide GU815674_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815675_HBe_P-B Product feature CHAIN GU815675_HBe_P-B of FT:mat_peptide GU815675_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815676_HBe_P-B Product feature CHAIN GU815676_HBe_P-B of FT:mat_peptide GU815676_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVSVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815677_HBe_P-B Product feature CHAIN GU815677_HBe_P-B of FT:mat_peptide GU815677_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQVILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815678_HBe_P-B Product feature CHAIN GU815678_HBe_P-B of FT:mat_peptide GU815678_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFNISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815679_HBe_P-B Product feature CHAIN GU815679_HBe_P-B of FT:mat_peptide GU815679_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815680_HBe_P-B Product feature CHAIN GU815680_HBe_P-B of FT:mat_peptide GU815680_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815681_HBe_P-B Product feature CHAIN GU815681_HBe_P-B of FT:mat_peptide GU815681_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815683_HBe_P-B Product feature CHAIN GU815683_HBe_P-B of FT:mat_peptide GU815683_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815684_HBe_P-B Product feature CHAIN GU815684_HBe_P-B of FT:mat_peptide GU815684_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815685_HBe_P-B Product feature CHAIN GU815685_HBe_P-B of FT:mat_peptide GU815685_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815686_HBe_P-B Product feature CHAIN GU815686_HBe_P-B of FT:mat_peptide GU815686_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815687_HBe_P-B Product feature CHAIN GU815687_HBe_P-B of FT:mat_peptide GU815687_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815688_HBe_P-B Product feature CHAIN GU815688_HBe_P-B of FT:mat_peptide GU815688_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815689_HBe_P-B Product feature CHAIN GU815689_HBe_P-B of FT:mat_peptide GU815689_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815691_HBe_P-B Product feature CHAIN GU815691_HBe_P-B of FT:mat_peptide GU815691_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815692_HBe_P-B Product feature CHAIN GU815692_HBe_P-B of FT:mat_peptide GU815692_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815693_HBe_P-B Product feature CHAIN GU815693_HBe_P-B of FT:mat_peptide GU815693_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815694_HBe_P-B Product feature CHAIN GU815694_HBe_P-B of FT:mat_peptide GU815694_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
PNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815695_HBe_P-B Product feature CHAIN GU815695_HBe_P-B of FT:mat_peptide GU815695_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPKTTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815696_HBe_P-B Product feature CHAIN GU815696_HBe_P-B of FT:mat_peptide GU815696_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
PTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815697_HBe_P-B Product feature CHAIN GU815697_HBe_P-B of FT:mat_peptide GU815697_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815698_HBe_P-B Product feature CHAIN GU815698_HBe_P-B of FT:mat_peptide GU815698_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815700_HBe_P-B Product feature CHAIN GU815700_HBe_P-B of FT:mat_peptide GU815700_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPR
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815701_HBe_P-B Product feature CHAIN GU815701_HBe_P-B of FT:mat_peptide GU815701_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815702_HBe_P-B Product feature CHAIN GU815702_HBe_P-B of FT:mat_peptide GU815702_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815703_HBe_P-B Product feature CHAIN GU815703_HBe_P-B of FT:mat_peptide GU815703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815704_HBe_P-B Product feature CHAIN GU815704_HBe_P-B of FT:mat_peptide GU815704_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815705_HBe_P-B Product feature CHAIN GU815705_HBe_P-B of FT:mat_peptide GU815705_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815708_HBe_P-B Product feature CHAIN GU815708_HBe_P-B of FT:mat_peptide GU815708_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815709_HBe_P-B Product feature CHAIN GU815709_HBe_P-B of FT:mat_peptide GU815709_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815711_HBe_P-B Product feature CHAIN GU815711_HBe_P-B of FT:mat_peptide GU815711_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815712_HBe_P-B Product feature CHAIN GU815712_HBe_P-B of FT:mat_peptide GU815712_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRETLESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNTPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815713_HBe_P-B Product feature CHAIN GU815713_HBe_P-B of FT:mat_peptide GU815713_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815715_HBe_P-B Product feature CHAIN GU815715_HBe_P-B of FT:mat_peptide GU815715_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815716_HBe_P-B Product feature CHAIN GU815716_HBe_P-B of FT:mat_peptide GU815716_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815717_HBe_P-B Product feature CHAIN GU815717_HBe_P-B of FT:mat_peptide GU815717_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815718_HBe_P-B Product feature CHAIN GU815718_HBe_P-B of FT:mat_peptide GU815718_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815719_HBe_P-B Product feature CHAIN GU815719_HBe_P-B of FT:mat_peptide GU815719_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815720_HBe_P-B Product feature CHAIN GU815720_HBe_P-B of FT:mat_peptide GU815720_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815721_HBe_P-B Product feature CHAIN GU815721_HBe_P-B of FT:mat_peptide GU815721_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815722_HBe_P-B Product feature CHAIN GU815722_HBe_P-B of FT:mat_peptide GU815722_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMGIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815723_HBe_P-B Product feature CHAIN GU815723_HBe_P-B of FT:mat_peptide GU815723_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815724_HBe_P-B Product feature CHAIN GU815724_HBe_P-B of FT:mat_peptide GU815724_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815725_HBe_P-B Product feature CHAIN GU815725_HBe_P-B of FT:mat_peptide GU815725_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815726_HBe_P-B Product feature CHAIN GU815726_HBe_P-B of FT:mat_peptide GU815726_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815727_HBe_P-B Product feature CHAIN GU815727_HBe_P-B of FT:mat_peptide GU815727_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815728_HBe_P-B Product feature CHAIN GU815728_HBe_P-B of FT:mat_peptide GU815728_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815729_HBe_P-B Product feature CHAIN GU815729_HBe_P-B of FT:mat_peptide GU815729_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815730_HBe_P-B Product feature CHAIN GU815730_HBe_P-B of FT:mat_peptide GU815730_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815731_HBe_P-B Product feature CHAIN GU815731_HBe_P-B of FT:mat_peptide GU815731_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815732_HBe_P-B Product feature CHAIN GU815732_HBe_P-B of FT:mat_peptide GU815732_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815733_HBe_P-B Product feature CHAIN GU815733_HBe_P-B of FT:mat_peptide GU815733_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815734_HBe_P-B Product feature CHAIN GU815734_HBe_P-B of FT:mat_peptide GU815734_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815735_HBe_P-B Product feature CHAIN GU815735_HBe_P-B of FT:mat_peptide GU815735_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815736_HBe_P-B Product feature CHAIN GU815736_HBe_P-B of FT:mat_peptide GU815736_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815737_HBe_P-B Product feature CHAIN GU815737_HBe_P-B of FT:mat_peptide GU815737_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815738_HBe_P-B Product feature CHAIN GU815738_HBe_P-B of FT:mat_peptide GU815738_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815739_HBe_P-B Product feature CHAIN GU815739_HBe_P-B of FT:mat_peptide GU815739_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815740_HBe_P-B Product feature CHAIN GU815740_HBe_P-B of FT:mat_peptide GU815740_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815741_HBe_P-B Product feature CHAIN GU815741_HBe_P-B of FT:mat_peptide GU815741_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-4). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815742_HBe_P-B Product feature CHAIN GU815742_HBe_P-B of FT:mat_peptide GU815742_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815743_HBe_P-B Product feature CHAIN GU815743_HBe_P-B of FT:mat_peptide GU815743_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815744_HBe_P-B Product feature CHAIN GU815744_HBe_P-B of FT:mat_peptide GU815744_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815745_HBe_P-B Product feature CHAIN GU815745_HBe_P-B of FT:mat_peptide GU815745_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815746_HBe_P-B Product feature CHAIN GU815746_HBe_P-B of FT:mat_peptide GU815746_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815747_HBe_P-B Product feature CHAIN GU815747_HBe_P-B of FT:mat_peptide GU815747_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNRGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815748_HBe_P-B Product feature CHAIN GU815748_HBe_P-B of FT:mat_peptide GU815748_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNRGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815749_HBe_P-B Product feature CHAIN GU815749_HBe_P-B of FT:mat_peptide GU815749_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815750_HBe_P-B Product feature CHAIN GU815750_HBe_P-B of FT:mat_peptide GU815750_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815751_HBe_P-B Product feature CHAIN GU815751_HBe_P-B of FT:mat_peptide GU815751_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815752_HBe_P-B Product feature CHAIN GU815752_HBe_P-B of FT:mat_peptide GU815752_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRPQSPRRRRSQSRESQC
>gnl|hbvpro|GU815753_HBe_P-B Product feature CHAIN GU815753_HBe_P-B of FT:mat_peptide GU815753_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815754_HBe_P-B Product feature CHAIN GU815754_HBe_P-B of FT:mat_peptide GU815754_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815755_HBe_P-B Product feature CHAIN GU815755_HBe_P-B of FT:mat_peptide GU815755_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815756_HBe_P-B Product feature CHAIN GU815756_HBe_P-B of FT:mat_peptide GU815756_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815759_HBe_P-B Product feature CHAIN GU815759_HBe_P-B of FT:mat_peptide GU815759_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815760_HBe_P-B Product feature CHAIN GU815760_HBe_P-B of FT:mat_peptide GU815760_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815761_HBe_P-B Product feature CHAIN GU815761_HBe_P-B of FT:mat_peptide GU815761_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRCRRSQSRESQC
>gnl|hbvpro|GU815762_HBe_P-B Product feature CHAIN GU815762_HBe_P-B of FT:mat_peptide GU815762_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815764_HBe_P-B Product feature CHAIN GU815764_HBe_P-B of FT:mat_peptide GU815764_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRCRRSQSRESQC
>gnl|hbvpro|GU815765_HBe_P-B Product feature CHAIN GU815765_HBe_P-B of FT:mat_peptide GU815765_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815766_HBe_P-B Product feature CHAIN GU815766_HBe_P-B of FT:mat_peptide GU815766_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815767_HBe_P-B Product feature CHAIN GU815767_HBe_P-B of FT:mat_peptide GU815767_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815768_HBe_P-B Product feature CHAIN GU815768_HBe_P-B of FT:mat_peptide GU815768_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815769_HBe_P-B Product feature CHAIN GU815769_HBe_P-B of FT:mat_peptide GU815769_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815770_HBe_P-B Product feature CHAIN GU815770_HBe_P-B of FT:mat_peptide GU815770_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815771_HBe_P-B Product feature CHAIN GU815771_HBe_P-B of FT:mat_peptide GU815771_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU815780_HBe_P-B Product feature CHAIN GU815780_HBe_P-B of FT:mat_peptide GU815780_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU827630_HBe_P-B Product feature CHAIN GU827630_HBe_P-B of FT:mat_peptide GU827630_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CMC104L). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011474_HBe_P-B Product feature CHAIN HM011474_HBe_P-B of FT:mat_peptide HM011474_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRPRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011487_HBe_P-B Product feature CHAIN HM011487_HBe_P-B of FT:mat_peptide HM011487_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATTELVSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAXLCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011494_HBe_P-B Product feature CHAIN HM011494_HBe_P-B of FT:mat_peptide HM011494_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSXRDLLDTAXALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRXPRRRTPSPRRRRSQSPRRRRSXSRESQC
>gnl|hbvpro|HM011504_HBe_P-B Product feature CHAIN HM011504_HBe_P-B of FT:mat_peptide HM011504_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|HQ700546_HBe_P-B Product feature CHAIN HQ700546_HBe_P-B of FT:mat_peptide HQ700546_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREYQC
>gnl|hbvpro|HQ700548_HBe_P-B Product feature CHAIN HQ700548_HBe_P-B of FT:mat_peptide HQ700548_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700549_HBe_P-B Product feature CHAIN HQ700549_HBe_P-B of FT:mat_peptide HQ700549_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF412801_HBe_P-B Product feature CHAIN JF412801_HBe_P-B of FT:mat_peptide JF412801_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF436921_HBe_P-B Product feature CHAIN JF436921_HBe_P-B of FT:mat_peptide JF436921_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSMLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775480_HBe_P-B Product feature CHAIN JF775480_HBe_P-B of FT:mat_peptide JF775480_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775482_HBe_P-B Product feature CHAIN JF775482_HBe_P-B of FT:mat_peptide JF775482_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775483_HBe_P-B Product feature CHAIN JF775483_HBe_P-B of FT:mat_peptide JF775483_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF775484_HBe_P-B Product feature CHAIN JF775484_HBe_P-B of FT:mat_peptide JF775484_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF899335_HBe_P-B Product feature CHAIN JF899335_HBe_P-B of FT:mat_peptide JF899335_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN406371_HBe_P-B Product feature CHAIN JN406371_HBe_P-B of FT:mat_peptide JN406371_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827419_HBe_P-B Product feature CHAIN JN827419_HBe_P-B of FT:mat_peptide JN827419_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027311_HBe_P-B Product feature CHAIN JQ027311_HBe_P-B of FT:mat_peptide JQ027311_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
IQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASXXLLSFLPADFFPSVHDLLDTATALYREALESPEHCSPH
HTAXRQAILCWGELMNLATWVGGNLXDPXSRELVVGYVNVNMGLKXRQLLWFHISCLXFGRETVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027316_HBe_P-B Product feature CHAIN JQ027316_HBe_P-B of FT:mat_peptide JQ027316_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGREVVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040125_HBe_P-B Product feature CHAIN JQ040125_HBe_P-B of FT:mat_peptide JQ040125_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPHRRRSQSRESQC
>gnl|hbvpro|JQ040128_HBe_P-B Product feature CHAIN JQ040128_HBe_P-B of FT:mat_peptide JQ040128_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYXEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|JQ040157_HBe_P-B Product feature CHAIN JQ040157_HBe_P-B of FT:mat_peptide JQ040157_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTXXALYREALEXPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040169_HBe_P-B Product feature CHAIN JQ040169_HBe_P-B of FT:mat_peptide JQ040169_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G237). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040170_HBe_P-B Product feature CHAIN JQ040170_HBe_P-B of FT:mat_peptide JQ040170_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040171_HBe_P-B Product feature CHAIN JQ040171_HBe_P-B of FT:mat_peptide JQ040171_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPXRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040173_HBe_P-B Product feature CHAIN JQ040173_HBe_P-B of FT:mat_peptide JQ040173_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341459_HBe_P-B Product feature CHAIN JQ341459_HBe_P-B of FT:mat_peptide JQ341459_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341460_HBe_P-B Product feature CHAIN JQ341460_HBe_P-B of FT:mat_peptide JQ341460_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341461_HBe_P-B Product feature CHAIN JQ341461_HBe_P-B of FT:mat_peptide JQ341461_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341462_HBe_P-B Product feature CHAIN JQ341462_HBe_P-B of FT:mat_peptide JQ341462_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFXASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQXAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341463_HBe_P-B Product feature CHAIN JQ341463_HBe_P-B of FT:mat_peptide JQ341463_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSXXDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPA
YRPQXAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341464_HBe_P-B Product feature CHAIN JQ341464_HBe_P-B of FT:mat_peptide JQ341464_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQXRESQC
>gnl|hbvpro|JQ341465_HBe_P-B Product feature CHAIN JQ341465_HBe_P-B of FT:mat_peptide JQ341465_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341467_HBe_P-B Product feature CHAIN JQ341467_HBe_P-B of FT:mat_peptide JQ341467_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPH
HTALRQAIXCWGEXMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRXRSQSRESQC
>gnl|hbvpro|JQ341468_HBe_P-B Product feature CHAIN JQ341468_HBe_P-B of FT:mat_peptide JQ341468_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPSSRELVVGYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPAXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341470_HBe_P-B Product feature CHAIN JQ341470_HBe_P-B of FT:mat_peptide JQ341470_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAXLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341473_HBe_P-B Product feature CHAIN JQ341473_HBe_P-B of FT:mat_peptide JQ341473_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341475_HBe_P-B Product feature CHAIN JQ341475_HBe_P-B of FT:mat_peptide JQ341475_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESQEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ341477_HBe_P-B Product feature CHAIN JQ341477_HBe_P-B of FT:mat_peptide JQ341477_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341479_HBe_P-B Product feature CHAIN JQ341479_HBe_P-B of FT:mat_peptide JQ341479_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPQXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ341481_HBe_P-B Product feature CHAIN JQ341481_HBe_P-B of FT:mat_peptide JQ341481_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341482_HBe_P-B Product feature CHAIN JQ341482_HBe_P-B of FT:mat_peptide JQ341482_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALXSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341483_HBe_P-B Product feature CHAIN JQ341483_HBe_P-B of FT:mat_peptide JQ341483_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRXGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341484_HBe_P-B Product feature CHAIN JQ341484_HBe_P-B of FT:mat_peptide JQ341484_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ341485_HBe_P-B Product feature CHAIN JQ341485_HBe_P-B of FT:mat_peptide JQ341485_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341486_HBe_P-B Product feature CHAIN JQ341486_HBe_P-B of FT:mat_peptide JQ341486_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDSASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQXAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ341487_HBe_P-B Product feature CHAIN JQ341487_HBe_P-B of FT:mat_peptide JQ341487_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPA
YRPXXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341489_HBe_P-B Product feature CHAIN JQ341489_HBe_P-B of FT:mat_peptide JQ341489_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPA
YRPXXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341490_HBe_P-B Product feature CHAIN JQ341490_HBe_P-B of FT:mat_peptide JQ341490_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ341491_HBe_P-B Product feature CHAIN JQ341491_HBe_P-B of FT:mat_peptide JQ341491_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQXAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341493_HBe_P-B Product feature CHAIN JQ341493_HBe_P-B of FT:mat_peptide JQ341493_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPH
HTAXRQAILCWGELMNLAXWVGXNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQXAPILSTLPETTVVRQRGRSXRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ341494_HBe_P-B Product feature CHAIN JQ341494_HBe_P-B of FT:mat_peptide JQ341494_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQX
>gnl|hbvpro|JQ341496_HBe_P-B Product feature CHAIN JQ341496_HBe_P-B of FT:mat_peptide JQ341496_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341497_HBe_P-B Product feature CHAIN JQ341497_HBe_P-B of FT:mat_peptide JQ341497_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRZTVLEYLVSFGVWIRTPPA
YRPXXAPILSTLPETTVVRXRGRXPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341499_HBe_P-B Product feature CHAIN JQ341499_HBe_P-B of FT:mat_peptide JQ341499_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASXELLSFLPSDFYPSIRDLLDTASALYREALESPEHXTPH
HTALRQAILCWGELMNLATWVGSNLEDPXSREXVVSYVNVNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQXAPILSTLPETTVIRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341502_HBe_P-B Product feature CHAIN JQ341502_HBe_P-B of FT:mat_peptide JQ341502_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPXXAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ341504_HBe_P-B Product feature CHAIN JQ341504_HBe_P-B of FT:mat_peptide JQ341504_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGXNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPA
YRPXXAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341510_HBe_P-B Product feature CHAIN JQ341510_HBe_P-B of FT:mat_peptide JQ341510_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JQ341515_HBe_P-B Product feature CHAIN JQ341515_HBe_P-B of FT:mat_peptide JQ341515_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cgeno12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEXPASRELXVSYVNVNMGLKXRQXLWFHISCLTFGXXTVLEYLVSFGVWIRTPXA
YRPPXAPILSTLPETTVVRXRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341530_HBe_P-B Product feature CHAIN JQ341530_HBe_P-B of FT:mat_peptide JQ341530_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cgeno39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ429081_HBe_P-B Product feature CHAIN JQ429081_HBe_P-B of FT:mat_peptide JQ429081_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ688405_HBe_P-B Product feature CHAIN JQ688405_HBe_P-B of FT:mat_peptide JQ688405_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707734_HBe_P-B Product feature CHAIN JQ707734_HBe_P-B of FT:mat_peptide JQ707734_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707737_HBe_P-B Product feature CHAIN JQ707737_HBe_P-B of FT:mat_peptide JQ707737_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707738_HBe_P-B Product feature CHAIN JQ707738_HBe_P-B of FT:mat_peptide JQ707738_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707739_HBe_P-B Product feature CHAIN JQ707739_HBe_P-B of FT:mat_peptide JQ707739_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707742_HBe_P-B Product feature CHAIN JQ707742_HBe_P-B of FT:mat_peptide JQ707742_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707743_HBe_P-B Product feature CHAIN JQ707743_HBe_P-B of FT:mat_peptide JQ707743_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707744_HBe_P-B Product feature CHAIN JQ707744_HBe_P-B of FT:mat_peptide JQ707744_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASTLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707747_HBe_P-B Product feature CHAIN JQ707747_HBe_P-B of FT:mat_peptide JQ707747_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707749_HBe_P-B Product feature CHAIN JQ707749_HBe_P-B of FT:mat_peptide JQ707749_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707750_HBe_P-B Product feature CHAIN JQ707750_HBe_P-B of FT:mat_peptide JQ707750_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707755_HBe_P-B Product feature CHAIN JQ707755_HBe_P-B of FT:mat_peptide JQ707755_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707758_HBe_P-B Product feature CHAIN JQ707758_HBe_P-B of FT:mat_peptide JQ707758_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707759_HBe_P-B Product feature CHAIN JQ707759_HBe_P-B of FT:mat_peptide JQ707759_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707763_HBe_P-B Product feature CHAIN JQ707763_HBe_P-B of FT:mat_peptide JQ707763_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707764_HBe_P-B Product feature CHAIN JQ707764_HBe_P-B of FT:mat_peptide JQ707764_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707765_HBe_P-B Product feature CHAIN JQ707765_HBe_P-B of FT:mat_peptide JQ707765_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707767_HBe_P-B Product feature CHAIN JQ707767_HBe_P-B of FT:mat_peptide JQ707767_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801471_HBe_P-B Product feature CHAIN JQ801471_HBe_P-B of FT:mat_peptide JQ801471_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801479_HBe_P-B Product feature CHAIN JQ801479_HBe_P-B of FT:mat_peptide JQ801479_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801507_HBe_P-B Product feature CHAIN JQ801507_HBe_P-B of FT:mat_peptide JQ801507_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801512_HBe_P-B Product feature CHAIN JQ801512_HBe_P-B of FT:mat_peptide JQ801512_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801514_HBe_P-B Product feature CHAIN JQ801514_HBe_P-B of FT:mat_peptide JQ801514_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026879_HBe_P-B Product feature CHAIN JX026879_HBe_P-B of FT:mat_peptide JX026879_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFFFLPSDFFPSIRDLLDTASALYQEALESPEHCS
PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLSWFHISCLTFGRETVLEYLVSFGVWIRTP
PAYRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429897_HBe_P-B Product feature CHAIN JX429897_HBe_P-B of FT:mat_peptide JX429897_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAPALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429899_HBe_P-B Product feature CHAIN JX429899_HBe_P-B of FT:mat_peptide JX429899_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPVSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429902_HBe_P-B Product feature CHAIN JX429902_HBe_P-B of FT:mat_peptide JX429902_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429908_HBe_P-B Product feature CHAIN JX429908_HBe_P-B of FT:mat_peptide JX429908_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|JX429910_HBe_P-B Product feature CHAIN JX429910_HBe_P-B of FT:mat_peptide JX429910_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-67). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|JX429911_HBe_P-B Product feature CHAIN JX429911_HBe_P-B of FT:mat_peptide JX429911_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-45). Non-functional genomic sequence. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFFLPSDFFPSIRDLLDTASALYQEALESPEHCSP
HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLSWFHISCLTFGRETVLEYLVSFGVWIRTPP
AYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQLPRRRRSQSRESQCQ
>gnl|hbvpro|JX504538_HBe_P-B Product feature CHAIN JX504538_HBe_P-B of FT:mat_peptide JX504538_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-65). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507210_HBe_P-B Product feature CHAIN JX507210_HBe_P-B of FT:mat_peptide JX507210_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSLLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507213_HBe_P-B Product feature CHAIN JX507213_HBe_P-B of FT:mat_peptide JX507213_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 82). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPH
HTAHRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507215_HBe_P-B Product feature CHAIN JX507215_HBe_P-B of FT:mat_peptide JX507215_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 310). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661470_HBe_P-B Product feature CHAIN JX661470_HBe_P-B of FT:mat_peptide JX661470_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1221-B12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661471_HBe_P-B Product feature CHAIN JX661471_HBe_P-B of FT:mat_peptide JX661471_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1202-B1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661472_HBe_P-B Product feature CHAIN JX661472_HBe_P-B of FT:mat_peptide JX661472_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1224-B13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661473_HBe_P-B Product feature CHAIN JX661473_HBe_P-B of FT:mat_peptide JX661473_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1220-B11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661474_HBe_P-B Product feature CHAIN JX661474_HBe_P-B of FT:mat_peptide JX661474_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1229-B15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661475_HBe_P-B Product feature CHAIN JX661475_HBe_P-B of FT:mat_peptide JX661475_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1216-B9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661476_HBe_P-B Product feature CHAIN JX661476_HBe_P-B of FT:mat_peptide JX661476_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1227-B14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVHTRKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661477_HBe_P-B Product feature CHAIN JX661477_HBe_P-B of FT:mat_peptide JX661477_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1209-B5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQALQLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661478_HBe_P-B Product feature CHAIN JX661478_HBe_P-B of FT:mat_peptide JX661478_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1211-B7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661479_HBe_P-B Product feature CHAIN JX661479_HBe_P-B of FT:mat_peptide JX661479_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1219-B10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASQLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661480_HBe_P-B Product feature CHAIN JX661480_HBe_P-B of FT:mat_peptide JX661480_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1210-B6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661481_HBe_P-B Product feature CHAIN JX661481_HBe_P-B of FT:mat_peptide JX661481_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1214-B8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661482_HBe_P-B Product feature CHAIN JX661482_HBe_P-B of FT:mat_peptide JX661482_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1204-B2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHVSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661483_HBe_P-B Product feature CHAIN JX661483_HBe_P-B of FT:mat_peptide JX661483_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1205-B3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHVSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661484_HBe_P-B Product feature CHAIN JX661484_HBe_P-B of FT:mat_peptide JX661484_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1206-B4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX869998_HBe_P-B Product feature CHAIN JX869998_HBe_P-B of FT:mat_peptide JX869998_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 317). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGEFMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX869999_HBe_P-B Product feature CHAIN JX869999_HBe_P-B of FT:mat_peptide JX869999_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX978431_HBe_P-B Product feature CHAIN JX978431_HBe_P-B of FT:mat_peptide JX978431_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate X02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510641_HBe_P-B Product feature CHAIN KC510641_HBe_P-B of FT:mat_peptide KC510641_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510642_HBe_P-B Product feature CHAIN KC510642_HBe_P-B of FT:mat_peptide KC510642_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
PRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510643_HBe_P-B Product feature CHAIN KC510643_HBe_P-B of FT:mat_peptide KC510643_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510646_HBe_P-B Product feature CHAIN KC510646_HBe_P-B of FT:mat_peptide KC510646_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
PWIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510647_HBe_P-B Product feature CHAIN KC510647_HBe_P-B of FT:mat_peptide KC510647_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510648_HBe_P-B Product feature CHAIN KC510648_HBe_P-B of FT:mat_peptide KC510648_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510649_HBe_P-B Product feature CHAIN KC510649_HBe_P-B of FT:mat_peptide KC510649_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510650_HBe_P-B Product feature CHAIN KC510650_HBe_P-B of FT:mat_peptide KC510650_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510651_HBe_P-B Product feature CHAIN KC510651_HBe_P-B of FT:mat_peptide KC510651_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510652_HBe_P-B Product feature CHAIN KC510652_HBe_P-B of FT:mat_peptide KC510652_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510653_HBe_P-B Product feature CHAIN KC510653_HBe_P-B of FT:mat_peptide KC510653_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510654_HBe_P-B Product feature CHAIN KC510654_HBe_P-B of FT:mat_peptide KC510654_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510655_HBe_P-B Product feature CHAIN KC510655_HBe_P-B of FT:mat_peptide KC510655_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510656_HBe_P-B Product feature CHAIN KC510656_HBe_P-B of FT:mat_peptide KC510656_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510657_HBe_P-B Product feature CHAIN KC510657_HBe_P-B of FT:mat_peptide KC510657_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510658_HBe_P-B Product feature CHAIN KC510658_HBe_P-B of FT:mat_peptide KC510658_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510659_HBe_P-B Product feature CHAIN KC510659_HBe_P-B of FT:mat_peptide KC510659_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC510660_HBe_P-B Product feature CHAIN KC510660_HBe_P-B of FT:mat_peptide KC510660_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774362_HBe_P-B Product feature CHAIN KC774362_HBe_P-B of FT:mat_peptide KC774362_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz1107). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774363_HBe_P-B Product feature CHAIN KC774363_HBe_P-B of FT:mat_peptide KC774363_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2022). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774366_HBe_P-B Product feature CHAIN KC774366_HBe_P-B of FT:mat_peptide KC774366_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2116). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774368_HBe_P-B Product feature CHAIN KC774368_HBe_P-B of FT:mat_peptide KC774368_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1012). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KC774369_HBe_P-B Product feature CHAIN KC774369_HBe_P-B of FT:mat_peptide KC774369_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1013). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774370_HBe_P-B Product feature CHAIN KC774370_HBe_P-B of FT:mat_peptide KC774370_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1014). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSHSRESQC
>gnl|hbvpro|KC774372_HBe_P-B Product feature CHAIN KC774372_HBe_P-B of FT:mat_peptide KC774372_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1040). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774374_HBe_P-B Product feature CHAIN KC774374_HBe_P-B of FT:mat_peptide KC774374_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1053). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774375_HBe_P-B Product feature CHAIN KC774375_HBe_P-B of FT:mat_peptide KC774375_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1055). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774376_HBe_P-B Product feature CHAIN KC774376_HBe_P-B of FT:mat_peptide KC774376_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1056). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774378_HBe_P-B Product feature CHAIN KC774378_HBe_P-B of FT:mat_peptide KC774378_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1015). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774380_HBe_P-B Product feature CHAIN KC774380_HBe_P-B of FT:mat_peptide KC774380_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1033). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774381_HBe_P-B Product feature CHAIN KC774381_HBe_P-B of FT:mat_peptide KC774381_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1062). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774382_HBe_P-B Product feature CHAIN KC774382_HBe_P-B of FT:mat_peptide KC774382_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1063). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774384_HBe_P-B Product feature CHAIN KC774384_HBe_P-B of FT:mat_peptide KC774384_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1091). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774386_HBe_P-B Product feature CHAIN KC774386_HBe_P-B of FT:mat_peptide KC774386_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1101). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774387_HBe_P-B Product feature CHAIN KC774387_HBe_P-B of FT:mat_peptide KC774387_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1104). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774388_HBe_P-B Product feature CHAIN KC774388_HBe_P-B of FT:mat_peptide KC774388_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1116). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774390_HBe_P-B Product feature CHAIN KC774390_HBe_P-B of FT:mat_peptide KC774390_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2158). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774392_HBe_P-B Product feature CHAIN KC774392_HBe_P-B of FT:mat_peptide KC774392_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2169). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774393_HBe_P-B Product feature CHAIN KC774393_HBe_P-B of FT:mat_peptide KC774393_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1068). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774394_HBe_P-B Product feature CHAIN KC774394_HBe_P-B of FT:mat_peptide KC774394_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1070). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774396_HBe_P-B Product feature CHAIN KC774396_HBe_P-B of FT:mat_peptide KC774396_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1182). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774398_HBe_P-B Product feature CHAIN KC774398_HBe_P-B of FT:mat_peptide KC774398_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1202). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774399_HBe_P-B Product feature CHAIN KC774399_HBe_P-B of FT:mat_peptide KC774399_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1556). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774401_HBe_P-B Product feature CHAIN KC774401_HBe_P-B of FT:mat_peptide KC774401_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1663). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774403_HBe_P-B Product feature CHAIN KC774403_HBe_P-B of FT:mat_peptide KC774403_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774404_HBe_P-B Product feature CHAIN KC774404_HBe_P-B of FT:mat_peptide KC774404_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2004). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774406_HBe_P-B Product feature CHAIN KC774406_HBe_P-B of FT:mat_peptide KC774406_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2009). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774408_HBe_P-B Product feature CHAIN KC774408_HBe_P-B of FT:mat_peptide KC774408_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2012). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774409_HBe_P-B Product feature CHAIN KC774409_HBe_P-B of FT:mat_peptide KC774409_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2013). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774411_HBe_P-B Product feature CHAIN KC774411_HBe_P-B of FT:mat_peptide KC774411_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2025). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774413_HBe_P-B Product feature CHAIN KC774413_HBe_P-B of FT:mat_peptide KC774413_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2037). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774416_HBe_P-B Product feature CHAIN KC774416_HBe_P-B of FT:mat_peptide KC774416_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1016). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774418_HBe_P-B Product feature CHAIN KC774418_HBe_P-B of FT:mat_peptide KC774418_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1055). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774419_HBe_P-B Product feature CHAIN KC774419_HBe_P-B of FT:mat_peptide KC774419_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1083). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836830_HBe_P-B Product feature CHAIN KC836830_HBe_P-B of FT:mat_peptide KC836830_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836841_HBe_P-B Product feature CHAIN KC836841_HBe_P-B of FT:mat_peptide KC836841_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836843_HBe_P-B Product feature CHAIN KC836843_HBe_P-B of FT:mat_peptide KC836843_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836853_HBe_P-B Product feature CHAIN KC836853_HBe_P-B of FT:mat_peptide KC836853_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836857_HBe_P-B Product feature CHAIN KC836857_HBe_P-B of FT:mat_peptide KC836857_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH37). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836861_HBe_P-B Product feature CHAIN KC836861_HBe_P-B of FT:mat_peptide KC836861_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836863_HBe_P-B Product feature CHAIN KC836863_HBe_P-B of FT:mat_peptide KC836863_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836864_HBe_P-B Product feature CHAIN KC836864_HBe_P-B of FT:mat_peptide KC836864_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836865_HBe_P-B Product feature CHAIN KC836865_HBe_P-B of FT:mat_peptide KC836865_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH49). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836872_HBe_P-B Product feature CHAIN KC836872_HBe_P-B of FT:mat_peptide KC836872_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH58). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836874_HBe_P-B Product feature CHAIN KC836874_HBe_P-B of FT:mat_peptide KC836874_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AH60). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF164967_HBe_P-B Product feature CHAIN KF164967_HBe_P-B of FT:mat_peptide KF164967_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 122). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF165328_HBe_P-B Product feature CHAIN KF165328_HBe_P-B of FT:mat_peptide KF165328_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1702). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF165906_HBe_P-B Product feature CHAIN KF165906_HBe_P-B of FT:mat_peptide KF165906_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2865). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILPTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KJ173297_HBe_P-B Product feature CHAIN KJ173297_HBe_P-B of FT:mat_peptide KJ173297_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008C(e46n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173298_HBe_P-B Product feature CHAIN KJ173298_HBe_P-B of FT:mat_peptide KJ173298_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008M(e47)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173339_HBe_P-B Product feature CHAIN KJ173339_HBe_P-B of FT:mat_peptide KJ173339_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001C(e201)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173340_HBe_P-B Product feature CHAIN KJ173340_HBe_P-B of FT:mat_peptide KJ173340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001M(e202)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173341_HBe_P-B Product feature CHAIN KJ173341_HBe_P-B of FT:mat_peptide KJ173341_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003C(e204)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173342_HBe_P-B Product feature CHAIN KJ173342_HBe_P-B of FT:mat_peptide KJ173342_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003M(e205)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173343_HBe_P-B Product feature CHAIN KJ173343_HBe_P-B of FT:mat_peptide KJ173343_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX007C(e211)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173345_HBe_P-B Product feature CHAIN KJ173345_HBe_P-B of FT:mat_peptide KJ173345_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX008C(e214)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173347_HBe_P-B Product feature CHAIN KJ173347_HBe_P-B of FT:mat_peptide KJ173347_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012C(e220)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173348_HBe_P-B Product feature CHAIN KJ173348_HBe_P-B of FT:mat_peptide KJ173348_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012M(e221)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTGQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173351_HBe_P-B Product feature CHAIN KJ173351_HBe_P-B of FT:mat_peptide KJ173351_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025C(e234)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173352_HBe_P-B Product feature CHAIN KJ173352_HBe_P-B of FT:mat_peptide KJ173352_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025M(e235n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173353_HBe_P-B Product feature CHAIN KJ173353_HBe_P-B of FT:mat_peptide KJ173353_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027C(e237)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173354_HBe_P-B Product feature CHAIN KJ173354_HBe_P-B of FT:mat_peptide KJ173354_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027M(e235n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173355_HBe_P-B Product feature CHAIN KJ173355_HBe_P-B of FT:mat_peptide KJ173355_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032C(e247n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173356_HBe_P-B Product feature CHAIN KJ173356_HBe_P-B of FT:mat_peptide KJ173356_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032M(e248n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173357_HBe_P-B Product feature CHAIN KJ173357_HBe_P-B of FT:mat_peptide KJ173357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX065C(e313)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173359_HBe_P-B Product feature CHAIN KJ173359_HBe_P-B of FT:mat_peptide KJ173359_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161C(m162)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173360_HBe_P-B Product feature CHAIN KJ173360_HBe_P-B of FT:mat_peptide KJ173360_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161M(m161)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173361_HBe_P-B Product feature CHAIN KJ173361_HBe_P-B of FT:mat_peptide KJ173361_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041C(m42)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173363_HBe_P-B Product feature CHAIN KJ173363_HBe_P-B of FT:mat_peptide KJ173363_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-C(006)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173364_HBe_P-B Product feature CHAIN KJ173364_HBe_P-B of FT:mat_peptide KJ173364_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-M(007)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173365_HBe_P-B Product feature CHAIN KJ173365_HBe_P-B of FT:mat_peptide KJ173365_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-C(009)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173366_HBe_P-B Product feature CHAIN KJ173366_HBe_P-B of FT:mat_peptide KJ173366_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-M(011)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173367_HBe_P-B Product feature CHAIN KJ173367_HBe_P-B of FT:mat_peptide KJ173367_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-C(B1)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173369_HBe_P-B Product feature CHAIN KJ173369_HBe_P-B of FT:mat_peptide KJ173369_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-C(B37)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173370_HBe_P-B Product feature CHAIN KJ173370_HBe_P-B of FT:mat_peptide KJ173370_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-M(B39)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173373_HBe_P-B Product feature CHAIN KJ173373_HBe_P-B of FT:mat_peptide KJ173373_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-C1(147a)). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTALTTRQPLWFDISCVTFGRETVREYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173374_HBe_P-B Product feature CHAIN KJ173374_HBe_P-B of FT:mat_peptide KJ173374_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-M(B149)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173375_HBe_P-B Product feature CHAIN KJ173375_HBe_P-B of FT:mat_peptide KJ173375_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004C(e107)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173376_HBe_P-B Product feature CHAIN KJ173376_HBe_P-B of FT:mat_peptide KJ173376_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004M(e108)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173379_HBe_P-B Product feature CHAIN KJ173379_HBe_P-B of FT:mat_peptide KJ173379_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019C(e121)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173381_HBe_P-B Product feature CHAIN KJ173381_HBe_P-B of FT:mat_peptide KJ173381_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-C(FY137Cn).fas). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173382_HBe_P-B Product feature CHAIN KJ173382_HBe_P-B of FT:mat_peptide KJ173382_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137An).fas). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173386_HBe_P-B Product feature CHAIN KJ173386_HBe_P-B of FT:mat_peptide KJ173386_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-C(m604)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173387_HBe_P-B Product feature CHAIN KJ173387_HBe_P-B of FT:mat_peptide KJ173387_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-M(m607)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173388_HBe_P-B Product feature CHAIN KJ173388_HBe_P-B of FT:mat_peptide KJ173388_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-C(m608)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173389_HBe_P-B Product feature CHAIN KJ173389_HBe_P-B of FT:mat_peptide KJ173389_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-M(m617)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173390_HBe_P-B Product feature CHAIN KJ173390_HBe_P-B of FT:mat_peptide KJ173390_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-C(m618)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173397_HBe_P-B Product feature CHAIN KJ173397_HBe_P-B of FT:mat_peptide KJ173397_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-M(134A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173398_HBe_P-B Product feature CHAIN KJ173398_HBe_P-B of FT:mat_peptide KJ173398_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-C(134B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173399_HBe_P-B Product feature CHAIN KJ173399_HBe_P-B of FT:mat_peptide KJ173399_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-M(4161A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173400_HBe_P-B Product feature CHAIN KJ173400_HBe_P-B of FT:mat_peptide KJ173400_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-C(4230B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173401_HBe_P-B Product feature CHAIN KJ173401_HBe_P-B of FT:mat_peptide KJ173401_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-M(6720A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173402_HBe_P-B Product feature CHAIN KJ173402_HBe_P-B of FT:mat_peptide KJ173402_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-C(3733B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173403_HBe_P-B Product feature CHAIN KJ173403_HBe_P-B of FT:mat_peptide KJ173403_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-M(6641M)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173404_HBe_P-B Product feature CHAIN KJ173404_HBe_P-B of FT:mat_peptide KJ173404_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-C(3953B)). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173405_HBe_P-B Product feature CHAIN KJ173405_HBe_P-B of FT:mat_peptide KJ173405_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-M(6642A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173406_HBe_P-B Product feature CHAIN KJ173406_HBe_P-B of FT:mat_peptide KJ173406_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-C(3965B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173407_HBe_P-B Product feature CHAIN KJ173407_HBe_P-B of FT:mat_peptide KJ173407_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-M(6650A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173408_HBe_P-B Product feature CHAIN KJ173408_HBe_P-B of FT:mat_peptide KJ173408_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-C(4198B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173409_HBe_P-B Product feature CHAIN KJ173409_HBe_P-B of FT:mat_peptide KJ173409_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-M(6692A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173410_HBe_P-B Product feature CHAIN KJ173410_HBe_P-B of FT:mat_peptide KJ173410_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-C(4171B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173411_HBe_P-B Product feature CHAIN KJ173411_HBe_P-B of FT:mat_peptide KJ173411_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-M(6579A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173412_HBe_P-B Product feature CHAIN KJ173412_HBe_P-B of FT:mat_peptide KJ173412_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-C(4159b)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173413_HBe_P-B Product feature CHAIN KJ173413_HBe_P-B of FT:mat_peptide KJ173413_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173414_HBe_P-B Product feature CHAIN KJ173414_HBe_P-B of FT:mat_peptide KJ173414_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_C(FY137B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173415_HBe_P-B Product feature CHAIN KJ173415_HBe_P-B of FT:mat_peptide KJ173415_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-V(FY137C)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173416_HBe_P-B Product feature CHAIN KJ173416_HBe_P-B of FT:mat_peptide KJ173416_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201M(e401)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173417_HBe_P-B Product feature CHAIN KJ173417_HBe_P-B of FT:mat_peptide KJ173417_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201C(e402)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173418_HBe_P-B Product feature CHAIN KJ173418_HBe_P-B of FT:mat_peptide KJ173418_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N202M(e403)). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173419_HBe_P-B Product feature CHAIN KJ173419_HBe_P-B of FT:mat_peptide KJ173419_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N202C(e404)). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173420_HBe_P-B Product feature CHAIN KJ173420_HBe_P-B of FT:mat_peptide KJ173420_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203M(e405)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173421_HBe_P-B Product feature CHAIN KJ173421_HBe_P-B of FT:mat_peptide KJ173421_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203C(e406)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173422_HBe_P-B Product feature CHAIN KJ173422_HBe_P-B of FT:mat_peptide KJ173422_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204M(e407)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173423_HBe_P-B Product feature CHAIN KJ173423_HBe_P-B of FT:mat_peptide KJ173423_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204C(e408)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173424_HBe_P-B Product feature CHAIN KJ173424_HBe_P-B of FT:mat_peptide KJ173424_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205M(e409)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173425_HBe_P-B Product feature CHAIN KJ173425_HBe_P-B of FT:mat_peptide KJ173425_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205C(e410)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410490_HBe_P-B Product feature CHAIN KJ410490_HBe_P-B of FT:mat_peptide KJ410490_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HK_1329). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KJ410507_HBe_P-B Product feature CHAIN KJ410507_HBe_P-B of FT:mat_peptide KJ410507_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK6840). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410516_HBe_P-B Product feature CHAIN KJ410516_HBe_P-B of FT:mat_peptide KJ410516_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4777). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410517_HBe_P-B Product feature CHAIN KJ410517_HBe_P-B of FT:mat_peptide KJ410517_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4901). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803752_HBe_P-B Product feature CHAIN KJ803752_HBe_P-B of FT:mat_peptide KJ803752_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY155693). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRCRSPRRRTPSPRRQRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803763_HBe_P-B Product feature CHAIN KJ803763_HBe_P-B of FT:mat_peptide KJ803763_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY790800). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803764_HBe_P-B Product feature CHAIN KJ803764_HBe_P-B of FT:mat_peptide KJ803764_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY043147). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRQRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803781_HBe_P-B Product feature CHAIN KJ803781_HBe_P-B of FT:mat_peptide KJ803781_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY799421). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNDNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803783_HBe_P-B Product feature CHAIN KJ803783_HBe_P-B of FT:mat_peptide KJ803783_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY266289). Complete genome. [Hepadnaviridae] (length=212 residues).
MQHFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803784_HBe_P-B Product feature CHAIN KJ803784_HBe_P-B of FT:mat_peptide KJ803784_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY781114). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803787_HBe_P-B Product feature CHAIN KJ803787_HBe_P-B of FT:mat_peptide KJ803787_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY853571). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPLRRRSQSRESQC
>gnl|hbvpro|KJ803795_HBe_P-B Product feature CHAIN KJ803795_HBe_P-B of FT:mat_peptide KJ803795_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY789421). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGLKIRQLLWFQISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803796_HBe_P-B Product feature CHAIN KJ803796_HBe_P-B of FT:mat_peptide KJ803796_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY711763). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGLKIRQLLWFHISCLTFGIETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KJ803797_HBe_P-B Product feature CHAIN KJ803797_HBe_P-B of FT:mat_peptide KJ803797_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY775775). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCRDALESPEHVSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRTQSPLRRRSQSRESQS
>gnl|hbvpro|KJ803817_HBe_P-B Product feature CHAIN KJ803817_HBe_P-B of FT:mat_peptide KJ803817_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY241913). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ843165_HBe_P-B Product feature CHAIN KJ843165_HBe_P-B of FT:mat_peptide KJ843165_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ag03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM213034_HBe_P-B Product feature CHAIN KM213034_HBe_P-B of FT:mat_peptide KM213034_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYG-k1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KM359440_HBe_P-B Product feature CHAIN KM359440_HBe_P-B of FT:mat_peptide KM359440_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FF3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM392072_HBe_P-B Product feature CHAIN KM392072_HBe_P-B of FT:mat_peptide KM392072_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFDLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM392083_HBe_P-B Product feature CHAIN KM392083_HBe_P-B of FT:mat_peptide KM392083_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V41). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM392084_HBe_P-B Product feature CHAIN KM392084_HBe_P-B of FT:mat_peptide KM392084_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V42). Non-functional genomic sequence. [Hepadnaviridae] (length=211 residues).
QIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHH
TALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAY
RPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRXRSQSRESQC
>gnl|hbvpro|KM875426_HBe_P-B Product feature CHAIN KM875426_HBe_P-B of FT:mat_peptide KM875426_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt14N). Non-functional genomic sequence. [Hepadnaviridae] (length=213 residues).
MQLFLHLCLSISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSP
HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPP
AYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP036970_HBe_P-B Product feature CHAIN KP036970_HBe_P-B of FT:mat_peptide KP036970_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-YA). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP148317_HBe_P-B Product feature CHAIN KP148317_HBe_P-B of FT:mat_peptide KP148317_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148318_HBe_P-B Product feature CHAIN KP148318_HBe_P-B of FT:mat_peptide KP148318_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148319_HBe_P-B Product feature CHAIN KP148319_HBe_P-B of FT:mat_peptide KP148319_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148320_HBe_P-B Product feature CHAIN KP148320_HBe_P-B of FT:mat_peptide KP148320_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148321_HBe_P-B Product feature CHAIN KP148321_HBe_P-B of FT:mat_peptide KP148321_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148322_HBe_P-B Product feature CHAIN KP148322_HBe_P-B of FT:mat_peptide KP148322_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148323_HBe_P-B Product feature CHAIN KP148323_HBe_P-B of FT:mat_peptide KP148323_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP148324_HBe_P-B Product feature CHAIN KP148324_HBe_P-B of FT:mat_peptide KP148324_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148325_HBe_P-B Product feature CHAIN KP148325_HBe_P-B of FT:mat_peptide KP148325_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148326_HBe_P-B Product feature CHAIN KP148326_HBe_P-B of FT:mat_peptide KP148326_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-27). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148327_HBe_P-B Product feature CHAIN KP148327_HBe_P-B of FT:mat_peptide KP148327_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-41). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148328_HBe_P-B Product feature CHAIN KP148328_HBe_P-B of FT:mat_peptide KP148328_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-94). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148330_HBe_P-B Product feature CHAIN KP148330_HBe_P-B of FT:mat_peptide KP148330_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-104). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148331_HBe_P-B Product feature CHAIN KP148331_HBe_P-B of FT:mat_peptide KP148331_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-109). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148332_HBe_P-B Product feature CHAIN KP148332_HBe_P-B of FT:mat_peptide KP148332_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-122). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HAALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148333_HBe_P-B Product feature CHAIN KP148333_HBe_P-B of FT:mat_peptide KP148333_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-124). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148334_HBe_P-B Product feature CHAIN KP148334_HBe_P-B of FT:mat_peptide KP148334_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-126). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP148335_HBe_P-B Product feature CHAIN KP148335_HBe_P-B of FT:mat_peptide KP148335_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-130). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCPGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLLETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148336_HBe_P-B Product feature CHAIN KP148336_HBe_P-B of FT:mat_peptide KP148336_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148338_HBe_P-B Product feature CHAIN KP148338_HBe_P-B of FT:mat_peptide KP148338_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148339_HBe_P-B Product feature CHAIN KP148339_HBe_P-B of FT:mat_peptide KP148339_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148340_HBe_P-B Product feature CHAIN KP148340_HBe_P-B of FT:mat_peptide KP148340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148341_HBe_P-B Product feature CHAIN KP148341_HBe_P-B of FT:mat_peptide KP148341_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-7). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQCQ
>gnl|hbvpro|KP148342_HBe_P-B Product feature CHAIN KP148342_HBe_P-B of FT:mat_peptide KP148342_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148343_HBe_P-B Product feature CHAIN KP148343_HBe_P-B of FT:mat_peptide KP148343_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148344_HBe_P-B Product feature CHAIN KP148344_HBe_P-B of FT:mat_peptide KP148344_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148345_HBe_P-B Product feature CHAIN KP148345_HBe_P-B of FT:mat_peptide KP148345_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDIFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLAAWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148346_HBe_P-B Product feature CHAIN KP148346_HBe_P-B of FT:mat_peptide KP148346_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-22). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148347_HBe_P-B Product feature CHAIN KP148347_HBe_P-B of FT:mat_peptide KP148347_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148348_HBe_P-B Product feature CHAIN KP148348_HBe_P-B of FT:mat_peptide KP148348_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148349_HBe_P-B Product feature CHAIN KP148349_HBe_P-B of FT:mat_peptide KP148349_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-26). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148356_HBe_P-B Product feature CHAIN KP148356_HBe_P-B of FT:mat_peptide KP148356_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148357_HBe_P-B Product feature CHAIN KP148357_HBe_P-B of FT:mat_peptide KP148357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148359_HBe_P-B Product feature CHAIN KP148359_HBe_P-B of FT:mat_peptide KP148359_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148360_HBe_P-B Product feature CHAIN KP148360_HBe_P-B of FT:mat_peptide KP148360_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-36). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148361_HBe_P-B Product feature CHAIN KP148361_HBe_P-B of FT:mat_peptide KP148361_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-42). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148362_HBe_P-B Product feature CHAIN KP148362_HBe_P-B of FT:mat_peptide KP148362_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-73). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148363_HBe_P-B Product feature CHAIN KP148363_HBe_P-B of FT:mat_peptide KP148363_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-86). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148364_HBe_P-B Product feature CHAIN KP148364_HBe_P-B of FT:mat_peptide KP148364_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-101). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRALLDTASALYREALESPEHCSPH
HTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148365_HBe_P-B Product feature CHAIN KP148365_HBe_P-B of FT:mat_peptide KP148365_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-106). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148366_HBe_P-B Product feature CHAIN KP148366_HBe_P-B of FT:mat_peptide KP148366_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-110). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPY
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148368_HBe_P-B Product feature CHAIN KP148368_HBe_P-B of FT:mat_peptide KP148368_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148369_HBe_P-B Product feature CHAIN KP148369_HBe_P-B of FT:mat_peptide KP148369_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148370_HBe_P-B Product feature CHAIN KP148370_HBe_P-B of FT:mat_peptide KP148370_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148371_HBe_P-B Product feature CHAIN KP148371_HBe_P-B of FT:mat_peptide KP148371_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148372_HBe_P-B Product feature CHAIN KP148372_HBe_P-B of FT:mat_peptide KP148372_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148373_HBe_P-B Product feature CHAIN KP148373_HBe_P-B of FT:mat_peptide KP148373_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148374_HBe_P-B Product feature CHAIN KP148374_HBe_P-B of FT:mat_peptide KP148374_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148375_HBe_P-B Product feature CHAIN KP148375_HBe_P-B of FT:mat_peptide KP148375_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148376_HBe_P-B Product feature CHAIN KP148376_HBe_P-B of FT:mat_peptide KP148376_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148377_HBe_P-B Product feature CHAIN KP148377_HBe_P-B of FT:mat_peptide KP148377_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148378_HBe_P-B Product feature CHAIN KP148378_HBe_P-B of FT:mat_peptide KP148378_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148379_HBe_P-B Product feature CHAIN KP148379_HBe_P-B of FT:mat_peptide KP148379_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148380_HBe_P-B Product feature CHAIN KP148380_HBe_P-B of FT:mat_peptide KP148380_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148382_HBe_P-B Product feature CHAIN KP148382_HBe_P-B of FT:mat_peptide KP148382_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148383_HBe_P-B Product feature CHAIN KP148383_HBe_P-B of FT:mat_peptide KP148383_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-26). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148384_HBe_P-B Product feature CHAIN KP148384_HBe_P-B of FT:mat_peptide KP148384_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148385_HBe_P-B Product feature CHAIN KP148385_HBe_P-B of FT:mat_peptide KP148385_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148386_HBe_P-B Product feature CHAIN KP148386_HBe_P-B of FT:mat_peptide KP148386_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148387_HBe_P-B Product feature CHAIN KP148387_HBe_P-B of FT:mat_peptide KP148387_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-34). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148388_HBe_P-B Product feature CHAIN KP148388_HBe_P-B of FT:mat_peptide KP148388_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-35). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGALMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148389_HBe_P-B Product feature CHAIN KP148389_HBe_P-B of FT:mat_peptide KP148389_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148390_HBe_P-B Product feature CHAIN KP148390_HBe_P-B of FT:mat_peptide KP148390_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-45). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148391_HBe_P-B Product feature CHAIN KP148391_HBe_P-B of FT:mat_peptide KP148391_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-46). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWGGSNLEDPASRELVVSYVNVNMGQKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148392_HBe_P-B Product feature CHAIN KP148392_HBe_P-B of FT:mat_peptide KP148392_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-47). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVESLSFLPSDFFPPIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148394_HBe_P-B Product feature CHAIN KP148394_HBe_P-B of FT:mat_peptide KP148394_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-50). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPEATVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148395_HBe_P-B Product feature CHAIN KP148395_HBe_P-B of FT:mat_peptide KP148395_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-51). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148396_HBe_P-B Product feature CHAIN KP148396_HBe_P-B of FT:mat_peptide KP148396_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-58). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148397_HBe_P-B Product feature CHAIN KP148397_HBe_P-B of FT:mat_peptide KP148397_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-59). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148398_HBe_P-B Product feature CHAIN KP148398_HBe_P-B of FT:mat_peptide KP148398_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-60). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148400_HBe_P-B Product feature CHAIN KP148400_HBe_P-B of FT:mat_peptide KP148400_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-65). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148401_HBe_P-B Product feature CHAIN KP148401_HBe_P-B of FT:mat_peptide KP148401_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-67). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148402_HBe_P-B Product feature CHAIN KP148402_HBe_P-B of FT:mat_peptide KP148402_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-70). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148403_HBe_P-B Product feature CHAIN KP148403_HBe_P-B of FT:mat_peptide KP148403_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-71). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148405_HBe_P-B Product feature CHAIN KP148405_HBe_P-B of FT:mat_peptide KP148405_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPV
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148406_HBe_P-B Product feature CHAIN KP148406_HBe_P-B of FT:mat_peptide KP148406_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148407_HBe_P-B Product feature CHAIN KP148407_HBe_P-B of FT:mat_peptide KP148407_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCPPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148409_HBe_P-B Product feature CHAIN KP148409_HBe_P-B of FT:mat_peptide KP148409_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148410_HBe_P-B Product feature CHAIN KP148410_HBe_P-B of FT:mat_peptide KP148410_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-29). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELAVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148411_HBe_P-B Product feature CHAIN KP148411_HBe_P-B of FT:mat_peptide KP148411_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-31). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLYLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148413_HBe_P-B Product feature CHAIN KP148413_HBe_P-B of FT:mat_peptide KP148413_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-38). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILRWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148414_HBe_P-B Product feature CHAIN KP148414_HBe_P-B of FT:mat_peptide KP148414_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-42). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVIMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148418_HBe_P-B Product feature CHAIN KP148418_HBe_P-B of FT:mat_peptide KP148418_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-58). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETIVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148419_HBe_P-B Product feature CHAIN KP148419_HBe_P-B of FT:mat_peptide KP148419_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-65). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148420_HBe_P-B Product feature CHAIN KP148420_HBe_P-B of FT:mat_peptide KP148420_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-66). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCFTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148421_HBe_P-B Product feature CHAIN KP148421_HBe_P-B of FT:mat_peptide KP148421_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-72). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLGTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148423_HBe_P-B Product feature CHAIN KP148423_HBe_P-B of FT:mat_peptide KP148423_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-86). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148424_HBe_P-B Product feature CHAIN KP148424_HBe_P-B of FT:mat_peptide KP148424_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-89). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148425_HBe_P-B Product feature CHAIN KP148425_HBe_P-B of FT:mat_peptide KP148425_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-90). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148427_HBe_P-B Product feature CHAIN KP148427_HBe_P-B of FT:mat_peptide KP148427_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-94). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148429_HBe_P-B Product feature CHAIN KP148429_HBe_P-B of FT:mat_peptide KP148429_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-104). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148430_HBe_P-B Product feature CHAIN KP148430_HBe_P-B of FT:mat_peptide KP148430_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-105). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148433_HBe_P-B Product feature CHAIN KP148433_HBe_P-B of FT:mat_peptide KP148433_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCPPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148435_HBe_P-B Product feature CHAIN KP148435_HBe_P-B of FT:mat_peptide KP148435_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIPCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148438_HBe_P-B Product feature CHAIN KP148438_HBe_P-B of FT:mat_peptide KP148438_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|KP148439_HBe_P-B Product feature CHAIN KP148439_HBe_P-B of FT:mat_peptide KP148439_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148440_HBe_P-B Product feature CHAIN KP148440_HBe_P-B of FT:mat_peptide KP148440_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-26). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP148451_HBe_P-B Product feature CHAIN KP148451_HBe_P-B of FT:mat_peptide KP148451_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y147-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148452_HBe_P-B Product feature CHAIN KP148452_HBe_P-B of FT:mat_peptide KP148452_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148453_HBe_P-B Product feature CHAIN KP148453_HBe_P-B of FT:mat_peptide KP148453_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-20). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLRLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRFQSPRRRRSQSRESQC
>gnl|hbvpro|KP148455_HBe_P-B Product feature CHAIN KP148455_HBe_P-B of FT:mat_peptide KP148455_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148456_HBe_P-B Product feature CHAIN KP148456_HBe_P-B of FT:mat_peptide KP148456_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148457_HBe_P-B Product feature CHAIN KP148457_HBe_P-B of FT:mat_peptide KP148457_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148461_HBe_P-B Product feature CHAIN KP148461_HBe_P-B of FT:mat_peptide KP148461_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-46). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148579_HBe_P-B Product feature CHAIN KP148579_HBe_P-B of FT:mat_peptide KP148579_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDAASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148580_HBe_P-B Product feature CHAIN KP148580_HBe_P-B of FT:mat_peptide KP148580_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-4). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148581_HBe_P-B Product feature CHAIN KP148581_HBe_P-B of FT:mat_peptide KP148581_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSWESQC
>gnl|hbvpro|KP148582_HBe_P-B Product feature CHAIN KP148582_HBe_P-B of FT:mat_peptide KP148582_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-18). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHYSPH
HTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148583_HBe_P-B Product feature CHAIN KP148583_HBe_P-B of FT:mat_peptide KP148583_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-24). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP406170_HBe_P-B Product feature CHAIN KP406170_HBe_P-B of FT:mat_peptide KP406170_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
PYYTHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNDNTGLKIRHLLWFHNSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP659234_HBe_P-B Product feature CHAIN KP659234_HBe_P-B of FT:mat_peptide KP659234_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1500). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLKDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPKRRTPSPRKRKSQSPRRKKSQSRESQC
>gnl|hbvpro|KP659235_HBe_P-B Product feature CHAIN KP659235_HBe_P-B of FT:mat_peptide KP659235_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1602). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPXRRTPSPRRRRSQSPRRXXSQSRESQC
>gnl|hbvpro|KP659237_HBe_P-B Product feature CHAIN KP659237_HBe_P-B of FT:mat_peptide KP659237_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-2456). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP659247_HBe_P-B Product feature CHAIN KP659247_HBe_P-B of FT:mat_peptide KP659247_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-1290). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR152339_HBe_P-B Product feature CHAIN KR152339_HBe_P-B of FT:mat_peptide KR152339_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR232337_HBe_P-B Product feature CHAIN KR232337_HBe_P-B of FT:mat_peptide KR232337_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU234318_HBe_P-B Product feature CHAIN KU234318_HBe_P-B of FT:mat_peptide KU234318_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575921_HBe_P-B Product feature CHAIN KU575921_HBe_P-B of FT:mat_peptide KU575921_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPGSRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575922_HBe_P-B Product feature CHAIN KU575922_HBe_P-B of FT:mat_peptide KU575922_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCRGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQCW
>gnl|hbvpro|KU575927_HBe_P-B Product feature CHAIN KU575927_HBe_P-B of FT:mat_peptide KU575927_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGXSPGRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575928_HBe_P-B Product feature CHAIN KU575928_HBe_P-B of FT:mat_peptide KU575928_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575945_HBe_P-B Product feature CHAIN KU575945_HBe_P-B of FT:mat_peptide KU575945_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575959_HBe_P-B Product feature CHAIN KU575959_HBe_P-B of FT:mat_peptide KU575959_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7-1-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREFFF
>gnl|hbvpro|KU575966_HBe_P-B Product feature CHAIN KU575966_HBe_P-B of FT:mat_peptide KU575966_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILRWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575973_HBe_P-B Product feature CHAIN KU575973_HBe_P-B of FT:mat_peptide KU575973_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575974_HBe_P-B Product feature CHAIN KU575974_HBe_P-B of FT:mat_peptide KU575974_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575976_HBe_P-B Product feature CHAIN KU575976_HBe_P-B of FT:mat_peptide KU575976_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHRSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575977_HBe_P-B Product feature CHAIN KU575977_HBe_P-B of FT:mat_peptide KU575977_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPERCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575978_HBe_P-B Product feature CHAIN KU575978_HBe_P-B of FT:mat_peptide KU575978_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575979_HBe_P-B Product feature CHAIN KU575979_HBe_P-B of FT:mat_peptide KU575979_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNPPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575980_HBe_P-B Product feature CHAIN KU575980_HBe_P-B of FT:mat_peptide KU575980_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575981_HBe_P-B Product feature CHAIN KU575981_HBe_P-B of FT:mat_peptide KU575981_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVVLLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSGELVVNYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQR
>gnl|hbvpro|KU575982_HBe_P-B Product feature CHAIN KU575982_HBe_P-B of FT:mat_peptide KU575982_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLLETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575983_HBe_P-B Product feature CHAIN KU575983_HBe_P-B of FT:mat_peptide KU575983_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPTLSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU575984_HBe_P-B Product feature CHAIN KU575984_HBe_P-B of FT:mat_peptide KU575984_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576015_HBe_P-B Product feature CHAIN KU576015_HBe_P-B of FT:mat_peptide KU576015_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576018_HBe_P-B Product feature CHAIN KU576018_HBe_P-B of FT:mat_peptide KU576018_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576022_HBe_P-B Product feature CHAIN KU576022_HBe_P-B of FT:mat_peptide KU576022_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCPTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576024_HBe_P-B Product feature CHAIN KU576024_HBe_P-B of FT:mat_peptide KU576024_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576026_HBe_P-B Product feature CHAIN KU576026_HBe_P-B of FT:mat_peptide KU576026_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576038_HBe_P-B Product feature CHAIN KU576038_HBe_P-B of FT:mat_peptide KU576038_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576039_HBe_P-B Product feature CHAIN KU576039_HBe_P-B of FT:mat_peptide KU576039_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576041_HBe_P-B Product feature CHAIN KU576041_HBe_P-B of FT:mat_peptide KU576041_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCPPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576042_HBe_P-B Product feature CHAIN KU576042_HBe_P-B of FT:mat_peptide KU576042_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYREFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576043_HBe_P-B Product feature CHAIN KU576043_HBe_P-B of FT:mat_peptide KU576043_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSLH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576045_HBe_P-B Product feature CHAIN KU576045_HBe_P-B of FT:mat_peptide KU576045_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576046_HBe_P-B Product feature CHAIN KU576046_HBe_P-B of FT:mat_peptide KU576046_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576051_HBe_P-B Product feature CHAIN KU576051_HBe_P-B of FT:mat_peptide KU576051_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKAFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576052_HBe_P-B Product feature CHAIN KU576052_HBe_P-B of FT:mat_peptide KU576052_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576053_HBe_P-B Product feature CHAIN KU576053_HBe_P-B of FT:mat_peptide KU576053_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576054_HBe_P-B Product feature CHAIN KU576054_HBe_P-B of FT:mat_peptide KU576054_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16zc-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576069_HBe_P-B Product feature CHAIN KU576069_HBe_P-B of FT:mat_peptide KU576069_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALEAPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRDTVLGYLVSFGVWIRTPPA
YRPPNAPILSTLPEPAVVRCRGRSTRRRTPSPRRRRSRSPRRRRSQSRESQC
>gnl|hbvpro|KU576070_HBe_P-B Product feature CHAIN KU576070_HBe_P-B of FT:mat_peptide KU576070_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALEAPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRDTVLGYLVSFGVWIRTPPA
YRPPNAPILSTLPEPAVVRCRGRSTRRRTPSPRRRRSRSPRRRRSQSRESQC
>gnl|hbvpro|KU576088_HBe_P-B Product feature CHAIN KU576088_HBe_P-B of FT:mat_peptide KU576088_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAFVELLSFLPSDFFPSIRDLLDTASALYRETLESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU576132_HBe_P-B Product feature CHAIN KU576132_HBe_P-B of FT:mat_peptide KU576132_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 27-4-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQASLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576189_HBe_P-B Product feature CHAIN KU576189_HBe_P-B of FT:mat_peptide KU576189_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 36-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLVTWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETIVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576240_HBe_P-B Product feature CHAIN KU576240_HBe_P-B of FT:mat_peptide KU576240_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576288_HBe_P-B Product feature CHAIN KU576288_HBe_P-B of FT:mat_peptide KU576288_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPPIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576295_HBe_P-B Product feature CHAIN KU576295_HBe_P-B of FT:mat_peptide KU576295_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576297_HBe_P-B Product feature CHAIN KU576297_HBe_P-B of FT:mat_peptide KU576297_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576299_HBe_P-B Product feature CHAIN KU576299_HBe_P-B of FT:mat_peptide KU576299_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 53-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPEIAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576300_HBe_P-B Product feature CHAIN KU576300_HBe_P-B of FT:mat_peptide KU576300_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVSVNMGLKLRQLLWFHISCLSFGRDIVLEYLVSFGVWIRIPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576302_HBe_P-B Product feature CHAIN KU576302_HBe_P-B of FT:mat_peptide KU576302_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576303_HBe_P-B Product feature CHAIN KU576303_HBe_P-B of FT:mat_peptide KU576303_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-4). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HAALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLSFGRDIVLEYLVSFGVWIRTPPA
YRPQNVPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576304_HBe_P-B Product feature CHAIN KU576304_HBe_P-B of FT:mat_peptide KU576304_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFPLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRRLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576306_HBe_P-B Product feature CHAIN KU576306_HBe_P-B of FT:mat_peptide KU576306_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRGLVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576307_HBe_P-B Product feature CHAIN KU576307_HBe_P-B of FT:mat_peptide KU576307_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVKRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576308_HBe_P-B Product feature CHAIN KU576308_HBe_P-B of FT:mat_peptide KU576308_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 54-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576309_HBe_P-B Product feature CHAIN KU576309_HBe_P-B of FT:mat_peptide KU576309_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576310_HBe_P-B Product feature CHAIN KU576310_HBe_P-B of FT:mat_peptide KU576310_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576319_HBe_P-B Product feature CHAIN KU576319_HBe_P-B of FT:mat_peptide KU576319_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576320_HBe_P-B Product feature CHAIN KU576320_HBe_P-B of FT:mat_peptide KU576320_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576321_HBe_P-B Product feature CHAIN KU576321_HBe_P-B of FT:mat_peptide KU576321_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576322_HBe_P-B Product feature CHAIN KU576322_HBe_P-B of FT:mat_peptide KU576322_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASELCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
RTALRQAILCWGGLMNLATWVGSNLEDPASRELVVSYVNVNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRGSQSRESQC
>gnl|hbvpro|KU576324_HBe_P-B Product feature CHAIN KU576324_HBe_P-B of FT:mat_peptide KU576324_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576325_HBe_P-B Product feature CHAIN KU576325_HBe_P-B of FT:mat_peptide KU576325_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRKGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576326_HBe_P-B Product feature CHAIN KU576326_HBe_P-B of FT:mat_peptide KU576326_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576327_HBe_P-B Product feature CHAIN KU576327_HBe_P-B of FT:mat_peptide KU576327_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576328_HBe_P-B Product feature CHAIN KU576328_HBe_P-B of FT:mat_peptide KU576328_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576331_HBe_P-B Product feature CHAIN KU576331_HBe_P-B of FT:mat_peptide KU576331_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 58-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHISPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576460_HBe_P-B Product feature CHAIN KU576460_HBe_P-B of FT:mat_peptide KU576460_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 79-3). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576600_HBe_P-B Product feature CHAIN KU576600_HBe_P-B of FT:mat_peptide KU576600_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 99-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSPH
HTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576619_HBe_P-B Product feature CHAIN KU576619_HBe_P-B of FT:mat_peptide KU576619_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576620_HBe_P-B Product feature CHAIN KU576620_HBe_P-B of FT:mat_peptide KU576620_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576623_HBe_P-B Product feature CHAIN KU576623_HBe_P-B of FT:mat_peptide KU576623_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 102-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYGEALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576624_HBe_P-B Product feature CHAIN KU576624_HBe_P-B of FT:mat_peptide KU576624_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 103-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSPH
HTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRDSQC
>gnl|hbvpro|KU576626_HBe_P-B Product feature CHAIN KU576626_HBe_P-B of FT:mat_peptide KU576626_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 103-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDPLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVYFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576629_HBe_P-B Product feature CHAIN KU576629_HBe_P-B of FT:mat_peptide KU576629_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 104-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576630_HBe_P-B Product feature CHAIN KU576630_HBe_P-B of FT:mat_peptide KU576630_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 104-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPGRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576633_HBe_P-B Product feature CHAIN KU576633_HBe_P-B of FT:mat_peptide KU576633_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 105-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576637_HBe_P-B Product feature CHAIN KU576637_HBe_P-B of FT:mat_peptide KU576637_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 106-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDAASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPRC
>gnl|hbvpro|KU576640_HBe_P-B Product feature CHAIN KU576640_HBe_P-B of FT:mat_peptide KU576640_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576641_HBe_P-B Product feature CHAIN KU576641_HBe_P-B of FT:mat_peptide KU576641_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYRGALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU576645_HBe_P-B Product feature CHAIN KU576645_HBe_P-B of FT:mat_peptide KU576645_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576647_HBe_P-B Product feature CHAIN KU576647_HBe_P-B of FT:mat_peptide KU576647_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 107-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLNTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576656_HBe_P-B Product feature CHAIN KU576656_HBe_P-B of FT:mat_peptide KU576656_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 109-2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576681_HBe_P-B Product feature CHAIN KU576681_HBe_P-B of FT:mat_peptide KU576681_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 114-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576691_HBe_P-B Product feature CHAIN KU576691_HBe_P-B of FT:mat_peptide KU576691_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 115-8-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLEWLWDMDIDPYKEFGASAELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSPH
YTALRQAILCWGDLMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576692_HBe_P-B Product feature CHAIN KU576692_HBe_P-B of FT:mat_peptide KU576692_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 116-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSLLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHIPCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576693_HBe_P-B Product feature CHAIN KU576693_HBe_P-B of FT:mat_peptide KU576693_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 116-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576698_HBe_P-B Product feature CHAIN KU576698_HBe_P-B of FT:mat_peptide KU576698_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 116-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576702_HBe_P-B Product feature CHAIN KU576702_HBe_P-B of FT:mat_peptide KU576702_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576703_HBe_P-B Product feature CHAIN KU576703_HBe_P-B of FT:mat_peptide KU576703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWVRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576704_HBe_P-B Product feature CHAIN KU576704_HBe_P-B of FT:mat_peptide KU576704_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576707_HBe_P-B Product feature CHAIN KU576707_HBe_P-B of FT:mat_peptide KU576707_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 117-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576713_HBe_P-B Product feature CHAIN KU576713_HBe_P-B of FT:mat_peptide KU576713_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 118-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYANVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTSAA
YRPPNAPILSTLPETTVVRQRGRTPRRRTLSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576714_HBe_P-B Product feature CHAIN KU576714_HBe_P-B of FT:mat_peptide KU576714_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 118-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576718_HBe_P-B Product feature CHAIN KU576718_HBe_P-B of FT:mat_peptide KU576718_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 118-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVIRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576738_HBe_P-B Product feature CHAIN KU576738_HBe_P-B of FT:mat_peptide KU576738_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 121-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576746_HBe_P-B Product feature CHAIN KU576746_HBe_P-B of FT:mat_peptide KU576746_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 122-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGQETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576748_HBe_P-B Product feature CHAIN KU576748_HBe_P-B of FT:mat_peptide KU576748_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576751_HBe_P-B Product feature CHAIN KU576751_HBe_P-B of FT:mat_peptide KU576751_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576754_HBe_P-B Product feature CHAIN KU576754_HBe_P-B of FT:mat_peptide KU576754_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFRLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMSLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576766_HBe_P-B Product feature CHAIN KU576766_HBe_P-B of FT:mat_peptide KU576766_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 123-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576777_HBe_P-B Product feature CHAIN KU576777_HBe_P-B of FT:mat_peptide KU576777_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576778_HBe_P-B Product feature CHAIN KU576778_HBe_P-B of FT:mat_peptide KU576778_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576780_HBe_P-B Product feature CHAIN KU576780_HBe_P-B of FT:mat_peptide KU576780_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576781_HBe_P-B Product feature CHAIN KU576781_HBe_P-B of FT:mat_peptide KU576781_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576782_HBe_P-B Product feature CHAIN KU576782_HBe_P-B of FT:mat_peptide KU576782_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576783_HBe_P-B Product feature CHAIN KU576783_HBe_P-B of FT:mat_peptide KU576783_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576784_HBe_P-B Product feature CHAIN KU576784_HBe_P-B of FT:mat_peptide KU576784_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576785_HBe_P-B Product feature CHAIN KU576785_HBe_P-B of FT:mat_peptide KU576785_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576788_HBe_P-B Product feature CHAIN KU576788_HBe_P-B of FT:mat_peptide KU576788_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 127-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576793_HBe_P-B Product feature CHAIN KU576793_HBe_P-B of FT:mat_peptide KU576793_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576794_HBe_P-B Product feature CHAIN KU576794_HBe_P-B of FT:mat_peptide KU576794_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 128-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576803_HBe_P-B Product feature CHAIN KU576803_HBe_P-B of FT:mat_peptide KU576803_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576804_HBe_P-B Product feature CHAIN KU576804_HBe_P-B of FT:mat_peptide KU576804_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576806_HBe_P-B Product feature CHAIN KU576806_HBe_P-B of FT:mat_peptide KU576806_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQCQ
>gnl|hbvpro|KU576807_HBe_P-B Product feature CHAIN KU576807_HBe_P-B of FT:mat_peptide KU576807_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTVSALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576808_HBe_P-B Product feature CHAIN KU576808_HBe_P-B of FT:mat_peptide KU576808_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU576809_HBe_P-B Product feature CHAIN KU576809_HBe_P-B of FT:mat_peptide KU576809_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 130-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576843_HBe_P-B Product feature CHAIN KU576843_HBe_P-B of FT:mat_peptide KU576843_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 137-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELINLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576845_HBe_P-B Product feature CHAIN KU576845_HBe_P-B of FT:mat_peptide KU576845_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 137-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFYLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576848_HBe_P-B Product feature CHAIN KU576848_HBe_P-B of FT:mat_peptide KU576848_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 138-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPGRRTPSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|KU576854_HBe_P-B Product feature CHAIN KU576854_HBe_P-B of FT:mat_peptide KU576854_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 138-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576856_HBe_P-B Product feature CHAIN KU576856_HBe_P-B of FT:mat_peptide KU576856_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 139-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDSASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576866_HBe_P-B Product feature CHAIN KU576866_HBe_P-B of FT:mat_peptide KU576866_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576867_HBe_P-B Product feature CHAIN KU576867_HBe_P-B of FT:mat_peptide KU576867_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576868_HBe_P-B Product feature CHAIN KU576868_HBe_P-B of FT:mat_peptide KU576868_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576869_HBe_P-B Product feature CHAIN KU576869_HBe_P-B of FT:mat_peptide KU576869_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576870_HBe_P-B Product feature CHAIN KU576870_HBe_P-B of FT:mat_peptide KU576870_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576871_HBe_P-B Product feature CHAIN KU576871_HBe_P-B of FT:mat_peptide KU576871_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576872_HBe_P-B Product feature CHAIN KU576872_HBe_P-B of FT:mat_peptide KU576872_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576873_HBe_P-B Product feature CHAIN KU576873_HBe_P-B of FT:mat_peptide KU576873_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 141-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576874_HBe_P-B Product feature CHAIN KU576874_HBe_P-B of FT:mat_peptide KU576874_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU576875_HBe_P-B Product feature CHAIN KU576875_HBe_P-B of FT:mat_peptide KU576875_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576877_HBe_P-B Product feature CHAIN KU576877_HBe_P-B of FT:mat_peptide KU576877_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576879_HBe_P-B Product feature CHAIN KU576879_HBe_P-B of FT:mat_peptide KU576879_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 142-12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSLRRRRSQSRESQC
>gnl|hbvpro|KU576940_HBe_P-B Product feature CHAIN KU576940_HBe_P-B of FT:mat_peptide KU576940_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 166-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576968_HBe_P-B Product feature CHAIN KU576968_HBe_P-B of FT:mat_peptide KU576968_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 183-9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVPEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576969_HBe_P-B Product feature CHAIN KU576969_HBe_P-B of FT:mat_peptide KU576969_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 183-10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU576970_HBe_P-B Product feature CHAIN KU576970_HBe_P-B of FT:mat_peptide KU576970_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 183-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577003_HBe_P-B Product feature CHAIN KU577003_HBe_P-B of FT:mat_peptide KU577003_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 192-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577004_HBe_P-B Product feature CHAIN KU577004_HBe_P-B of FT:mat_peptide KU577004_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 192-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFLSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577081_HBe_P-B Product feature CHAIN KU577081_HBe_P-B of FT:mat_peptide KU577081_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 27-11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPAVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577089_HBe_P-B Product feature CHAIN KU577089_HBe_P-B of FT:mat_peptide KU577089_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 52-8-1). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALCRDALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCXSPRRRTPSPRRRXSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577107_HBe_P-B Product feature CHAIN KU577107_HBe_P-B of FT:mat_peptide KU577107_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 112-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
STLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KU667412_HBe_P-B Product feature CHAIN KU667412_HBe_P-B of FT:mat_peptide KU667412_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-00c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALWQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTLSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667422_HBe_P-B Product feature CHAIN KU667422_HBe_P-B of FT:mat_peptide KU667422_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-01c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREFVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRTRMSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667438_HBe_P-B Product feature CHAIN KU667438_HBe_P-B of FT:mat_peptide KU667438_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-03c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSALPETTVVRRRGRSPRRRTPSPRRRRPQSPRHRRSQSRESQC
>gnl|hbvpro|KU667448_HBe_P-B Product feature CHAIN KU667448_HBe_P-B of FT:mat_peptide KU667448_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-04c). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRGSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667457_HBe_P-B Product feature CHAIN KU667457_HBe_P-B of FT:mat_peptide KU667457_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 97-04c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTLSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667460_HBe_P-B Product feature CHAIN KU667460_HBe_P-B of FT:mat_peptide KU667460_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-05c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667469_HBe_P-B Product feature CHAIN KU667469_HBe_P-B of FT:mat_peptide KU667469_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-06c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667484_HBe_P-B Product feature CHAIN KU667484_HBe_P-B of FT:mat_peptide KU667484_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 97-07c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELHSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667493_HBe_P-B Product feature CHAIN KU667493_HBe_P-B of FT:mat_peptide KU667493_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-09c). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MKLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667508_HBe_P-B Product feature CHAIN KU667508_HBe_P-B of FT:mat_peptide KU667508_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33-10c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YTPPNAPILSTLPETTVVRRRGRSPRRRTLSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667515_HBe_P-B Product feature CHAIN KU667515_HBe_P-B of FT:mat_peptide KU667515_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 97-10c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667540_HBe_P-B Product feature CHAIN KU667540_HBe_P-B of FT:mat_peptide KU667540_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-13c). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASELCLGWLWGMDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSTLPETSVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667569_HBe_P-B Product feature CHAIN KU667569_HBe_P-B of FT:mat_peptide KU667569_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23-16c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQLPRRRRSQSRESQC
>gnl|hbvpro|KU667590_HBe_P-B Product feature CHAIN KU667590_HBe_P-B of FT:mat_peptide KU667590_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 62-18c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPTLSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667612_HBe_P-B Product feature CHAIN KU667612_HBe_P-B of FT:mat_peptide KU667612_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 65-20c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSRPTVQASKLCLGWLWGMDIDPYKEFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667640_HBe_P-B Product feature CHAIN KU667640_HBe_P-B of FT:mat_peptide KU667640_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 92-22c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLSLINSCSCPTVQASKQCLGRLWGMDIDPYKEFGASVELLSFLSSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLGDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667647_HBe_P-B Product feature CHAIN KU667647_HBe_P-B of FT:mat_peptide KU667647_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-23c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRGSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667659_HBe_P-B Product feature CHAIN KU667659_HBe_P-B of FT:mat_peptide KU667659_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7-24c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLSSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGKLMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRKGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|KU667700_HBe_P-B Product feature CHAIN KU667700_HBe_P-B of FT:mat_peptide KU667700_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29-12s-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPGTTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667784_HBe_P-B Product feature CHAIN KU667784_HBe_P-B of FT:mat_peptide KU667784_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 65-35c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGGLMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU667840_HBe_P-B Product feature CHAIN KU667840_HBe_P-B of FT:mat_peptide KU667840_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 39-40c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNTPILSTLPETTVVRRRGRSPRRRTPSPRRQRSQSPRRKKSQSRESQC
>gnl|hbvpro|KU667858_HBe_P-B Product feature CHAIN KU667858_HBe_P-B of FT:mat_peptide KU667858_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 37-41c). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MKLFHLCLIISYSCPTVQASKLCLGWLWGMDIDPYKESGAPVELLSFLPSDFSPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRGLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667859_HBe_P-B Product feature CHAIN KU667859_HBe_P-B of FT:mat_peptide KU667859_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 39-41c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVRIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPKRRTPSPRIRKSQSPRLRRSQSRESQC
>gnl|hbvpro|KU667879_HBe_P-B Product feature CHAIN KU667879_HBe_P-B of FT:mat_peptide KU667879_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 37-43c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YIPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRMSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667936_HBe_P-B Product feature CHAIN KU667936_HBe_P-B of FT:mat_peptide KU667936_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 39-49c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALEPPEHCSPH
HTALRQAILCWGELMKLATWVGSNLEDPASRELVVSYVNVSMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRKRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667955_HBe_P-B Product feature CHAIN KU667955_HBe_P-B of FT:mat_peptide KU667955_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-51c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSSLEDPASRELVVSCVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667956_HBe_P-B Product feature CHAIN KU667956_HBe_P-B of FT:mat_peptide KU667956_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69-51c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVKASKLCLGRLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRGALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGTSPRRRAPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667980_HBe_P-B Product feature CHAIN KU667980_HBe_P-B of FT:mat_peptide KU667980_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-54c). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQAYKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRGRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667987_HBe_P-B Product feature CHAIN KU667987_HBe_P-B of FT:mat_peptide KU667987_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 59-55c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHPSCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU667996_HBe_P-B Product feature CHAIN KU667996_HBe_P-B of FT:mat_peptide KU667996_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-56c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRRSQSQESQC
>gnl|hbvpro|KU667997_HBe_P-B Product feature CHAIN KU667997_HBe_P-B of FT:mat_peptide KU667997_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 59-56c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPAVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668003_HBe_P-B Product feature CHAIN KU668003_HBe_P-B of FT:mat_peptide KU668003_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 59-57c). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRNLLDTANALYREALESPEHCSPH
HTTIRQAILCWGELMNLATWVKNNLKDPTSRELVVGYVNVNMDIKLRQLLWFHLSCRTFKRETVLGYLVSFGVWIRTPAA
YRPPNAPILSTLPKTTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSQKSQC
>gnl|hbvpro|KU668009_HBe_P-B Product feature CHAIN KU668009_HBe_P-B of FT:mat_peptide KU668009_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-58c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVDMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668012_HBe_P-B Product feature CHAIN KU668012_HBe_P-B of FT:mat_peptide KU668012_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 85-58c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDIASALYREALESPEHCSPH
HTALRQAILCWGGSMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668027_HBe_P-B Product feature CHAIN KU668027_HBe_P-B of FT:mat_peptide KU668027_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-60c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLSWLHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRRSQSREPQC
>gnl|hbvpro|KU668037_HBe_P-B Product feature CHAIN KU668037_HBe_P-B of FT:mat_peptide KU668037_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-61c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU668046_HBe_P-B Product feature CHAIN KU668046_HBe_P-B of FT:mat_peptide KU668046_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-62c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU668058_HBe_P-B Product feature CHAIN KU668058_HBe_P-B of FT:mat_peptide KU668058_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-63c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALVSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU668061_HBe_P-B Product feature CHAIN KU668061_HBe_P-B of FT:mat_peptide KU668061_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 64-5s). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLLHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWMRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668069_HBe_P-B Product feature CHAIN KU668069_HBe_P-B of FT:mat_peptide KU668069_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-64c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU668076_HBe_P-B Product feature CHAIN KU668076_HBe_P-B of FT:mat_peptide KU668076_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 45-65c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYRKALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSRSRESQC
>gnl|hbvpro|KU668093_HBe_P-B Product feature CHAIN KU668093_HBe_P-B of FT:mat_peptide KU668093_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-66c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSFRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVFEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSHSPRPRRSQSREPQC
>gnl|hbvpro|KU668108_HBe_P-B Product feature CHAIN KU668108_HBe_P-B of FT:mat_peptide KU668108_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-67c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALVSPEHCSPH
RTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU668115_HBe_P-B Product feature CHAIN KU668115_HBe_P-B of FT:mat_peptide KU668115_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 64-68c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668116_HBe_P-B Product feature CHAIN KU668116_HBe_P-B of FT:mat_peptide KU668116_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 86-68c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIGPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALVSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU668124_HBe_P-B Product feature CHAIN KU668124_HBe_P-B of FT:mat_peptide KU668124_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 64-69c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRMSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668133_HBe_P-B Product feature CHAIN KU668133_HBe_P-B of FT:mat_peptide KU668133_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 64-70c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668149_HBe_P-B Product feature CHAIN KU668149_HBe_P-B of FT:mat_peptide KU668149_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 64-72c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
VQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668173_HBe_P-B Product feature CHAIN KU668173_HBe_P-B of FT:mat_peptide KU668173_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13-75c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKESGASVELLSFLSPDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQS
>gnl|hbvpro|KU668216_HBe_P-B Product feature CHAIN KU668216_HBe_P-B of FT:mat_peptide KU668216_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16-80c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPY
HTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRGGRSPKRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668289_HBe_P-B Product feature CHAIN KU668289_HBe_P-B of FT:mat_peptide KU668289_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-87c). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGTSVELLSFLPSDFFPNIRDLLDTASALYREASESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668299_HBe_P-B Product feature CHAIN KU668299_HBe_P-B of FT:mat_peptide KU668299_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-88c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNVPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668300_HBe_P-B Product feature CHAIN KU668300_HBe_P-B of FT:mat_peptide KU668300_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-88c-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRGRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668307_HBe_P-B Product feature CHAIN KU668307_HBe_P-B of FT:mat_peptide KU668307_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 44-89c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILPTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668308_HBe_P-B Product feature CHAIN KU668308_HBe_P-B of FT:mat_peptide KU668308_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 45-89c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYRKALESTEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFRISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|KU668309_HBe_P-B Product feature CHAIN KU668309_HBe_P-B of FT:mat_peptide KU668309_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 59-89c). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRNLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668318_HBe_P-B Product feature CHAIN KU668318_HBe_P-B of FT:mat_peptide KU668318_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-90c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTDSALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668330_HBe_P-B Product feature CHAIN KU668330_HBe_P-B of FT:mat_peptide KU668330_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-91c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668332_HBe_P-B Product feature CHAIN KU668332_HBe_P-B of FT:mat_peptide KU668332_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 59-91c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668336_HBe_P-B Product feature CHAIN KU668336_HBe_P-B of FT:mat_peptide KU668336_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21-92c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHHSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIRQLLWFHIPCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668358_HBe_P-B Product feature CHAIN KU668358_HBe_P-B of FT:mat_peptide KU668358_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 55-94c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAIMCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRPQSRESQC
>gnl|hbvpro|KU668369_HBe_P-B Product feature CHAIN KU668369_HBe_P-B of FT:mat_peptide KU668369_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 59-95c). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLKDPASRELVVGYVNVNMGIKPRQLLWFHLSCLTFGKKTVLKYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRCRTPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU679959_HBe_P-B Product feature CHAIN KU679959_HBe_P-B of FT:mat_peptide KU679959_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 126_EA_Gap). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKQCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963799_HBe_P-B Product feature CHAIN KU963799_HBe_P-B of FT:mat_peptide KU963799_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963800_HBe_P-B Product feature CHAIN KU963800_HBe_P-B of FT:mat_peptide KU963800_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963801_HBe_P-B Product feature CHAIN KU963801_HBe_P-B of FT:mat_peptide KU963801_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963802_HBe_P-B Product feature CHAIN KU963802_HBe_P-B of FT:mat_peptide KU963802_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963803_HBe_P-B Product feature CHAIN KU963803_HBe_P-B of FT:mat_peptide KU963803_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963804_HBe_P-B Product feature CHAIN KU963804_HBe_P-B of FT:mat_peptide KU963804_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963805_HBe_P-B Product feature CHAIN KU963805_HBe_P-B of FT:mat_peptide KU963805_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963806_HBe_P-B Product feature CHAIN KU963806_HBe_P-B of FT:mat_peptide KU963806_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963807_HBe_P-B Product feature CHAIN KU963807_HBe_P-B of FT:mat_peptide KU963807_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963808_HBe_P-B Product feature CHAIN KU963808_HBe_P-B of FT:mat_peptide KU963808_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963809_HBe_P-B Product feature CHAIN KU963809_HBe_P-B of FT:mat_peptide KU963809_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963810_HBe_P-B Product feature CHAIN KU963810_HBe_P-B of FT:mat_peptide KU963810_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963811_HBe_P-B Product feature CHAIN KU963811_HBe_P-B of FT:mat_peptide KU963811_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963812_HBe_P-B Product feature CHAIN KU963812_HBe_P-B of FT:mat_peptide KU963812_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963813_HBe_P-B Product feature CHAIN KU963813_HBe_P-B of FT:mat_peptide KU963813_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963814_HBe_P-B Product feature CHAIN KU963814_HBe_P-B of FT:mat_peptide KU963814_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963815_HBe_P-B Product feature CHAIN KU963815_HBe_P-B of FT:mat_peptide KU963815_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963816_HBe_P-B Product feature CHAIN KU963816_HBe_P-B of FT:mat_peptide KU963816_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963817_HBe_P-B Product feature CHAIN KU963817_HBe_P-B of FT:mat_peptide KU963817_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963818_HBe_P-B Product feature CHAIN KU963818_HBe_P-B of FT:mat_peptide KU963818_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963819_HBe_P-B Product feature CHAIN KU963819_HBe_P-B of FT:mat_peptide KU963819_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963820_HBe_P-B Product feature CHAIN KU963820_HBe_P-B of FT:mat_peptide KU963820_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963821_HBe_P-B Product feature CHAIN KU963821_HBe_P-B of FT:mat_peptide KU963821_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963822_HBe_P-B Product feature CHAIN KU963822_HBe_P-B of FT:mat_peptide KU963822_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963823_HBe_P-B Product feature CHAIN KU963823_HBe_P-B of FT:mat_peptide KU963823_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963824_HBe_P-B Product feature CHAIN KU963824_HBe_P-B of FT:mat_peptide KU963824_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFFLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963825_HBe_P-B Product feature CHAIN KU963825_HBe_P-B of FT:mat_peptide KU963825_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963826_HBe_P-B Product feature CHAIN KU963826_HBe_P-B of FT:mat_peptide KU963826_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963827_HBe_P-B Product feature CHAIN KU963827_HBe_P-B of FT:mat_peptide KU963827_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963828_HBe_P-B Product feature CHAIN KU963828_HBe_P-B of FT:mat_peptide KU963828_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963829_HBe_P-B Product feature CHAIN KU963829_HBe_P-B of FT:mat_peptide KU963829_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963830_HBe_P-B Product feature CHAIN KU963830_HBe_P-B of FT:mat_peptide KU963830_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963831_HBe_P-B Product feature CHAIN KU963831_HBe_P-B of FT:mat_peptide KU963831_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963832_HBe_P-B Product feature CHAIN KU963832_HBe_P-B of FT:mat_peptide KU963832_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963833_HBe_P-B Product feature CHAIN KU963833_HBe_P-B of FT:mat_peptide KU963833_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963834_HBe_P-B Product feature CHAIN KU963834_HBe_P-B of FT:mat_peptide KU963834_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963835_HBe_P-B Product feature CHAIN KU963835_HBe_P-B of FT:mat_peptide KU963835_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963836_HBe_P-B Product feature CHAIN KU963836_HBe_P-B of FT:mat_peptide KU963836_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963837_HBe_P-B Product feature CHAIN KU963837_HBe_P-B of FT:mat_peptide KU963837_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963838_HBe_P-B Product feature CHAIN KU963838_HBe_P-B of FT:mat_peptide KU963838_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963839_HBe_P-B Product feature CHAIN KU963839_HBe_P-B of FT:mat_peptide KU963839_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963840_HBe_P-B Product feature CHAIN KU963840_HBe_P-B of FT:mat_peptide KU963840_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963841_HBe_P-B Product feature CHAIN KU963841_HBe_P-B of FT:mat_peptide KU963841_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963842_HBe_P-B Product feature CHAIN KU963842_HBe_P-B of FT:mat_peptide KU963842_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963843_HBe_P-B Product feature CHAIN KU963843_HBe_P-B of FT:mat_peptide KU963843_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963844_HBe_P-B Product feature CHAIN KU963844_HBe_P-B of FT:mat_peptide KU963844_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963845_HBe_P-B Product feature CHAIN KU963845_HBe_P-B of FT:mat_peptide KU963845_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963846_HBe_P-B Product feature CHAIN KU963846_HBe_P-B of FT:mat_peptide KU963846_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963847_HBe_P-B Product feature CHAIN KU963847_HBe_P-B of FT:mat_peptide KU963847_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963848_HBe_P-B Product feature CHAIN KU963848_HBe_P-B of FT:mat_peptide KU963848_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963849_HBe_P-B Product feature CHAIN KU963849_HBe_P-B of FT:mat_peptide KU963849_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963850_HBe_P-B Product feature CHAIN KU963850_HBe_P-B of FT:mat_peptide KU963850_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963851_HBe_P-B Product feature CHAIN KU963851_HBe_P-B of FT:mat_peptide KU963851_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963852_HBe_P-B Product feature CHAIN KU963852_HBe_P-B of FT:mat_peptide KU963852_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963853_HBe_P-B Product feature CHAIN KU963853_HBe_P-B of FT:mat_peptide KU963853_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963854_HBe_P-B Product feature CHAIN KU963854_HBe_P-B of FT:mat_peptide KU963854_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963855_HBe_P-B Product feature CHAIN KU963855_HBe_P-B of FT:mat_peptide KU963855_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963945_HBe_P-B Product feature CHAIN KU963945_HBe_P-B of FT:mat_peptide KU963945_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963946_HBe_P-B Product feature CHAIN KU963946_HBe_P-B of FT:mat_peptide KU963946_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963947_HBe_P-B Product feature CHAIN KU963947_HBe_P-B of FT:mat_peptide KU963947_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963948_HBe_P-B Product feature CHAIN KU963948_HBe_P-B of FT:mat_peptide KU963948_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963949_HBe_P-B Product feature CHAIN KU963949_HBe_P-B of FT:mat_peptide KU963949_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963950_HBe_P-B Product feature CHAIN KU963950_HBe_P-B of FT:mat_peptide KU963950_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963951_HBe_P-B Product feature CHAIN KU963951_HBe_P-B of FT:mat_peptide KU963951_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALMQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963952_HBe_P-B Product feature CHAIN KU963952_HBe_P-B of FT:mat_peptide KU963952_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963953_HBe_P-B Product feature CHAIN KU963953_HBe_P-B of FT:mat_peptide KU963953_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963954_HBe_P-B Product feature CHAIN KU963954_HBe_P-B of FT:mat_peptide KU963954_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963955_HBe_P-B Product feature CHAIN KU963955_HBe_P-B of FT:mat_peptide KU963955_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963956_HBe_P-B Product feature CHAIN KU963956_HBe_P-B of FT:mat_peptide KU963956_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963957_HBe_P-B Product feature CHAIN KU963957_HBe_P-B of FT:mat_peptide KU963957_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963958_HBe_P-B Product feature CHAIN KU963958_HBe_P-B of FT:mat_peptide KU963958_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963959_HBe_P-B Product feature CHAIN KU963959_HBe_P-B of FT:mat_peptide KU963959_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963960_HBe_P-B Product feature CHAIN KU963960_HBe_P-B of FT:mat_peptide KU963960_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963961_HBe_P-B Product feature CHAIN KU963961_HBe_P-B of FT:mat_peptide KU963961_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963962_HBe_P-B Product feature CHAIN KU963962_HBe_P-B of FT:mat_peptide KU963962_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963963_HBe_P-B Product feature CHAIN KU963963_HBe_P-B of FT:mat_peptide KU963963_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963964_HBe_P-B Product feature CHAIN KU963964_HBe_P-B of FT:mat_peptide KU963964_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963965_HBe_P-B Product feature CHAIN KU963965_HBe_P-B of FT:mat_peptide KU963965_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963966_HBe_P-B Product feature CHAIN KU963966_HBe_P-B of FT:mat_peptide KU963966_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWISTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963967_HBe_P-B Product feature CHAIN KU963967_HBe_P-B of FT:mat_peptide KU963967_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963968_HBe_P-B Product feature CHAIN KU963968_HBe_P-B of FT:mat_peptide KU963968_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963969_HBe_P-B Product feature CHAIN KU963969_HBe_P-B of FT:mat_peptide KU963969_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963970_HBe_P-B Product feature CHAIN KU963970_HBe_P-B of FT:mat_peptide KU963970_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963971_HBe_P-B Product feature CHAIN KU963971_HBe_P-B of FT:mat_peptide KU963971_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963972_HBe_P-B Product feature CHAIN KU963972_HBe_P-B of FT:mat_peptide KU963972_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963973_HBe_P-B Product feature CHAIN KU963973_HBe_P-B of FT:mat_peptide KU963973_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963974_HBe_P-B Product feature CHAIN KU963974_HBe_P-B of FT:mat_peptide KU963974_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963975_HBe_P-B Product feature CHAIN KU963975_HBe_P-B of FT:mat_peptide KU963975_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963976_HBe_P-B Product feature CHAIN KU963976_HBe_P-B of FT:mat_peptide KU963976_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963977_HBe_P-B Product feature CHAIN KU963977_HBe_P-B of FT:mat_peptide KU963977_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963978_HBe_P-B Product feature CHAIN KU963978_HBe_P-B of FT:mat_peptide KU963978_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963979_HBe_P-B Product feature CHAIN KU963979_HBe_P-B of FT:mat_peptide KU963979_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963980_HBe_P-B Product feature CHAIN KU963980_HBe_P-B of FT:mat_peptide KU963980_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963981_HBe_P-B Product feature CHAIN KU963981_HBe_P-B of FT:mat_peptide KU963981_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963982_HBe_P-B Product feature CHAIN KU963982_HBe_P-B of FT:mat_peptide KU963982_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963983_HBe_P-B Product feature CHAIN KU963983_HBe_P-B of FT:mat_peptide KU963983_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963984_HBe_P-B Product feature CHAIN KU963984_HBe_P-B of FT:mat_peptide KU963984_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963985_HBe_P-B Product feature CHAIN KU963985_HBe_P-B of FT:mat_peptide KU963985_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963986_HBe_P-B Product feature CHAIN KU963986_HBe_P-B of FT:mat_peptide KU963986_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963987_HBe_P-B Product feature CHAIN KU963987_HBe_P-B of FT:mat_peptide KU963987_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963988_HBe_P-B Product feature CHAIN KU963988_HBe_P-B of FT:mat_peptide KU963988_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963989_HBe_P-B Product feature CHAIN KU963989_HBe_P-B of FT:mat_peptide KU963989_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964079_HBe_P-B Product feature CHAIN KU964079_HBe_P-B of FT:mat_peptide KU964079_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964081_HBe_P-B Product feature CHAIN KU964081_HBe_P-B of FT:mat_peptide KU964081_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964083_HBe_P-B Product feature CHAIN KU964083_HBe_P-B of FT:mat_peptide KU964083_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964084_HBe_P-B Product feature CHAIN KU964084_HBe_P-B of FT:mat_peptide KU964084_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964085_HBe_P-B Product feature CHAIN KU964085_HBe_P-B of FT:mat_peptide KU964085_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964087_HBe_P-B Product feature CHAIN KU964087_HBe_P-B of FT:mat_peptide KU964087_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964088_HBe_P-B Product feature CHAIN KU964088_HBe_P-B of FT:mat_peptide KU964088_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964089_HBe_P-B Product feature CHAIN KU964089_HBe_P-B of FT:mat_peptide KU964089_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964090_HBe_P-B Product feature CHAIN KU964090_HBe_P-B of FT:mat_peptide KU964090_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964091_HBe_P-B Product feature CHAIN KU964091_HBe_P-B of FT:mat_peptide KU964091_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGAYVELLSFLPSDFFPSIRDLLETATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964092_HBe_P-B Product feature CHAIN KU964092_HBe_P-B of FT:mat_peptide KU964092_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964093_HBe_P-B Product feature CHAIN KU964093_HBe_P-B of FT:mat_peptide KU964093_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964094_HBe_P-B Product feature CHAIN KU964094_HBe_P-B of FT:mat_peptide KU964094_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964095_HBe_P-B Product feature CHAIN KU964095_HBe_P-B of FT:mat_peptide KU964095_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964096_HBe_P-B Product feature CHAIN KU964096_HBe_P-B of FT:mat_peptide KU964096_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964097_HBe_P-B Product feature CHAIN KU964097_HBe_P-B of FT:mat_peptide KU964097_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964098_HBe_P-B Product feature CHAIN KU964098_HBe_P-B of FT:mat_peptide KU964098_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964099_HBe_P-B Product feature CHAIN KU964099_HBe_P-B of FT:mat_peptide KU964099_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964100_HBe_P-B Product feature CHAIN KU964100_HBe_P-B of FT:mat_peptide KU964100_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964101_HBe_P-B Product feature CHAIN KU964101_HBe_P-B of FT:mat_peptide KU964101_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KU964102_HBe_P-B Product feature CHAIN KU964102_HBe_P-B of FT:mat_peptide KU964102_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964103_HBe_P-B Product feature CHAIN KU964103_HBe_P-B of FT:mat_peptide KU964103_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964104_HBe_P-B Product feature CHAIN KU964104_HBe_P-B of FT:mat_peptide KU964104_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964105_HBe_P-B Product feature CHAIN KU964105_HBe_P-B of FT:mat_peptide KU964105_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964106_HBe_P-B Product feature CHAIN KU964106_HBe_P-B of FT:mat_peptide KU964106_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964107_HBe_P-B Product feature CHAIN KU964107_HBe_P-B of FT:mat_peptide KU964107_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964153_HBe_P-B Product feature CHAIN KU964153_HBe_P-B of FT:mat_peptide KU964153_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964154_HBe_P-B Product feature CHAIN KU964154_HBe_P-B of FT:mat_peptide KU964154_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964155_HBe_P-B Product feature CHAIN KU964155_HBe_P-B of FT:mat_peptide KU964155_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964156_HBe_P-B Product feature CHAIN KU964156_HBe_P-B of FT:mat_peptide KU964156_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964157_HBe_P-B Product feature CHAIN KU964157_HBe_P-B of FT:mat_peptide KU964157_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964158_HBe_P-B Product feature CHAIN KU964158_HBe_P-B of FT:mat_peptide KU964158_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964159_HBe_P-B Product feature CHAIN KU964159_HBe_P-B of FT:mat_peptide KU964159_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964160_HBe_P-B Product feature CHAIN KU964160_HBe_P-B of FT:mat_peptide KU964160_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964161_HBe_P-B Product feature CHAIN KU964161_HBe_P-B of FT:mat_peptide KU964161_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964162_HBe_P-B Product feature CHAIN KU964162_HBe_P-B of FT:mat_peptide KU964162_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964163_HBe_P-B Product feature CHAIN KU964163_HBe_P-B of FT:mat_peptide KU964163_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964164_HBe_P-B Product feature CHAIN KU964164_HBe_P-B of FT:mat_peptide KU964164_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964165_HBe_P-B Product feature CHAIN KU964165_HBe_P-B of FT:mat_peptide KU964165_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQTRESQC
>gnl|hbvpro|KU964166_HBe_P-B Product feature CHAIN KU964166_HBe_P-B of FT:mat_peptide KU964166_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964167_HBe_P-B Product feature CHAIN KU964167_HBe_P-B of FT:mat_peptide KU964167_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964168_HBe_P-B Product feature CHAIN KU964168_HBe_P-B of FT:mat_peptide KU964168_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTHTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964381_HBe_P-B Product feature CHAIN KU964381_HBe_P-B of FT:mat_peptide KU964381_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964382_HBe_P-B Product feature CHAIN KU964382_HBe_P-B of FT:mat_peptide KU964382_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964383_HBe_P-B Product feature CHAIN KU964383_HBe_P-B of FT:mat_peptide KU964383_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964384_HBe_P-B Product feature CHAIN KU964384_HBe_P-B of FT:mat_peptide KU964384_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964385_HBe_P-B Product feature CHAIN KU964385_HBe_P-B of FT:mat_peptide KU964385_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964386_HBe_P-B Product feature CHAIN KU964386_HBe_P-B of FT:mat_peptide KU964386_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_8). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPETCVVRGRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964387_HBe_P-B Product feature CHAIN KU964387_HBe_P-B of FT:mat_peptide KU964387_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_9). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPETCVVRGRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964388_HBe_P-B Product feature CHAIN KU964388_HBe_P-B of FT:mat_peptide KU964388_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964389_HBe_P-B Product feature CHAIN KU964389_HBe_P-B of FT:mat_peptide KU964389_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPETCVVRGRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964390_HBe_P-B Product feature CHAIN KU964390_HBe_P-B of FT:mat_peptide KU964390_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_12). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPETCVVRGRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964391_HBe_P-B Product feature CHAIN KU964391_HBe_P-B of FT:mat_peptide KU964391_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964392_HBe_P-B Product feature CHAIN KU964392_HBe_P-B of FT:mat_peptide KU964392_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_14). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPETCVVRGRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964393_HBe_P-B Product feature CHAIN KU964393_HBe_P-B of FT:mat_peptide KU964393_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964395_HBe_P-B Product feature CHAIN KU964395_HBe_P-B of FT:mat_peptide KU964395_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964396_HBe_P-B Product feature CHAIN KU964396_HBe_P-B of FT:mat_peptide KU964396_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_16). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPETCVVRGRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964397_HBe_P-B Product feature CHAIN KU964397_HBe_P-B of FT:mat_peptide KU964397_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPQNAPILSTLPECTVVRGRRRSPRRRTPSPSRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX276774_HBe_P-B Product feature CHAIN KX276774_HBe_P-B of FT:mat_peptide KX276774_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLEWLWDMDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLXDPASRELVVSYVNVNMGXKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRPRGRSIRRRTPSPRRRRTQSPRRRRSSSREPQC
>gnl|hbvpro|KX276776_HBe_P-B Product feature CHAIN KX276776_HBe_P-B of FT:mat_peptide KX276776_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
LQLFHLCLIXSCSCPTVQASKLCLGWLXDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCXXH
HTALRHAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRQRRRSPRRRTPSPRRRRSXSPRRRRSXSRESQC
>gnl|hbvpro|KX276777_HBe_P-B Product feature CHAIN KX276777_HBe_P-B of FT:mat_peptide KX276777_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
XQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRQRGRSLRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276805_HBe_P-B Product feature CHAIN KX276805_HBe_P-B of FT:mat_peptide KX276805_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTXSALYREALESPEHCSHH
HTALRQAVLCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRPRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX276806_HBe_P-B Product feature CHAIN KX276806_HBe_P-B of FT:mat_peptide KX276806_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
LXLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDXXSRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRXRGRSLRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276809_HBe_P-B Product feature CHAIN KX276809_HBe_P-B of FT:mat_peptide KX276809_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSMRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKMRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX276817_HBe_P-B Product feature CHAIN KX276817_HBe_P-B of FT:mat_peptide KX276817_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHH
HTAIRQAILCWGELMNLAXWVGSNLEDPASRELVVGYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRGRGRSPRRRTPSPRRRRSQSPRRRRSRSRXSQC
>gnl|hbvpro|KX276821_HBe_P-B Product feature CHAIN KX276821_HBe_P-B of FT:mat_peptide KX276821_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
TQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFXPSIRDLLDTASALXREALESPEHCSPH
HTALRQAXLCWGELMXLATWVGSNLEDPASRELVVSYVNVNMGXKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQG
YRPPNAPILSTLPETTVVRGRSRVPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276824_HBe_P-B Product feature CHAIN KX276824_HBe_P-B of FT:mat_peptide KX276824_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
RQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSXH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETXVVRXRGRXPRRRTPSPRRRRSQSPRRRRSQSRXXQC
>gnl|hbvpro|KX276830_HBe_P-B Product feature CHAIN KX276830_HBe_P-B of FT:mat_peptide KX276830_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
IQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPQNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX765856_HBe_P-B Product feature CHAIN KX765856_HBe_P-B of FT:mat_peptide KX765856_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PID:9231). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470830_HBe_P-B Product feature CHAIN KY470830_HBe_P-B of FT:mat_peptide KY470830_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-2-15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470832_HBe_P-B Product feature CHAIN KY470832_HBe_P-B of FT:mat_peptide KY470832_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470833_HBe_P-B Product feature CHAIN KY470833_HBe_P-B of FT:mat_peptide KY470833_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470834_HBe_P-B Product feature CHAIN KY470834_HBe_P-B of FT:mat_peptide KY470834_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470835_HBe_P-B Product feature CHAIN KY470835_HBe_P-B of FT:mat_peptide KY470835_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470837_HBe_P-B Product feature CHAIN KY470837_HBe_P-B of FT:mat_peptide KY470837_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470838_HBe_P-B Product feature CHAIN KY470838_HBe_P-B of FT:mat_peptide KY470838_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGGETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470840_HBe_P-B Product feature CHAIN KY470840_HBe_P-B of FT:mat_peptide KY470840_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPSA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470841_HBe_P-B Product feature CHAIN KY470841_HBe_P-B of FT:mat_peptide KY470841_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470953_HBe_P-B Product feature CHAIN KY470953_HBe_P-B of FT:mat_peptide KY470953_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-2-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470954_HBe_P-B Product feature CHAIN KY470954_HBe_P-B of FT:mat_peptide KY470954_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-2-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470956_HBe_P-B Product feature CHAIN KY470956_HBe_P-B of FT:mat_peptide KY470956_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-D2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470960_HBe_P-B Product feature CHAIN KY470960_HBe_P-B of FT:mat_peptide KY470960_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-E11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASTLYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470961_HBe_P-B Product feature CHAIN KY470961_HBe_P-B of FT:mat_peptide KY470961_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-E8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASTLYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470962_HBe_P-B Product feature CHAIN KY470962_HBe_P-B of FT:mat_peptide KY470962_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-F10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY629635_HBe_P-B Product feature CHAIN KY629635_HBe_P-B of FT:mat_peptide KY629635_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TYM03009). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY629636_HBe_P-B Product feature CHAIN KY629636_HBe_P-B of FT:mat_peptide KY629636_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TYM03036). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689408_HBe_P-B Product feature CHAIN KY689408_HBe_P-B of FT:mat_peptide KY689408_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_115_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689410_HBe_P-B Product feature CHAIN KY689410_HBe_P-B of FT:mat_peptide KY689410_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_11_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689413_HBe_P-B Product feature CHAIN KY689413_HBe_P-B of FT:mat_peptide KY689413_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_17_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689414_HBe_P-B Product feature CHAIN KY689414_HBe_P-B of FT:mat_peptide KY689414_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_1_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRXRSPRRRTPSPRRRRSQSPRRRRXQSRESQC
>gnl|hbvpro|KY689419_HBe_P-B Product feature CHAIN KY689419_HBe_P-B of FT:mat_peptide KY689419_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_29_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRXPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY689426_HBe_P-B Product feature CHAIN KY689426_HBe_P-B of FT:mat_peptide KY689426_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3021_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY689433_HBe_P-B Product feature CHAIN KY689433_HBe_P-B of FT:mat_peptide KY689433_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3039_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689443_HBe_P-B Product feature CHAIN KY689443_HBe_P-B of FT:mat_peptide KY689443_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3063_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689444_HBe_P-B Product feature CHAIN KY689444_HBe_P-B of FT:mat_peptide KY689444_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3065_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRQRCRSPRRRTPSPRRRRSKSPRRRRSQSRESNC
>gnl|hbvpro|KY689448_HBe_P-B Product feature CHAIN KY689448_HBe_P-B of FT:mat_peptide KY689448_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3081_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATAMYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY689469_HBe_P-B Product feature CHAIN KY689469_HBe_P-B of FT:mat_peptide KY689469_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPNDFFPNIRDLLDTAAALHREALESQEHCSAH
HTALRQAIVCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689472_HBe_P-B Product feature CHAIN KY689472_HBe_P-B of FT:mat_peptide KY689472_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_43_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689477_HBe_P-B Product feature CHAIN KY689477_HBe_P-B of FT:mat_peptide KY689477_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_53_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689480_HBe_P-B Product feature CHAIN KY689480_HBe_P-B of FT:mat_peptide KY689480_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_5_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689488_HBe_P-B Product feature CHAIN KY689488_HBe_P-B of FT:mat_peptide KY689488_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_7_N). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKPFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELXVXYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689505_HBe_P-B Product feature CHAIN KY689505_HBe_P-B of FT:mat_peptide KY689505_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_11_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689506_HBe_P-B Product feature CHAIN KY689506_HBe_P-B of FT:mat_peptide KY689506_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_111_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689507_HBe_P-B Product feature CHAIN KY689507_HBe_P-B of FT:mat_peptide KY689507_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_113_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689516_HBe_P-B Product feature CHAIN KY689516_HBe_P-B of FT:mat_peptide KY689516_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPNDFFPNIRDLLDTAAALHREALESQEHCSAH
HTALRQAIVCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689517_HBe_P-B Product feature CHAIN KY689517_HBe_P-B of FT:mat_peptide KY689517_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3013_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689520_HBe_P-B Product feature CHAIN KY689520_HBe_P-B of FT:mat_peptide KY689520_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3021_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRXPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|KY689523_HBe_P-B Product feature CHAIN KY689523_HBe_P-B of FT:mat_peptide KY689523_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3035_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASXLXLGWLWGMDIDXYKEFGFSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALTQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689534_HBe_P-B Product feature CHAIN KY689534_HBe_P-B of FT:mat_peptide KY689534_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3081_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATAMYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY689538_HBe_P-B Product feature CHAIN KY689538_HBe_P-B of FT:mat_peptide KY689538_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_3093_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689546_HBe_P-B Product feature CHAIN KY689546_HBe_P-B of FT:mat_peptide KY689546_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_43_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689553_HBe_P-B Product feature CHAIN KY689553_HBe_P-B of FT:mat_peptide KY689553_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_57_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689557_HBe_P-B Product feature CHAIN KY689557_HBe_P-B of FT:mat_peptide KY689557_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_7_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKXFGASVELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPH
HTALRQAXXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689562_HBe_P-B Product feature CHAIN KY689562_HBe_P-B of FT:mat_peptide KY689562_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_89_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|KY689563_HBe_P-B Product feature CHAIN KY689563_HBe_P-B of FT:mat_peptide KY689563_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_9_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRNPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY689564_HBe_P-B Product feature CHAIN KY689564_HBe_P-B of FT:mat_peptide KY689564_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Pt_91_T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRPPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881721_HBe_P-B Product feature CHAIN KY881721_HBe_P-B of FT:mat_peptide KY881721_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881722_HBe_P-B Product feature CHAIN KY881722_HBe_P-B of FT:mat_peptide KY881722_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881723_HBe_P-B Product feature CHAIN KY881723_HBe_P-B of FT:mat_peptide KY881723_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881724_HBe_P-B Product feature CHAIN KY881724_HBe_P-B of FT:mat_peptide KY881724_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881725_HBe_P-B Product feature CHAIN KY881725_HBe_P-B of FT:mat_peptide KY881725_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881726_HBe_P-B Product feature CHAIN KY881726_HBe_P-B of FT:mat_peptide KY881726_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881727_HBe_P-B Product feature CHAIN KY881727_HBe_P-B of FT:mat_peptide KY881727_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881728_HBe_P-B Product feature CHAIN KY881728_HBe_P-B of FT:mat_peptide KY881728_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881729_HBe_P-B Product feature CHAIN KY881729_HBe_P-B of FT:mat_peptide KY881729_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881730_HBe_P-B Product feature CHAIN KY881730_HBe_P-B of FT:mat_peptide KY881730_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881731_HBe_P-B Product feature CHAIN KY881731_HBe_P-B of FT:mat_peptide KY881731_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881732_HBe_P-B Product feature CHAIN KY881732_HBe_P-B of FT:mat_peptide KY881732_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881733_HBe_P-B Product feature CHAIN KY881733_HBe_P-B of FT:mat_peptide KY881733_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881734_HBe_P-B Product feature CHAIN KY881734_HBe_P-B of FT:mat_peptide KY881734_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881735_HBe_P-B Product feature CHAIN KY881735_HBe_P-B of FT:mat_peptide KY881735_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881740_HBe_P-B Product feature CHAIN KY881740_HBe_P-B of FT:mat_peptide KY881740_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881741_HBe_P-B Product feature CHAIN KY881741_HBe_P-B of FT:mat_peptide KY881741_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881745_HBe_P-B Product feature CHAIN KY881745_HBe_P-B of FT:mat_peptide KY881745_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881746_HBe_P-B Product feature CHAIN KY881746_HBe_P-B of FT:mat_peptide KY881746_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881747_HBe_P-B Product feature CHAIN KY881747_HBe_P-B of FT:mat_peptide KY881747_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881752_HBe_P-B Product feature CHAIN KY881752_HBe_P-B of FT:mat_peptide KY881752_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881753_HBe_P-B Product feature CHAIN KY881753_HBe_P-B of FT:mat_peptide KY881753_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881756_HBe_P-B Product feature CHAIN KY881756_HBe_P-B of FT:mat_peptide KY881756_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881757_HBe_P-B Product feature CHAIN KY881757_HBe_P-B of FT:mat_peptide KY881757_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881759_HBe_P-B Product feature CHAIN KY881759_HBe_P-B of FT:mat_peptide KY881759_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881760_HBe_P-B Product feature CHAIN KY881760_HBe_P-B of FT:mat_peptide KY881760_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881761_HBe_P-B Product feature CHAIN KY881761_HBe_P-B of FT:mat_peptide KY881761_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881778_HBe_P-B Product feature CHAIN KY881778_HBe_P-B of FT:mat_peptide KY881778_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881779_HBe_P-B Product feature CHAIN KY881779_HBe_P-B of FT:mat_peptide KY881779_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881780_HBe_P-B Product feature CHAIN KY881780_HBe_P-B of FT:mat_peptide KY881780_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881781_HBe_P-B Product feature CHAIN KY881781_HBe_P-B of FT:mat_peptide KY881781_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881782_HBe_P-B Product feature CHAIN KY881782_HBe_P-B of FT:mat_peptide KY881782_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881783_HBe_P-B Product feature CHAIN KY881783_HBe_P-B of FT:mat_peptide KY881783_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDKYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDTASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVARRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881784_HBe_P-B Product feature CHAIN KY881784_HBe_P-B of FT:mat_peptide KY881784_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881786_HBe_P-B Product feature CHAIN KY881786_HBe_P-B of FT:mat_peptide KY881786_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881787_HBe_P-B Product feature CHAIN KY881787_HBe_P-B of FT:mat_peptide KY881787_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881788_HBe_P-B Product feature CHAIN KY881788_HBe_P-B of FT:mat_peptide KY881788_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881789_HBe_P-B Product feature CHAIN KY881789_HBe_P-B of FT:mat_peptide KY881789_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGTDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881790_HBe_P-B Product feature CHAIN KY881790_HBe_P-B of FT:mat_peptide KY881790_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881791_HBe_P-B Product feature CHAIN KY881791_HBe_P-B of FT:mat_peptide KY881791_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881793_HBe_P-B Product feature CHAIN KY881793_HBe_P-B of FT:mat_peptide KY881793_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881794_HBe_P-B Product feature CHAIN KY881794_HBe_P-B of FT:mat_peptide KY881794_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRQRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881795_HBe_P-B Product feature CHAIN KY881795_HBe_P-B of FT:mat_peptide KY881795_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881796_HBe_P-B Product feature CHAIN KY881796_HBe_P-B of FT:mat_peptide KY881796_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881797_HBe_P-B Product feature CHAIN KY881797_HBe_P-B of FT:mat_peptide KY881797_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881798_HBe_P-B Product feature CHAIN KY881798_HBe_P-B of FT:mat_peptide KY881798_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFWRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881799_HBe_P-B Product feature CHAIN KY881799_HBe_P-B of FT:mat_peptide KY881799_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFFPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLS
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881800_HBe_P-B Product feature CHAIN KY881800_HBe_P-B of FT:mat_peptide KY881800_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881801_HBe_P-B Product feature CHAIN KY881801_HBe_P-B of FT:mat_peptide KY881801_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881808_HBe_P-B Product feature CHAIN KY881808_HBe_P-B of FT:mat_peptide KY881808_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881848_HBe_P-B Product feature CHAIN KY881848_HBe_P-B of FT:mat_peptide KY881848_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAIGCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY881850_HBe_P-B Product feature CHAIN KY881850_HBe_P-B of FT:mat_peptide KY881850_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQVIVCWGELMNLATWVGSNLKDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY881861_HBe_P-B Product feature CHAIN KY881861_HBe_P-B of FT:mat_peptide KY881861_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLLGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRLRRSKSRESQC
>gnl|hbvpro|KY881906_HBe_P-B Product feature CHAIN KY881906_HBe_P-B of FT:mat_peptide KY881906_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|LC279268_HBe_P-B Product feature CHAIN LC279268_HBe_P-B of FT:mat_peptide LC279268_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_1st_child_serum). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC279269_HBe_P-B Product feature CHAIN LC279269_HBe_P-B of FT:mat_peptide LC279269_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_1st_child_UC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC279270_HBe_P-B Product feature CHAIN LC279270_HBe_P-B of FT:mat_peptide LC279270_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_2nd_child_serum). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC279271_HBe_P-B Product feature CHAIN LC279271_HBe_P-B of FT:mat_peptide LC279271_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_2nd_child_UC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC279272_HBe_P-B Product feature CHAIN LC279272_HBe_P-B of FT:mat_peptide LC279272_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_3rd_child_UC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC279273_HBe_P-B Product feature CHAIN LC279273_HBe_P-B of FT:mat_peptide LC279273_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_mother_serum). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC349872_HBe_P-B Product feature CHAIN LC349872_HBe_P-B of FT:mat_peptide LC349872_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC349873_HBe_P-B Product feature CHAIN LC349873_HBe_P-B of FT:mat_peptide LC349873_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC349877_HBe_P-B Product feature CHAIN LC349877_HBe_P-B of FT:mat_peptide LC349877_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC349878_HBe_P-B Product feature CHAIN LC349878_HBe_P-B of FT:mat_peptide LC349878_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC416037_HBe_P-B Product feature CHAIN LC416037_HBe_P-B of FT:mat_peptide LC416037_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TKI_2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992442_HBe_P-B Product feature CHAIN LT992442_HBe_P-B of FT:mat_peptide LT992442_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate DA45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HXALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|M54923_HBe_P-B Product feature CHAIN M54923_HBe_P-B of FT:mat_peptide M54923_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPGRRRSQSRESQC
>gnl|hbvpro|MF621878_HBe_P-B Product feature CHAIN MF621878_HBe_P-B of FT:mat_peptide MF621878_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVVZ0614). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674382_HBe_P-B Product feature CHAIN MF674382_HBe_P-B of FT:mat_peptide MF674382_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040003). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674383_HBe_P-B Product feature CHAIN MF674383_HBe_P-B of FT:mat_peptide MF674383_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040005). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674384_HBe_P-B Product feature CHAIN MF674384_HBe_P-B of FT:mat_peptide MF674384_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040008). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674385_HBe_P-B Product feature CHAIN MF674385_HBe_P-B of FT:mat_peptide MF674385_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040009). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYQEALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPQNAPILSTLPETAVVRQRCRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674387_HBe_P-B Product feature CHAIN MF674387_HBe_P-B of FT:mat_peptide MF674387_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040013). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674389_HBe_P-B Product feature CHAIN MF674389_HBe_P-B of FT:mat_peptide MF674389_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040016). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674391_HBe_P-B Product feature CHAIN MF674391_HBe_P-B of FT:mat_peptide MF674391_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040022). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674392_HBe_P-B Product feature CHAIN MF674392_HBe_P-B of FT:mat_peptide MF674392_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040023). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674393_HBe_P-B Product feature CHAIN MF674393_HBe_P-B of FT:mat_peptide MF674393_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040024). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674394_HBe_P-B Product feature CHAIN MF674394_HBe_P-B of FT:mat_peptide MF674394_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040025). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674395_HBe_P-B Product feature CHAIN MF674395_HBe_P-B of FT:mat_peptide MF674395_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040026). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674396_HBe_P-B Product feature CHAIN MF674396_HBe_P-B of FT:mat_peptide MF674396_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040027). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674397_HBe_P-B Product feature CHAIN MF674397_HBe_P-B of FT:mat_peptide MF674397_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040028). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674400_HBe_P-B Product feature CHAIN MF674400_HBe_P-B of FT:mat_peptide MF674400_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040031). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674401_HBe_P-B Product feature CHAIN MF674401_HBe_P-B of FT:mat_peptide MF674401_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040033). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674404_HBe_P-B Product feature CHAIN MF674404_HBe_P-B of FT:mat_peptide MF674404_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040037). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674405_HBe_P-B Product feature CHAIN MF674405_HBe_P-B of FT:mat_peptide MF674405_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040038). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674407_HBe_P-B Product feature CHAIN MF674407_HBe_P-B of FT:mat_peptide MF674407_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040043). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSYH
HTALRQAILCWGELMNLATWVGGNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRQRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674409_HBe_P-B Product feature CHAIN MF674409_HBe_P-B of FT:mat_peptide MF674409_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040047). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674410_HBe_P-B Product feature CHAIN MF674410_HBe_P-B of FT:mat_peptide MF674410_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040048). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674413_HBe_P-B Product feature CHAIN MF674413_HBe_P-B of FT:mat_peptide MF674413_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040058). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674414_HBe_P-B Product feature CHAIN MF674414_HBe_P-B of FT:mat_peptide MF674414_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040060). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFXPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674416_HBe_P-B Product feature CHAIN MF674416_HBe_P-B of FT:mat_peptide MF674416_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040063). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674419_HBe_P-B Product feature CHAIN MF674419_HBe_P-B of FT:mat_peptide MF674419_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040069). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674420_HBe_P-B Product feature CHAIN MF674420_HBe_P-B of FT:mat_peptide MF674420_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040071). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|MF674421_HBe_P-B Product feature CHAIN MF674421_HBe_P-B of FT:mat_peptide MF674421_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040075). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674423_HBe_P-B Product feature CHAIN MF674423_HBe_P-B of FT:mat_peptide MF674423_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040078). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674424_HBe_P-B Product feature CHAIN MF674424_HBe_P-B of FT:mat_peptide MF674424_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040080). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674426_HBe_P-B Product feature CHAIN MF674426_HBe_P-B of FT:mat_peptide MF674426_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040083). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674427_HBe_P-B Product feature CHAIN MF674427_HBe_P-B of FT:mat_peptide MF674427_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040084). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674431_HBe_P-B Product feature CHAIN MF674431_HBe_P-B of FT:mat_peptide MF674431_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040090). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674432_HBe_P-B Product feature CHAIN MF674432_HBe_P-B of FT:mat_peptide MF674432_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV040093). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674437_HBe_P-B Product feature CHAIN MF674437_HBe_P-B of FT:mat_peptide MF674437_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050008). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|MF674438_HBe_P-B Product feature CHAIN MF674438_HBe_P-B of FT:mat_peptide MF674438_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050023). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674443_HBe_P-B Product feature CHAIN MF674443_HBe_P-B of FT:mat_peptide MF674443_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050051). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFRLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674449_HBe_P-B Product feature CHAIN MF674449_HBe_P-B of FT:mat_peptide MF674449_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050060). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674451_HBe_P-B Product feature CHAIN MF674451_HBe_P-B of FT:mat_peptide MF674451_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050068). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674452_HBe_P-B Product feature CHAIN MF674452_HBe_P-B of FT:mat_peptide MF674452_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050071). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674453_HBe_P-B Product feature CHAIN MF674453_HBe_P-B of FT:mat_peptide MF674453_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050074). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674455_HBe_P-B Product feature CHAIN MF674455_HBe_P-B of FT:mat_peptide MF674455_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050077). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674456_HBe_P-B Product feature CHAIN MF674456_HBe_P-B of FT:mat_peptide MF674456_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050079). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674460_HBe_P-B Product feature CHAIN MF674460_HBe_P-B of FT:mat_peptide MF674460_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050083). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674462_HBe_P-B Product feature CHAIN MF674462_HBe_P-B of FT:mat_peptide MF674462_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV050085). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674469_HBe_P-B Product feature CHAIN MF674469_HBe_P-B of FT:mat_peptide MF674469_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVM0614). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674476_HBe_P-B Product feature CHAIN MF674476_HBe_P-B of FT:mat_peptide MF674476_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN02A0827). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISRSCPTVQASKLCLGWLWAMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674477_HBe_P-B Product feature CHAIN MF674477_HBe_P-B of FT:mat_peptide MF674477_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0023). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674479_HBe_P-B Product feature CHAIN MF674479_HBe_P-B of FT:mat_peptide MF674479_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0296). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674480_HBe_P-B Product feature CHAIN MF674480_HBe_P-B of FT:mat_peptide MF674480_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0313). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674481_HBe_P-B Product feature CHAIN MF674481_HBe_P-B of FT:mat_peptide MF674481_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0315). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674482_HBe_P-B Product feature CHAIN MF674482_HBe_P-B of FT:mat_peptide MF674482_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0321). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674483_HBe_P-B Product feature CHAIN MF674483_HBe_P-B of FT:mat_peptide MF674483_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0352). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674485_HBe_P-B Product feature CHAIN MF674485_HBe_P-B of FT:mat_peptide MF674485_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0438). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674487_HBe_P-B Product feature CHAIN MF674487_HBe_P-B of FT:mat_peptide MF674487_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN04A0864). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674488_HBe_P-B Product feature CHAIN MF674488_HBe_P-B of FT:mat_peptide MF674488_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05A0034). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674490_HBe_P-B Product feature CHAIN MF674490_HBe_P-B of FT:mat_peptide MF674490_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05A0515). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674493_HBe_P-B Product feature CHAIN MF674493_HBe_P-B of FT:mat_peptide MF674493_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0131). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|MF674495_HBe_P-B Product feature CHAIN MF674495_HBe_P-B of FT:mat_peptide MF674495_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0139). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674497_HBe_P-B Product feature CHAIN MF674497_HBe_P-B of FT:mat_peptide MF674497_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0141). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674500_HBe_P-B Product feature CHAIN MF674500_HBe_P-B of FT:mat_peptide MF674500_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0168). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674506_HBe_P-B Product feature CHAIN MF674506_HBe_P-B of FT:mat_peptide MF674506_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0217). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674507_HBe_P-B Product feature CHAIN MF674507_HBe_P-B of FT:mat_peptide MF674507_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0218). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674509_HBe_P-B Product feature CHAIN MF674509_HBe_P-B of FT:mat_peptide MF674509_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0226). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674510_HBe_P-B Product feature CHAIN MF674510_HBe_P-B of FT:mat_peptide MF674510_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0230). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674512_HBe_P-B Product feature CHAIN MF674512_HBe_P-B of FT:mat_peptide MF674512_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0250). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674513_HBe_P-B Product feature CHAIN MF674513_HBe_P-B of FT:mat_peptide MF674513_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0253). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF674515_HBe_P-B Product feature CHAIN MF674515_HBe_P-B of FT:mat_peptide MF674515_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VN05T0261). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571321_HBe_P-B Product feature CHAIN MG571321_HBe_P-B of FT:mat_peptide MG571321_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7049). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571322_HBe_P-B Product feature CHAIN MG571322_HBe_P-B of FT:mat_peptide MG571322_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8376). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571323_HBe_P-B Product feature CHAIN MG571323_HBe_P-B of FT:mat_peptide MG571323_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12324). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571327_HBe_P-B Product feature CHAIN MG571327_HBe_P-B of FT:mat_peptide MG571327_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 15035). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571328_HBe_P-B Product feature CHAIN MG571328_HBe_P-B of FT:mat_peptide MG571328_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 18612). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571331_HBe_P-B Product feature CHAIN MG571331_HBe_P-B of FT:mat_peptide MG571331_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19273). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MG571334_HBe_P-B Product feature CHAIN MG571334_HBe_P-B of FT:mat_peptide MG571334_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19727). Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571340_HBe_P-B Product feature CHAIN MG571340_HBe_P-B of FT:mat_peptide MG571340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21884). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571341_HBe_P-B Product feature CHAIN MG571341_HBe_P-B of FT:mat_peptide MG571341_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22174). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MG571342_HBe_P-B Product feature CHAIN MG571342_HBe_P-B of FT:mat_peptide MG571342_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22531). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571344_HBe_P-B Product feature CHAIN MG571344_HBe_P-B of FT:mat_peptide MG571344_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22732). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571346_HBe_P-B Product feature CHAIN MG571346_HBe_P-B of FT:mat_peptide MG571346_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23244). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571347_HBe_P-B Product feature CHAIN MG571347_HBe_P-B of FT:mat_peptide MG571347_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23305). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571348_HBe_P-B Product feature CHAIN MG571348_HBe_P-B of FT:mat_peptide MG571348_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23420). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571349_HBe_P-B Product feature CHAIN MG571349_HBe_P-B of FT:mat_peptide MG571349_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24177). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPTRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|MG571351_HBe_P-B Product feature CHAIN MG571351_HBe_P-B of FT:mat_peptide MG571351_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24924). Complete genome. [Hepadnaviridae] (length=212 residues).
TQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIPTPPA
YRPQNAPILSTLPETCVVRQRGRSTKRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571355_HBe_P-B Product feature CHAIN MG571355_HBe_P-B of FT:mat_peptide MG571355_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 28100). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571356_HBe_P-B Product feature CHAIN MG571356_HBe_P-B of FT:mat_peptide MG571356_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 28144). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571360_HBe_P-B Product feature CHAIN MG571360_HBe_P-B of FT:mat_peptide MG571360_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29978). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWMRTPPA
YRPQNAPILSTLPETTVIRQRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|MG571361_HBe_P-B Product feature CHAIN MG571361_HBe_P-B of FT:mat_peptide MG571361_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30357). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYQEALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571362_HBe_P-B Product feature CHAIN MG571362_HBe_P-B of FT:mat_peptide MG571362_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30671). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571364_HBe_P-B Product feature CHAIN MG571364_HBe_P-B of FT:mat_peptide MG571364_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30737). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MG571365_HBe_P-B Product feature CHAIN MG571365_HBe_P-B of FT:mat_peptide MG571365_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 30923). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571366_HBe_P-B Product feature CHAIN MG571366_HBe_P-B of FT:mat_peptide MG571366_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31042). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571368_HBe_P-B Product feature CHAIN MG571368_HBe_P-B of FT:mat_peptide MG571368_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31388). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIPTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPPRRRSKSPRRKRSQSRESQC
>gnl|hbvpro|MG571369_HBe_P-B Product feature CHAIN MG571369_HBe_P-B of FT:mat_peptide MG571369_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31608). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571371_HBe_P-B Product feature CHAIN MG571371_HBe_P-B of FT:mat_peptide MG571371_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31756). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG571374_HBe_P-B Product feature CHAIN MG571374_HBe_P-B of FT:mat_peptide MG571374_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32118). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG826152_HBe_P-B Product feature CHAIN MG826152_HBe_P-B of FT:mat_peptide MG826152_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YNKM70). Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTTAALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGGNLQDQASREAVVNYVNVNMGLKIRQLLWFHLSCITFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG826153_HBe_P-B Product feature CHAIN MG826153_HBe_P-B of FT:mat_peptide MG826153_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YNKM44H). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH061283_HBe_P-B Product feature CHAIN MH061283_HBe_P-B of FT:mat_peptide MH061283_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate t4-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH663473_HBe_P-B Product feature CHAIN MH663473_HBe_P-B of FT:mat_peptide MH663473_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 268). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK052962_HBe_P-B Product feature CHAIN MK052962_HBe_P-B of FT:mat_peptide MK052962_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NP137Q-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK052964_HBe_P-B Product feature CHAIN MK052964_HBe_P-B of FT:mat_peptide MK052964_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NP137Q-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK052965_HBe_P-B Product feature CHAIN MK052965_HBe_P-B of FT:mat_peptide MK052965_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NP137Q-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK075117_HBe_P-B Product feature CHAIN MK075117_HBe_P-B of FT:mat_peptide MK075117_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 667). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X97851_HBe_P-B Product feature CHAIN X97851_HBe_P-B of FT:mat_peptide X97851_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNANMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X98077_HBe_P-B Product feature CHAIN X98077_HBe_P-B of FT:mat_peptide X98077_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
© 1998-2019