HBVdb

Dataset for protein HBx of genotype B

[Download (right click)] [Alignment] [Repertoires]

2444 sequence(s)

>gnl|hbvpro|AB010289_HBx_P-B Product feature CHAIN AB010289_HBx_P-B of FT:mat_peptide AB010289_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB010290_HBx_P-B Product feature CHAIN AB010290_HBx_P-B of FT:mat_peptide AB010290_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB010291_HBx_P-B Product feature CHAIN AB010291_HBx_P-B of FT:mat_peptide AB010291_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB010292_HBx_P-B Product feature CHAIN AB010292_HBx_P-B of FT:mat_peptide AB010292_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB031266_HBx_P-B Product feature CHAIN AB031266_HBx_P-B of FT:mat_peptide AB031266_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB031267_HBx_P-B Product feature CHAIN AB031267_HBx_P-B of FT:mat_peptide AB031267_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMLTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033554_HBx_P-B Product feature CHAIN AB033554_HBx_P-B of FT:mat_peptide AB033554_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033555_HBx_P-B Product feature CHAIN AB033555_HBx_P-B of FT:mat_peptide AB033555_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB048705_HBx_P-B Product feature CHAIN AB048705_HBx_P-B of FT:mat_peptide AB048705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGDLPSPSASTVPTIDGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073821_HBx_P-B Product feature CHAIN AB073821_HBx_P-B of FT:mat_peptide AB073821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVSTXHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073822_HBx_P-B Product feature CHAIN AB073822_HBx_P-B of FT:mat_peptide AB073822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073823_HBx_P-B Product feature CHAIN AB073823_HBx_P-B of FT:mat_peptide AB073823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073824_HBx_P-B Product feature CHAIN AB073824_HBx_P-B of FT:mat_peptide AB073824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073825_HBx_P-B Product feature CHAIN AB073825_HBx_P-B of FT:mat_peptide AB073825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AB073826_HBx_P-B Product feature CHAIN AB073826_HBx_P-B of FT:mat_peptide AB073826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073827_HBx_P-B Product feature CHAIN AB073827_HBx_P-B of FT:mat_peptide AB073827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTKHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073828_HBx_P-B Product feature CHAIN AB073828_HBx_P-B of FT:mat_peptide AB073828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073829_HBx_P-B Product feature CHAIN AB073829_HBx_P-B of FT:mat_peptide AB073829_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073830_HBx_P-B Product feature CHAIN AB073830_HBx_P-B of FT:mat_peptide AB073830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSSRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073831_HBx_P-B Product feature CHAIN AB073831_HBx_P-B of FT:mat_peptide AB073831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGIPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073832_HBx_P-B Product feature CHAIN AB073832_HBx_P-B of FT:mat_peptide AB073832_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073833_HBx_P-B Product feature CHAIN AB073833_HBx_P-B of FT:mat_peptide AB073833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073834_HBx_P-B Product feature CHAIN AB073834_HBx_P-B of FT:mat_peptide AB073834_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073835_HBx_P-B Product feature CHAIN AB073835_HBx_P-B of FT:mat_peptide AB073835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073836_HBx_P-B Product feature CHAIN AB073836_HBx_P-B of FT:mat_peptide AB073836_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AB073837_HBx_P-B Product feature CHAIN AB073837_HBx_P-B of FT:mat_peptide AB073837_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073838_HBx_P-B Product feature CHAIN AB073838_HBx_P-B of FT:mat_peptide AB073838_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073839_HBx_P-B Product feature CHAIN AB073839_HBx_P-B of FT:mat_peptide AB073839_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073840_HBx_P-B Product feature CHAIN AB073840_HBx_P-B of FT:mat_peptide AB073840_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073841_HBx_P-B Product feature CHAIN AB073841_HBx_P-B of FT:mat_peptide AB073841_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073842_HBx_P-B Product feature CHAIN AB073842_HBx_P-B of FT:mat_peptide AB073842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGPLPPAFPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073843_HBx_P-B Product feature CHAIN AB073843_HBx_P-B of FT:mat_peptide AB073843_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLXKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073844_HBx_P-B Product feature CHAIN AB073844_HBx_P-B of FT:mat_peptide AB073844_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPATPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073845_HBx_P-B Product feature CHAIN AB073845_HBx_P-B of FT:mat_peptide AB073845_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073846_HBx_P-B Product feature CHAIN AB073846_HBx_P-B of FT:mat_peptide AB073846_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRRRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073847_HBx_P-B Product feature CHAIN AB073847_HBx_P-B of FT:mat_peptide AB073847_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073848_HBx_P-B Product feature CHAIN AB073848_HBx_P-B of FT:mat_peptide AB073848_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073849_HBx_P-B Product feature CHAIN AB073849_HBx_P-B of FT:mat_peptide AB073849_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSTPPCNFFTSA
>gnl|hbvpro|AB073850_HBx_P-B Product feature CHAIN AB073850_HBx_P-B of FT:mat_peptide AB073850_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPRNFFTSA
>gnl|hbvpro|AB073851_HBx_P-B Product feature CHAIN AB073851_HBx_P-B of FT:mat_peptide AB073851_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073852_HBx_P-B Product feature CHAIN AB073852_HBx_P-B of FT:mat_peptide AB073852_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEMGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073853_HBx_P-B Product feature CHAIN AB073853_HBx_P-B of FT:mat_peptide AB073853_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGDESRGRPLPGPLGALPPASPSAVPTDDGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEETRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AB073854_HBx_P-B Product feature CHAIN AB073854_HBx_P-B of FT:mat_peptide AB073854_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073855_HBx_P-B Product feature CHAIN AB073855_HBx_P-B of FT:mat_peptide AB073855_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVGAESCGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073856_HBx_P-B Product feature CHAIN AB073856_HBx_P-B of FT:mat_peptide AB073856_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry46). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEERRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073857_HBx_P-B Product feature CHAIN AB073857_HBx_P-B of FT:mat_peptide AB073857_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCKLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073858_HBx_P-B Product feature CHAIN AB073858_HBx_P-B of FT:mat_peptide AB073858_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKIYVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|AB100695_HBx_P-B Product feature CHAIN AB100695_HBx_P-B of FT:mat_peptide AB100695_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHGAHLSLRGLPVCAFSCAGPCALRFTSARRME
TTVNAHRILSKDLRTMTLELSGLSTSDLEAYFKDRVFTEWEELGEEIRLMIFVLGGCTHTLLFSPSPCNFLNSA
>gnl|hbvpro|AB104890_HBx_P-B Product feature CHAIN AB104890_HBx_P-B of FT:mat_peptide AB104890_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNDHRNLSKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCPPVPCNFFTSA
>gnl|hbvpro|AB104891_HBx_P-B Product feature CHAIN AB104891_HBx_P-B of FT:mat_peptide AB104891_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNDHRNLSKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLVCPPVPCNFFTSA
>gnl|hbvpro|AB106884_HBx_P-B Product feature CHAIN AB106884_HBx_P-B of FT:mat_peptide AB106884_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPPGAIPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHQNLPKVLHKRTLGLSAVSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB115551_HBx_P-B Product feature CHAIN AB115551_HBx_P-B of FT:mat_peptide AB115551_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHHTLRGLPVCLFSAAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|AB117759_HBx_P-B Product feature CHAIN AB117759_HBx_P-B of FT:mat_peptide AB117759_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195933_HBx_P-B Product feature CHAIN AB195933_HBx_P-B of FT:mat_peptide AB195933_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195934_HBx_P-B Product feature CHAIN AB195934_HBx_P-B of FT:mat_peptide AB195934_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195935_HBx_P-B Product feature CHAIN AB195935_HBx_P-B of FT:mat_peptide AB195935_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205119_HBx_P-B Product feature CHAIN AB205119_HBx_P-B of FT:mat_peptide AB205119_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205120_HBx_P-B Product feature CHAIN AB205120_HBx_P-B of FT:mat_peptide AB205120_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205121_HBx_P-B Product feature CHAIN AB205121_HBx_P-B of FT:mat_peptide AB205121_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLPGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVLFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205122_HBx_P-B Product feature CHAIN AB205122_HBx_P-B of FT:mat_peptide AB205122_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTADLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB212625_HBx_P-B Product feature CHAIN AB212625_HBx_P-B of FT:mat_peptide AB212625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB212626_HBx_P-B Product feature CHAIN AB212626_HBx_P-B of FT:mat_peptide AB212626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKILHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219426_HBx_P-B Product feature CHAIN AB219426_HBx_P-B of FT:mat_peptide AB219426_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTXNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219427_HBx_P-B Product feature CHAIN AB219427_HBx_P-B of FT:mat_peptide AB219427_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGAEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219428_HBx_C-B Product feature CHAIN AB219428_HBx_C-B of FT:mat_peptide AB219428_HBx_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219429_HBx_P-B Product feature CHAIN AB219429_HBx_P-B of FT:mat_peptide AB219429_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219430_HBx_P-B Product feature CHAIN AB219430_HBx_P-B of FT:mat_peptide AB219430_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB231909_HBx_P-B Product feature CHAIN AB231909_HBx_P-B of FT:mat_peptide AB231909_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCRQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB241116_HBx_P-B Product feature CHAIN AB241116_HBx_P-B of FT:mat_peptide AB241116_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB241117_HBx_P-B Product feature CHAIN AB241117_HBx_P-B of FT:mat_peptide AB241117_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246339_HBx_P-B Product feature CHAIN AB246339_HBx_P-B of FT:mat_peptide AB246339_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246340_HBx_P-B Product feature CHAIN AB246340_HBx_P-B of FT:mat_peptide AB246340_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246341_HBx_P-B Product feature CHAIN AB246341_HBx_P-B of FT:mat_peptide AB246341_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSACRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246342_HBx_P-B Product feature CHAIN AB246342_HBx_P-B of FT:mat_peptide AB246342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSPMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246343_HBx_P-B Product feature CHAIN AB246343_HBx_P-B of FT:mat_peptide AB246343_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSPMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRYKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287314_HBx_P-B Product feature CHAIN AB287314_HBx_P-B of FT:mat_peptide AB287314_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287315_HBx_P-B Product feature CHAIN AB287315_HBx_P-B of FT:mat_peptide AB287315_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287316_HBx_P-B Product feature CHAIN AB287316_HBx_P-B of FT:mat_peptide AB287316_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRSLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287317_HBx_P-B Product feature CHAIN AB287317_HBx_P-B of FT:mat_peptide AB287317_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287318_HBx_P-B Product feature CHAIN AB287318_HBx_P-B of FT:mat_peptide AB287318_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287319_HBx_P-B Product feature CHAIN AB287319_HBx_P-B of FT:mat_peptide AB287319_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFISARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287320_HBx_P-B Product feature CHAIN AB287320_HBx_P-B of FT:mat_peptide AB287320_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPPDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287321_HBx_P-B Product feature CHAIN AB287321_HBx_P-B of FT:mat_peptide AB287321_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287322_HBx_P-B Product feature CHAIN AB287322_HBx_P-B of FT:mat_peptide AB287322_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAYLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRSLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287323_HBx_P-B Product feature CHAIN AB287323_HBx_P-B of FT:mat_peptide AB287323_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287324_HBx_P-B Product feature CHAIN AB287324_HBx_P-B of FT:mat_peptide AB287324_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-5). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGAPPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287325_HBx_P-B Product feature CHAIN AB287325_HBx_P-B of FT:mat_peptide AB287325_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287326_HBx_P-B Product feature CHAIN AB287326_HBx_P-B of FT:mat_peptide AB287326_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287327_HBx_P-B Product feature CHAIN AB287327_HBx_P-B of FT:mat_peptide AB287327_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287328_HBx_P-B Product feature CHAIN AB287328_HBx_P-B of FT:mat_peptide AB287328_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287329_HBx_P-B Product feature CHAIN AB287329_HBx_P-B of FT:mat_peptide AB287329_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300364_HBx_P-B Product feature CHAIN AB300364_HBx_P-B of FT:mat_peptide AB300364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300370_HBx_P-B Product feature CHAIN AB300370_HBx_P-B of FT:mat_peptide AB300370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302095_HBx_P-B Product feature CHAIN AB302095_HBx_P-B of FT:mat_peptide AB302095_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEQGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302942_HBx_P-B Product feature CHAIN AB302942_HBx_P-B of FT:mat_peptide AB302942_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302943_HBx_P-B Product feature CHAIN AB302943_HBx_P-B of FT:mat_peptide AB302943_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302944_HBx_P-B Product feature CHAIN AB302944_HBx_P-B of FT:mat_peptide AB302944_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302945_HBx_P-B Product feature CHAIN AB302945_HBx_P-B of FT:mat_peptide AB302945_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB362933_HBx_P-B Product feature CHAIN AB362933_HBx_P-B of FT:mat_peptide AB362933_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRALPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB365445_HBx_P-B Product feature CHAIN AB365445_HBx_P-B of FT:mat_peptide AB365445_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB368295_HBx_P-B Product feature CHAIN AB368295_HBx_P-B of FT:mat_peptide AB368295_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSSASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471854_HBx_P-B Product feature CHAIN AB471854_HBx_P-B of FT:mat_peptide AB471854_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471855_HBx_P-B Product feature CHAIN AB471855_HBx_P-B of FT:mat_peptide AB471855_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493827_HBx_P-B Product feature CHAIN AB493827_HBx_P-B of FT:mat_peptide AB493827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVPGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493833_HBx_P-B Product feature CHAIN AB493833_HBx_P-B of FT:mat_peptide AB493833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493835_HBx_P-B Product feature CHAIN AB493835_HBx_P-B of FT:mat_peptide AB493835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB555498_HBx_P-B Product feature CHAIN AB555498_HBx_P-B of FT:mat_peptide AB555498_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|AB555499_HBx_P-B Product feature CHAIN AB555499_HBx_P-B of FT:mat_peptide AB555499_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSFRGLPVCAFSSAGPSALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGKEFRLMAFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642093_HBx_P-B Product feature CHAIN AB642093_HBx_P-B of FT:mat_peptide AB642093_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642094_HBx_P-B Product feature CHAIN AB642094_HBx_P-B of FT:mat_peptide AB642094_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642101_HBx_P-B Product feature CHAIN AB642101_HBx_P-B of FT:mat_peptide AB642101_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT2009-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB675676_HBx_P-B Product feature CHAIN AB675676_HBx_P-B of FT:mat_peptide AB675676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSSAPCNFFTSA
>gnl|hbvpro|AB713527_HBx_P-B Product feature CHAIN AB713527_HBx_P-B of FT:mat_peptide AB713527_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGTCALRFTSARRKE
NTVNAHRNLPQVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB713528_HBx_P-B Product feature CHAIN AB713528_HBx_P-B of FT:mat_peptide AB713528_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB713529_HBx_P-B Product feature CHAIN AB713529_HBx_P-B of FT:mat_peptide AB713529_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv68). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGTPVCAFSSAGPCALRFTSARRKE
TTVNAHWKLPQVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB713530_HBx_P-B Product feature CHAIN AB713530_HBx_P-B of FT:mat_peptide AB713530_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRRE
TTVNAHRNLPKVLHRRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFSTLAS
>gnl|hbvpro|AB713531_HBx_P-B Product feature CHAIN AB713531_HBx_P-B of FT:mat_peptide AB713531_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB828708_HBx_P-B Product feature CHAIN AB828708_HBx_P-B of FT:mat_peptide AB828708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HB12-0626). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AB900095_HBx_P-B Product feature CHAIN AB900095_HBx_P-B of FT:mat_peptide AB900095_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900097_HBx_P-B Product feature CHAIN AB900097_HBx_P-B of FT:mat_peptide AB900097_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVVCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900098_HBx_P-B Product feature CHAIN AB900098_HBx_P-B of FT:mat_peptide AB900098_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVXGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900102_HBx_P-B Product feature CHAIN AB900102_HBx_P-B of FT:mat_peptide AB900102_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSVMSTTDLEAYFKDCVFAEWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900103_HBx_P-B Product feature CHAIN AB900103_HBx_P-B of FT:mat_peptide AB900103_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900104_HBx_P-B Product feature CHAIN AB900104_HBx_P-B of FT:mat_peptide AB900104_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900105_HBx_P-B Product feature CHAIN AB900105_HBx_P-B of FT:mat_peptide AB900105_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900106_HBx_P-B Product feature CHAIN AB900106_HBx_P-B of FT:mat_peptide AB900106_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900107_HBx_P-B Product feature CHAIN AB900107_HBx_P-B of FT:mat_peptide AB900107_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCHFFTSA
>gnl|hbvpro|AB900108_HBx_P-B Product feature CHAIN AB900108_HBx_P-B of FT:mat_peptide AB900108_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900110_HBx_P-B Product feature CHAIN AB900110_HBx_P-B of FT:mat_peptide AB900110_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEGRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AB900111_HBx_P-B Product feature CHAIN AB900111_HBx_P-B of FT:mat_peptide AB900111_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLXXFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AB900112_HBx_P-B Product feature CHAIN AB900112_HBx_P-B of FT:mat_peptide AB900112_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRVE
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLXVFVLGGCRHKLVCSPAPRNFFTSA
>gnl|hbvpro|AB931168_HBx_P-B Product feature CHAIN AB931168_HBx_P-B of FT:mat_peptide AB931168_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEEMGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB931169_HBx_P-B Product feature CHAIN AB931169_HBx_P-B of FT:mat_peptide AB931169_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEEMGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB976562_HBx_P-B Product feature CHAIN AB976562_HBx_P-B of FT:mat_peptide AB976562_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTYHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEISEKVAWRWCSKHILLCSPESCNFLTYAL
>gnl|hbvpro|AF100308_HBx_P-B Product feature CHAIN AF100308_HBx_P-B of FT:mat_peptide AF100308_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF100309_HBx_P-B Product feature CHAIN AF100309_HBx_P-B of FT:mat_peptide AF100309_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121243_HBx_P-B Product feature CHAIN AF121243_HBx_P-B of FT:mat_peptide AF121243_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121244_HBx_P-B Product feature CHAIN AF121244_HBx_P-B of FT:mat_peptide AF121244_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121245_HBx_P-B Product feature CHAIN AF121245_HBx_P-B of FT:mat_peptide AF121245_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121246_HBx_P-B Product feature CHAIN AF121246_HBx_P-B of FT:mat_peptide AF121246_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121247_HBx_P-B Product feature CHAIN AF121247_HBx_P-B of FT:mat_peptide AF121247_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121248_HBx_P-B Product feature CHAIN AF121248_HBx_P-B of FT:mat_peptide AF121248_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121249_HBx_P-B Product feature CHAIN AF121249_HBx_P-B of FT:mat_peptide AF121249_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121250_HBx_P-B Product feature CHAIN AF121250_HBx_P-B of FT:mat_peptide AF121250_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121251_HBx_P-B Product feature CHAIN AF121251_HBx_P-B of FT:mat_peptide AF121251_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF282917_HBx_P-B Product feature CHAIN AF282917_HBx_P-B of FT:mat_peptide AF282917_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKALHKRTLGLSATSTTDLEAYFKDCVFTEWEELGEEVRFKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AF282918_HBx_P-B Product feature CHAIN AF282918_HBx_P-B of FT:mat_peptide AF282918_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDSVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF461360_HBx_P-B Product feature CHAIN AF461360_HBx_P-B of FT:mat_peptide AF461360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF479684_HBx_P-B Product feature CHAIN AF479684_HBx_P-B of FT:mat_peptide AF479684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AJ627225_HBx_P-B Product feature CHAIN AJ627225_HBx_P-B of FT:mat_peptide AJ627225_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AP011084_HBx_P-B Product feature CHAIN AP011084_HBx_P-B of FT:mat_peptide AP011084_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPTSPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011085_HBx_P-B Product feature CHAIN AP011085_HBx_P-B of FT:mat_peptide AP011085_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011086_HBx_P-B Product feature CHAIN AP011086_HBx_P-B of FT:mat_peptide AP011086_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011087_HBx_P-B Product feature CHAIN AP011087_HBx_P-B of FT:mat_peptide AP011087_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAVSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011088_HBx_P-B Product feature CHAIN AP011088_HBx_P-B of FT:mat_peptide AP011088_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLYLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011089_HBx_P-B Product feature CHAIN AP011089_HBx_P-B of FT:mat_peptide AP011089_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTIHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011090_HBx_P-B Product feature CHAIN AP011090_HBx_P-B of FT:mat_peptide AP011090_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011091_HBx_P-B Product feature CHAIN AP011091_HBx_P-B of FT:mat_peptide AP011091_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011092_HBx_P-B Product feature CHAIN AP011092_HBx_P-B of FT:mat_peptide AP011092_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDILCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011093_HBx_P-B Product feature CHAIN AP011093_HBx_P-B of FT:mat_peptide AP011093_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011094_HBx_P-B Product feature CHAIN AP011094_HBx_P-B of FT:mat_peptide AP011094_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011095_HBx_P-B Product feature CHAIN AP011095_HBx_P-B of FT:mat_peptide AP011095_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011096_HBx_P-B Product feature CHAIN AP011096_HBx_P-B of FT:mat_peptide AP011096_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY033072_HBx_P-B Product feature CHAIN AY033072_HBx_P-B of FT:mat_peptide AY033072_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY033073_HBx_P-B Product feature CHAIN AY033073_HBx_P-B of FT:mat_peptide AY033073_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY163869_HBx_P-B Product feature CHAIN AY163869_HBx_P-B of FT:mat_peptide AY163869_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY163870_HBx_P-B Product feature CHAIN AY163870_HBx_P-B of FT:mat_peptide AY163870_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167089_HBx_P-B Product feature CHAIN AY167089_HBx_P-B of FT:mat_peptide AY167089_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167093_HBx_P-B Product feature CHAIN AY167093_HBx_P-B of FT:mat_peptide AY167093_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPLVPTVNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGAEGRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167094_HBx_P-B Product feature CHAIN AY167094_HBx_P-B of FT:mat_peptide AY167094_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNGAHLSLRGLPVCAFSSTGPCALRFTSARRME
ATVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167097_HBx_P-B Product feature CHAIN AY167097_HBx_P-B of FT:mat_peptide AY167097_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167098_HBx_P-B Product feature CHAIN AY167098_HBx_P-B of FT:mat_peptide AY167098_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167100_HBx_P-B Product feature CHAIN AY167100_HBx_P-B of FT:mat_peptide AY167100_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167101_HBx_P-B Product feature CHAIN AY167101_HBx_P-B of FT:mat_peptide AY167101_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167102_HBx_P-B Product feature CHAIN AY167102_HBx_P-B of FT:mat_peptide AY167102_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPATPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AY206373_HBx_P-B Product feature CHAIN AY206373_HBx_P-B of FT:mat_peptide AY206373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHVNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AY206375_HBx_P-B Product feature CHAIN AY206375_HBx_P-B of FT:mat_peptide AY206375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206383_HBx_P-B Product feature CHAIN AY206383_HBx_P-B of FT:mat_peptide AY206383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206387_HBx_P-B Product feature CHAIN AY206387_HBx_P-B of FT:mat_peptide AY206387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEVGNEGRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206390_HBx_P-B Product feature CHAIN AY206390_HBx_P-B of FT:mat_peptide AY206390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206391_HBx_P-B Product feature CHAIN AY206391_HBx_P-B of FT:mat_peptide AY206391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217355_HBx_P-B Product feature CHAIN AY217355_HBx_P-B of FT:mat_peptide AY217355_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A6-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217356_HBx_P-B Product feature CHAIN AY217356_HBx_P-B of FT:mat_peptide AY217356_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217357_HBx_P-B Product feature CHAIN AY217357_HBx_P-B of FT:mat_peptide AY217357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217358_HBx_P-B Product feature CHAIN AY217358_HBx_P-B of FT:mat_peptide AY217358_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217359_HBx_P-B Product feature CHAIN AY217359_HBx_P-B of FT:mat_peptide AY217359_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217360_HBx_P-B Product feature CHAIN AY217360_HBx_P-B of FT:mat_peptide AY217360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217361_HBx_P-B Product feature CHAIN AY217361_HBx_P-B of FT:mat_peptide AY217361_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|AY217362_HBx_P-B Product feature CHAIN AY217362_HBx_P-B of FT:mat_peptide AY217362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLSKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|AY217364_HBx_P-B Product feature CHAIN AY217364_HBx_P-B of FT:mat_peptide AY217364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 586). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLRAVPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFLNSA
>gnl|hbvpro|AY217368_HBx_P-B Product feature CHAIN AY217368_HBx_P-B of FT:mat_peptide AY217368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21949). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220697_HBx_P-B Product feature CHAIN AY220697_HBx_P-B of FT:mat_peptide AY220697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEFKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220698_HBx_P-B Product feature CHAIN AY220698_HBx_P-B of FT:mat_peptide AY220698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220703_HBx_P-B Product feature CHAIN AY220703_HBx_P-B of FT:mat_peptide AY220703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220704_HBx_P-B Product feature CHAIN AY220704_HBx_P-B of FT:mat_peptide AY220704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY238972_HBx_P-B Product feature CHAIN AY238972_HBx_P-B of FT:mat_peptide AY238972_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU023). Partial genome (Contains: HBx, LHBs, MHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY283777_HBx_P-B Product feature CHAIN AY283777_HBx_P-B of FT:mat_peptide AY283777_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate spliced variant D-9). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLNPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLMCSPAPCNFFTSA
>gnl|hbvpro|AY293309_HBx_P-B Product feature CHAIN AY293309_HBx_P-B of FT:mat_peptide AY293309_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY310322_HBx_P-B Product feature CHAIN AY310322_HBx_P-B of FT:mat_peptide AY310322_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY518556_HBx_P-B Product feature CHAIN AY518556_HBx_P-B of FT:mat_peptide AY518556_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSATDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596102_HBx_P-B Product feature CHAIN AY596102_HBx_P-B of FT:mat_peptide AY596102_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596103_HBx_P-B Product feature CHAIN AY596103_HBx_P-B of FT:mat_peptide AY596103_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AY596104_HBx_P-B Product feature CHAIN AY596104_HBx_P-B of FT:mat_peptide AY596104_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNGAHLSLRGLPVCAFSSTGPCALRFTSARRME
ATVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596105_HBx_P-B Product feature CHAIN AY596105_HBx_P-B of FT:mat_peptide AY596105_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596106_HBx_P-B Product feature CHAIN AY596106_HBx_P-B of FT:mat_peptide AY596106_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596109_HBx_P-B Product feature CHAIN AY596109_HBx_P-B of FT:mat_peptide AY596109_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596110_HBx_P-B Product feature CHAIN AY596110_HBx_P-B of FT:mat_peptide AY596110_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596111_HBx_P-B Product feature CHAIN AY596111_HBx_P-B of FT:mat_peptide AY596111_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596112_HBx_P-B Product feature CHAIN AY596112_HBx_P-B of FT:mat_peptide AY596112_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY766463_HBx_P-B Product feature CHAIN AY766463_HBx_P-B of FT:mat_peptide AY766463_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY800389_HBx_P-B Product feature CHAIN AY800389_HBx_P-B of FT:mat_peptide AY800389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY800391_HBx_P-B Product feature CHAIN AY800391_HBx_P-B of FT:mat_peptide AY800391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY800392_HBx_P-B Product feature CHAIN AY800392_HBx_P-B of FT:mat_peptide AY800392_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D00329_HBx_P-B Product feature CHAIN D00329_HBx_P-B of FT:mat_peptide D00329_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D00330_HBx_P-B Product feature CHAIN D00330_HBx_P-B of FT:mat_peptide D00330_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D00331_HBx_C-B Product feature CHAIN D00331_HBx_C-B of FT:mat_peptide D00331_HBx_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAHFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D23678_HBx_P-B Product feature CHAIN D23678_HBx_P-B of FT:mat_peptide D23678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D23679_HBx_P-B Product feature CHAIN D23679_HBx_P-B of FT:mat_peptide D23679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNGHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50521_HBx_P-B Product feature CHAIN D50521_HBx_P-B of FT:mat_peptide D50521_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50522_HBx_P-B Product feature CHAIN D50522_HBx_P-B of FT:mat_peptide D50522_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ361535_HBx_P-B Product feature CHAIN DQ361535_HBx_P-B of FT:mat_peptide DQ361535_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLHPVSAESRGRPLSGPLGALPPTSPSVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377158_HBx_P-B Product feature CHAIN DQ377158_HBx_P-B of FT:mat_peptide DQ377158_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448619_HBx_P-B Product feature CHAIN DQ448619_HBx_P-B of FT:mat_peptide DQ448619_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448620_HBx_P-B Product feature CHAIN DQ448620_HBx_P-B of FT:mat_peptide DQ448620_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448621_HBx_P-B Product feature CHAIN DQ448621_HBx_P-B of FT:mat_peptide DQ448621_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448622_HBx_P-B Product feature CHAIN DQ448622_HBx_P-B of FT:mat_peptide DQ448622_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448623_HBx_P-B Product feature CHAIN DQ448623_HBx_P-B of FT:mat_peptide DQ448623_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448624_HBx_P-B Product feature CHAIN DQ448624_HBx_P-B of FT:mat_peptide DQ448624_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448625_HBx_P-B Product feature CHAIN DQ448625_HBx_P-B of FT:mat_peptide DQ448625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCTFFTSA
>gnl|hbvpro|DQ448626_HBx_P-B Product feature CHAIN DQ448626_HBx_P-B of FT:mat_peptide DQ448626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448627_HBx_P-B Product feature CHAIN DQ448627_HBx_P-B of FT:mat_peptide DQ448627_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448628_HBx_P-B Product feature CHAIN DQ448628_HBx_P-B of FT:mat_peptide DQ448628_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463787_HBx_P-B Product feature CHAIN DQ463787_HBx_P-B of FT:mat_peptide DQ463787_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSSMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463788_HBx_P-B Product feature CHAIN DQ463788_HBx_P-B of FT:mat_peptide DQ463788_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463789_HBx_P-B Product feature CHAIN DQ463789_HBx_P-B of FT:mat_peptide DQ463789_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463790_HBx_P-B Product feature CHAIN DQ463790_HBx_P-B of FT:mat_peptide DQ463790_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463791_HBx_P-B Product feature CHAIN DQ463791_HBx_P-B of FT:mat_peptide DQ463791_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVAAESRGRPLSGTLGAVPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSTMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463792_HBx_P-B Product feature CHAIN DQ463792_HBx_P-B of FT:mat_peptide DQ463792_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463793_HBx_P-B Product feature CHAIN DQ463793_HBx_P-B of FT:mat_peptide DQ463793_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463794_HBx_P-B Product feature CHAIN DQ463794_HBx_P-B of FT:mat_peptide DQ463794_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463795_HBx_P-B Product feature CHAIN DQ463795_HBx_P-B of FT:mat_peptide DQ463795_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSSMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463796_HBx_P-B Product feature CHAIN DQ463796_HBx_P-B of FT:mat_peptide DQ463796_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463797_HBx_P-B Product feature CHAIN DQ463797_HBx_P-B of FT:mat_peptide DQ463797_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463798_HBx_P-B Product feature CHAIN DQ463798_HBx_P-B of FT:mat_peptide DQ463798_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463799_HBx_P-B Product feature CHAIN DQ463799_HBx_P-B of FT:mat_peptide DQ463799_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463800_HBx_P-B Product feature CHAIN DQ463800_HBx_P-B of FT:mat_peptide DQ463800_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463801_HBx_P-B Product feature CHAIN DQ463801_HBx_P-B of FT:mat_peptide DQ463801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463802_HBx_P-B Product feature CHAIN DQ463802_HBx_P-B of FT:mat_peptide DQ463802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ904357_HBx_P-B Product feature CHAIN DQ904357_HBx_P-B of FT:mat_peptide DQ904357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ975271_HBx_P-B Product feature CHAIN DQ975271_HBx_P-B of FT:mat_peptide DQ975271_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993680_HBx_P-B Product feature CHAIN DQ993680_HBx_P-B of FT:mat_peptide DQ993680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993681_HBx_P-B Product feature CHAIN DQ993681_HBx_P-B of FT:mat_peptide DQ993681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTKVLHKRTLGLSAMSTTDLETYFKDCVFTEWEELGEEXRXKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993682_HBx_P-B Product feature CHAIN DQ993682_HBx_P-B of FT:mat_peptide DQ993682_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 479). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLXKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993683_HBx_P-B Product feature CHAIN DQ993683_HBx_P-B of FT:mat_peptide DQ993683_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNXHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993684_HBx_P-B Product feature CHAIN DQ993684_HBx_P-B of FT:mat_peptide DQ993684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993685_HBx_P-B Product feature CHAIN DQ993685_HBx_P-B of FT:mat_peptide DQ993685_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEXGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993686_HBx_P-B Product feature CHAIN DQ993686_HBx_P-B of FT:mat_peptide DQ993686_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIXLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993687_HBx_P-B Product feature CHAIN DQ993687_HBx_P-B of FT:mat_peptide DQ993687_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGXEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993694_HBx_P-B Product feature CHAIN DQ993694_HBx_P-B of FT:mat_peptide DQ993694_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 234). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAXFKDCVFAEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993696_HBx_P-B Product feature CHAIN DQ993696_HBx_P-B of FT:mat_peptide DQ993696_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|DQ993697_HBx_P-B Product feature CHAIN DQ993697_HBx_P-B of FT:mat_peptide DQ993697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKXTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|DQ993698_HBx_P-B Product feature CHAIN DQ993698_HBx_P-B of FT:mat_peptide DQ993698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|DQ993699_HBx_P-B Product feature CHAIN DQ993699_HBx_P-B of FT:mat_peptide DQ993699_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|DQ993700_HBx_P-B Product feature CHAIN DQ993700_HBx_P-B of FT:mat_peptide DQ993700_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993701_HBx_P-B Product feature CHAIN DQ993701_HBx_P-B of FT:mat_peptide DQ993701_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993702_HBx_P-B Product feature CHAIN DQ993702_HBx_P-B of FT:mat_peptide DQ993702_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESPVLPLPGLLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993703_HBx_P-B Product feature CHAIN DQ993703_HBx_P-B of FT:mat_peptide DQ993703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993704_HBx_P-B Product feature CHAIN DQ993704_HBx_P-B of FT:mat_peptide DQ993704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993705_HBx_P-B Product feature CHAIN DQ993705_HBx_P-B of FT:mat_peptide DQ993705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993706_HBx_P-B Product feature CHAIN DQ993706_HBx_P-B of FT:mat_peptide DQ993706_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993707_HBx_P-B Product feature CHAIN DQ993707_HBx_P-B of FT:mat_peptide DQ993707_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993708_HBx_P-B Product feature CHAIN DQ993708_HBx_P-B of FT:mat_peptide DQ993708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993709_HBx_P-B Product feature CHAIN DQ993709_HBx_P-B of FT:mat_peptide DQ993709_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993710_HBx_P-B Product feature CHAIN DQ993710_HBx_P-B of FT:mat_peptide DQ993710_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|DQ993711_HBx_P-B Product feature CHAIN DQ993711_HBx_P-B of FT:mat_peptide DQ993711_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPDVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
ATVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ995802_HBx_P-B Product feature CHAIN DQ995802_HBx_P-B of FT:mat_peptide DQ995802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ995803_HBx_P-B Product feature CHAIN DQ995803_HBx_P-B of FT:mat_peptide DQ995803_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C265-15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSSMSTTDLEAYFKDCVFTEWEELGVEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|DQ995804_HBx_P-B Product feature CHAIN DQ995804_HBx_P-B of FT:mat_peptide DQ995804_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ995805_HBx_P-B Product feature CHAIN DQ995805_HBx_P-B of FT:mat_peptide DQ995805_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-2.5KB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDHARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EF134945_HBx_P-B Product feature CHAIN EF134945_HBx_P-B of FT:mat_peptide EF134945_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF134946_HBx_P-B Product feature CHAIN EF134946_HBx_P-B of FT:mat_peptide EF134946_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473971_HBx_P-B Product feature CHAIN EF473971_HBx_P-B of FT:mat_peptide EF473971_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPAAVPTDHGAHLSLRGLPGCAFSSAGPGALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIMLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473972_HBx_P-B Product feature CHAIN EF473972_HBx_P-B of FT:mat_peptide EF473972_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473973_HBx_P-B Product feature CHAIN EF473973_HBx_P-B of FT:mat_peptide EF473973_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473974_HBx_P-B Product feature CHAIN EF473974_HBx_P-B of FT:mat_peptide EF473974_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPSALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCGFNEWEELGEEVRLKVFVLGGCRHKLLCSPAPCNFFTSA
>gnl|hbvpro|EF473975_HBx_P-B Product feature CHAIN EF473975_HBx_P-B of FT:mat_peptide EF473975_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473976_HBx_P-B Product feature CHAIN EF473976_HBx_P-B of FT:mat_peptide EF473976_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473977_HBx_P-B Product feature CHAIN EF473977_HBx_P-B of FT:mat_peptide EF473977_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494380_HBx_P-B Product feature CHAIN EF494380_HBx_P-B of FT:mat_peptide EF494380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494381_HBx_P-B Product feature CHAIN EF494381_HBx_P-B of FT:mat_peptide EF494381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKALHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494382_HBx_P-B Product feature CHAIN EF494382_HBx_P-B of FT:mat_peptide EF494382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRTLPKVLHERTIGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043342_HBx_P-B Product feature CHAIN EU043342_HBx_P-B of FT:mat_peptide EU043342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-2). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043343_HBx_P-B Product feature CHAIN EU043343_HBx_P-B of FT:mat_peptide EU043343_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-5). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043344_HBx_P-B Product feature CHAIN EU043344_HBx_P-B of FT:mat_peptide EU043344_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-14). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKGCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043345_HBx_P-B Product feature CHAIN EU043345_HBx_P-B of FT:mat_peptide EU043345_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-20). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKGCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU139543_HBx_P-B Product feature CHAIN EU139543_HBx_P-B of FT:mat_peptide EU139543_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU158263_HBx_P-B Product feature CHAIN EU158263_HBx_P-B of FT:mat_peptide EU158263_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU305547_HBx_P-B Product feature CHAIN EU305547_HBx_P-B of FT:mat_peptide EU305547_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVSHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU305548_HBx_P-B Product feature CHAIN EU305548_HBx_P-B of FT:mat_peptide EU305548_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLRKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306677_HBx_P-B Product feature CHAIN EU306677_HBx_P-B of FT:mat_peptide EU306677_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306678_HBx_P-B Product feature CHAIN EU306678_HBx_P-B of FT:mat_peptide EU306678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306679_HBx_P-B Product feature CHAIN EU306679_HBx_P-B of FT:mat_peptide EU306679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306680_HBx_P-B Product feature CHAIN EU306680_HBx_P-B of FT:mat_peptide EU306680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306681_HBx_P-B Product feature CHAIN EU306681_HBx_P-B of FT:mat_peptide EU306681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306695_HBx_P-B Product feature CHAIN EU306695_HBx_P-B of FT:mat_peptide EU306695_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306696_HBx_P-B Product feature CHAIN EU306696_HBx_P-B of FT:mat_peptide EU306696_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306697_HBx_P-B Product feature CHAIN EU306697_HBx_P-B of FT:mat_peptide EU306697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306698_HBx_P-B Product feature CHAIN EU306698_HBx_P-B of FT:mat_peptide EU306698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306699_HBx_P-B Product feature CHAIN EU306699_HBx_P-B of FT:mat_peptide EU306699_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVWHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306700_HBx_P-B Product feature CHAIN EU306700_HBx_P-B of FT:mat_peptide EU306700_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCLPAPCNFFTSA
>gnl|hbvpro|EU306701_HBx_P-B Product feature CHAIN EU306701_HBx_P-B of FT:mat_peptide EU306701_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306702_HBx_P-B Product feature CHAIN EU306702_HBx_P-B of FT:mat_peptide EU306702_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306703_HBx_P-B Product feature CHAIN EU306703_HBx_P-B of FT:mat_peptide EU306703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306704_HBx_P-B Product feature CHAIN EU306704_HBx_P-B of FT:mat_peptide EU306704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306705_HBx_P-B Product feature CHAIN EU306705_HBx_P-B of FT:mat_peptide EU306705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306706_HBx_P-B Product feature CHAIN EU306706_HBx_P-B of FT:mat_peptide EU306706_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306707_HBx_P-B Product feature CHAIN EU306707_HBx_P-B of FT:mat_peptide EU306707_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306708_HBx_P-B Product feature CHAIN EU306708_HBx_P-B of FT:mat_peptide EU306708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306709_HBx_P-B Product feature CHAIN EU306709_HBx_P-B of FT:mat_peptide EU306709_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306710_HBx_P-B Product feature CHAIN EU306710_HBx_P-B of FT:mat_peptide EU306710_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306711_HBx_P-B Product feature CHAIN EU306711_HBx_P-B of FT:mat_peptide EU306711_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306712_HBx_P-B Product feature CHAIN EU306712_HBx_P-B of FT:mat_peptide EU306712_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330989_HBx_P-B Product feature CHAIN EU330989_HBx_P-B of FT:mat_peptide EU330989_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330990_HBx_P-B Product feature CHAIN EU330990_HBx_P-B of FT:mat_peptide EU330990_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330992_HBx_P-B Product feature CHAIN EU330992_HBx_P-B of FT:mat_peptide EU330992_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330994_HBx_P-B Product feature CHAIN EU330994_HBx_P-B of FT:mat_peptide EU330994_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCASSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330995_HBx_P-B Product feature CHAIN EU330995_HBx_P-B of FT:mat_peptide EU330995_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330996_HBx_P-B Product feature CHAIN EU330996_HBx_P-B of FT:mat_peptide EU330996_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCTLRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330997_HBx_P-B Product feature CHAIN EU330997_HBx_P-B of FT:mat_peptide EU330997_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330998_HBx_P-B Product feature CHAIN EU330998_HBx_P-B of FT:mat_peptide EU330998_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330999_HBx_P-B Product feature CHAIN EU330999_HBx_P-B of FT:mat_peptide EU330999_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU331000_HBx_P-B Product feature CHAIN EU331000_HBx_P-B of FT:mat_peptide EU331000_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU331001_HBx_P-B Product feature CHAIN EU331001_HBx_P-B of FT:mat_peptide EU331001_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU350409_HBx_P-B Product feature CHAIN EU350409_HBx_P-B of FT:mat_peptide EU350409_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAACNFFTSA
>gnl|hbvpro|EU439018_HBx_P-B Product feature CHAIN EU439018_HBx_P-B of FT:mat_peptide EU439018_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRAPGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439020_HBx_P-B Product feature CHAIN EU439020_HBx_P-B of FT:mat_peptide EU439020_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439021_HBx_P-B Product feature CHAIN EU439021_HBx_P-B of FT:mat_peptide EU439021_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSX
>gnl|hbvpro|EU439022_HBx_P-B Product feature CHAIN EU439022_HBx_P-B of FT:mat_peptide EU439022_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439023_HBx_P-B Product feature CHAIN EU439023_HBx_P-B of FT:mat_peptide EU439023_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPEPCNFFTSA
>gnl|hbvpro|EU487256_HBx_P-B Product feature CHAIN EU487256_HBx_P-B of FT:mat_peptide EU487256_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU487257_HBx_P-B Product feature CHAIN EU487257_HBx_P-B of FT:mat_peptide EU487257_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522066_HBx_P-B Product feature CHAIN EU522066_HBx_P-B of FT:mat_peptide EU522066_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4N). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522067_HBx_P-B Product feature CHAIN EU522067_HBx_P-B of FT:mat_peptide EU522067_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVLFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522072_HBx_P-B Product feature CHAIN EU522072_HBx_P-B of FT:mat_peptide EU522072_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU522073_HBx_P-B Product feature CHAIN EU522073_HBx_P-B of FT:mat_peptide EU522073_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU522074_HBx_P-B Product feature CHAIN EU522074_HBx_P-B of FT:mat_peptide EU522074_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU522075_HBx_P-B Product feature CHAIN EU522075_HBx_P-B of FT:mat_peptide EU522075_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU547563_HBx_P-B Product feature CHAIN EU547563_HBx_P-B of FT:mat_peptide EU547563_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU564822_HBx_P-B Product feature CHAIN EU564822_HBx_P-B of FT:mat_peptide EU564822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU564823_HBx_P-B Product feature CHAIN EU564823_HBx_P-B of FT:mat_peptide EU564823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU564824_HBx_P-B Product feature CHAIN EU564824_HBx_P-B of FT:mat_peptide EU564824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU564826_HBx_P-B Product feature CHAIN EU564826_HBx_P-B of FT:mat_peptide EU564826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU570069_HBx_P-B Product feature CHAIN EU570069_HBx_P-B of FT:mat_peptide EU570069_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAVSRGRPLPGPLGALPPASPPVVPTDLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHGNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570071_HBx_P-B Product feature CHAIN EU570071_HBx_P-B of FT:mat_peptide EU570071_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570075_HBx_P-B Product feature CHAIN EU570075_HBx_P-B of FT:mat_peptide EU570075_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHPSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU579441_HBx_P-B Product feature CHAIN EU579441_HBx_P-B of FT:mat_peptide EU579441_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU589335_HBx_P-B Product feature CHAIN EU589335_HBx_P-B of FT:mat_peptide EU589335_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU595031_HBx_P-B Product feature CHAIN EU595031_HBx_P-B of FT:mat_peptide EU595031_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLRKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660224_HBx_P-B Product feature CHAIN EU660224_HBx_P-B of FT:mat_peptide EU660224_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660230_HBx_P-B Product feature CHAIN EU660230_HBx_P-B of FT:mat_peptide EU660230_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660231_HBx_P-B Product feature CHAIN EU660231_HBx_P-B of FT:mat_peptide EU660231_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660232_HBx_P-B Product feature CHAIN EU660232_HBx_P-B of FT:mat_peptide EU660232_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660233_HBx_P-B Product feature CHAIN EU660233_HBx_P-B of FT:mat_peptide EU660233_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796066_HBx_P-B Product feature CHAIN EU796066_HBx_P-B of FT:mat_peptide EU796066_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKNCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796067_HBx_P-B Product feature CHAIN EU796067_HBx_P-B of FT:mat_peptide EU796067_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLGPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796068_HBx_P-B Product feature CHAIN EU796068_HBx_P-B of FT:mat_peptide EU796068_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796071_HBx_P-B Product feature CHAIN EU796071_HBx_P-B of FT:mat_peptide EU796071_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU881997_HBx_P-B Product feature CHAIN EU881997_HBx_P-B of FT:mat_peptide EU881997_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU881998_HBx_P-B Product feature CHAIN EU881998_HBx_P-B of FT:mat_peptide EU881998_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882002_HBx_P-B Product feature CHAIN EU882002_HBx_P-B of FT:mat_peptide EU882002_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882003_HBx_P-B Product feature CHAIN EU882003_HBx_P-B of FT:mat_peptide EU882003_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882004_HBx_P-B Product feature CHAIN EU882004_HBx_P-B of FT:mat_peptide EU882004_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919171_HBx_P-B Product feature CHAIN EU919171_HBx_P-B of FT:mat_peptide EU919171_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRPPAPCNFFTSA
>gnl|hbvpro|EU919172_HBx_P-B Product feature CHAIN EU919172_HBx_P-B of FT:mat_peptide EU919172_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919173_HBx_P-B Product feature CHAIN EU919173_HBx_P-B of FT:mat_peptide EU919173_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919175_HBx_P-B Product feature CHAIN EU919175_HBx_P-B of FT:mat_peptide EU919175_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDPWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919176_HBx_P-B Product feature CHAIN EU919176_HBx_P-B of FT:mat_peptide EU919176_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDPWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939559_HBx_P-B Product feature CHAIN EU939559_HBx_P-B of FT:mat_peptide EU939559_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGVEGRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|EU939633_HBx_P-B Product feature CHAIN EU939633_HBx_P-B of FT:mat_peptide EU939633_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939634_HBx_P-B Product feature CHAIN EU939634_HBx_P-B of FT:mat_peptide EU939634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRAKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939636_HBx_P-B Product feature CHAIN EU939636_HBx_P-B of FT:mat_peptide EU939636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939637_HBx_P-B Product feature CHAIN EU939637_HBx_P-B of FT:mat_peptide EU939637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MVGRLYFQLDPARDVLFLRPVGDESRGRPFPGPLGDLPSASPPVVLTDHGAHLSLRGFPVCALSSAGPCALRFPSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLQAYFQDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939638_HBx_P-B Product feature CHAIN EU939638_HBx_P-B of FT:mat_peptide EU939638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939639_HBx_P-B Product feature CHAIN EU939639_HBx_P-B of FT:mat_peptide EU939639_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939660_HBx_P-B Product feature CHAIN EU939660_HBx_P-B of FT:mat_peptide EU939660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C34). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDGEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939661_HBx_P-B Product feature CHAIN EU939661_HBx_P-B of FT:mat_peptide EU939661_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRLCCQLDTARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939663_HBx_P-B Product feature CHAIN EU939663_HBx_P-B of FT:mat_peptide EU939663_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFMEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939664_HBx_P-B Product feature CHAIN EU939664_HBx_P-B of FT:mat_peptide EU939664_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU939665_HBx_P-B Product feature CHAIN EU939665_HBx_P-B of FT:mat_peptide EU939665_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939666_HBx_P-B Product feature CHAIN EU939666_HBx_P-B of FT:mat_peptide EU939666_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939667_HBx_P-B Product feature CHAIN EU939667_HBx_P-B of FT:mat_peptide EU939667_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939669_HBx_P-B Product feature CHAIN EU939669_HBx_P-B of FT:mat_peptide EU939669_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLXKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU939670_HBx_P-B Product feature CHAIN EU939670_HBx_P-B of FT:mat_peptide EU939670_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU939671_HBx_P-B Product feature CHAIN EU939671_HBx_P-B of FT:mat_peptide EU939671_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C201). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939672_HBx_P-B Product feature CHAIN EU939672_HBx_P-B of FT:mat_peptide EU939672_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939673_HBx_P-B Product feature CHAIN EU939673_HBx_P-B of FT:mat_peptide EU939673_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939674_HBx_P-B Product feature CHAIN EU939674_HBx_P-B of FT:mat_peptide EU939674_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939675_HBx_P-B Product feature CHAIN EU939675_HBx_P-B of FT:mat_peptide EU939675_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFNEWEEMGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939676_HBx_P-B Product feature CHAIN EU939676_HBx_P-B of FT:mat_peptide EU939676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939677_HBx_P-B Product feature CHAIN EU939677_HBx_P-B of FT:mat_peptide EU939677_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTEHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPWNFFTSA
>gnl|hbvpro|EU939678_HBx_P-B Product feature CHAIN EU939678_HBx_P-B of FT:mat_peptide EU939678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939679_HBx_P-B Product feature CHAIN EU939679_HBx_P-B of FT:mat_peptide EU939679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D134). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023631_HBx_P-B Product feature CHAIN FJ023631_HBx_P-B of FT:mat_peptide FJ023631_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPLPGPLGPVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023632_HBx_P-B Product feature CHAIN FJ023632_HBx_P-B of FT:mat_peptide FJ023632_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLCPVGAESRGRPLPGPLGAVPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023633_HBx_P-B Product feature CHAIN FJ023633_HBx_P-B of FT:mat_peptide FJ023633_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023634_HBx_P-B Product feature CHAIN FJ023634_HBx_P-B of FT:mat_peptide FJ023634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023635_HBx_P-B Product feature CHAIN FJ023635_HBx_P-B of FT:mat_peptide FJ023635_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023636_HBx_P-B Product feature CHAIN FJ023636_HBx_P-B of FT:mat_peptide FJ023636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAVSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023637_HBx_P-B Product feature CHAIN FJ023637_HBx_P-B of FT:mat_peptide FJ023637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023638_HBx_P-B Product feature CHAIN FJ023638_HBx_P-B of FT:mat_peptide FJ023638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPATPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWTLPKVLHKRTIGLSPMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032342_HBx_P-B Product feature CHAIN FJ032342_HBx_P-B of FT:mat_peptide FJ032342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVIAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032344_HBx_P-B Product feature CHAIN FJ032344_HBx_P-B of FT:mat_peptide FJ032344_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=154 residues).
LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVIAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032349_HBx_P-B Product feature CHAIN FJ032349_HBx_P-B of FT:mat_peptide FJ032349_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032353_HBx_P-B Product feature CHAIN FJ032353_HBx_P-B of FT:mat_peptide FJ032353_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSS
>gnl|hbvpro|FJ032354_HBx_P-B Product feature CHAIN FJ032354_HBx_P-B of FT:mat_peptide FJ032354_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTLSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032357_HBx_P-B Product feature CHAIN FJ032357_HBx_P-B of FT:mat_peptide FJ032357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032358_HBx_P-B Product feature CHAIN FJ032358_HBx_P-B of FT:mat_peptide FJ032358_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGRRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ349236_HBx_P-B Product feature CHAIN FJ349236_HBx_P-B of FT:mat_peptide FJ349236_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386582_HBx_P-B Product feature CHAIN FJ386582_HBx_P-B of FT:mat_peptide FJ386582_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386583_HBx_P-B Product feature CHAIN FJ386583_HBx_P-B of FT:mat_peptide FJ386583_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGHLSPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVKDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386584_HBx_P-B Product feature CHAIN FJ386584_HBx_P-B of FT:mat_peptide FJ386584_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386600_HBx_P-B Product feature CHAIN FJ386600_HBx_P-B of FT:mat_peptide FJ386600_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386608_HBx_P-B Product feature CHAIN FJ386608_HBx_P-B of FT:mat_peptide FJ386608_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386610_HBx_P-B Product feature CHAIN FJ386610_HBx_P-B of FT:mat_peptide FJ386610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDDGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386615_HBx_P-B Product feature CHAIN FJ386615_HBx_P-B of FT:mat_peptide FJ386615_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ386634_HBx_P-B Product feature CHAIN FJ386634_HBx_P-B of FT:mat_peptide FJ386634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLGCSPAPCNFFTSA
>gnl|hbvpro|FJ386636_HBx_P-B Product feature CHAIN FJ386636_HBx_P-B of FT:mat_peptide FJ386636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386642_HBx_P-B Product feature CHAIN FJ386642_HBx_P-B of FT:mat_peptide FJ386642_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386648_HBx_P-B Product feature CHAIN FJ386648_HBx_P-B of FT:mat_peptide FJ386648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPXXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEVRLMIFVLGGCSNKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ386654_HBx_P-B Product feature CHAIN FJ386654_HBx_P-B of FT:mat_peptide FJ386654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386655_HBx_P-B Product feature CHAIN FJ386655_HBx_P-B of FT:mat_peptide FJ386655_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386656_HBx_P-B Product feature CHAIN FJ386656_HBx_P-B of FT:mat_peptide FJ386656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCSNKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386658_HBx_P-B Product feature CHAIN FJ386658_HBx_P-B of FT:mat_peptide FJ386658_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386660_HBx_P-B Product feature CHAIN FJ386660_HBx_P-B of FT:mat_peptide FJ386660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLGCSPAPCNFFTSA
>gnl|hbvpro|FJ386666_HBx_P-B Product feature CHAIN FJ386666_HBx_P-B of FT:mat_peptide FJ386666_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386668_HBx_P-B Product feature CHAIN FJ386668_HBx_P-B of FT:mat_peptide FJ386668_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGDEVRLRNYVLGGCRDKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386669_HBx_P-B Product feature CHAIN FJ386669_HBx_P-B of FT:mat_peptide FJ386669_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386675_HBx_P-B Product feature CHAIN FJ386675_HBx_P-B of FT:mat_peptide FJ386675_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386676_HBx_P-B Product feature CHAIN FJ386676_HBx_P-B of FT:mat_peptide FJ386676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386680_HBx_P-B Product feature CHAIN FJ386680_HBx_P-B of FT:mat_peptide FJ386680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1244). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYIKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ386681_HBx_P-B Product feature CHAIN FJ386681_HBx_P-B of FT:mat_peptide FJ386681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386682_HBx_P-B Product feature CHAIN FJ386682_HBx_P-B of FT:mat_peptide FJ386682_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386683_HBx_P-B Product feature CHAIN FJ386683_HBx_P-B of FT:mat_peptide FJ386683_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386684_HBx_P-B Product feature CHAIN FJ386684_HBx_P-B of FT:mat_peptide FJ386684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386688_HBx_P-B Product feature CHAIN FJ386688_HBx_P-B of FT:mat_peptide FJ386688_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGSLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ518811_HBx_P-B Product feature CHAIN FJ518811_HBx_P-B of FT:mat_peptide FJ518811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ518812_HBx_P-B Product feature CHAIN FJ518812_HBx_P-B of FT:mat_peptide FJ518812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRSLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562219_HBx_P-B Product feature CHAIN FJ562219_HBx_P-B of FT:mat_peptide FJ562219_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562222_HBx_P-B Product feature CHAIN FJ562222_HBx_P-B of FT:mat_peptide FJ562222_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562224_HBx_P-B Product feature CHAIN FJ562224_HBx_P-B of FT:mat_peptide FJ562224_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSXMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562231_HBx_P-B Product feature CHAIN FJ562231_HBx_P-B of FT:mat_peptide FJ562231_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562234_HBx_P-B Product feature CHAIN FJ562234_HBx_P-B of FT:mat_peptide FJ562234_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562236_HBx_P-B Product feature CHAIN FJ562236_HBx_P-B of FT:mat_peptide FJ562236_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562237_HBx_P-B Product feature CHAIN FJ562237_HBx_P-B of FT:mat_peptide FJ562237_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562240_HBx_P-B Product feature CHAIN FJ562240_HBx_P-B of FT:mat_peptide FJ562240_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562246_HBx_P-B Product feature CHAIN FJ562246_HBx_P-B of FT:mat_peptide FJ562246_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562253_HBx_P-B Product feature CHAIN FJ562253_HBx_P-B of FT:mat_peptide FJ562253_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562254_HBx_P-B Product feature CHAIN FJ562254_HBx_P-B of FT:mat_peptide FJ562254_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562257_HBx_P-B Product feature CHAIN FJ562257_HBx_P-B of FT:mat_peptide FJ562257_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLSPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562259_HBx_P-B Product feature CHAIN FJ562259_HBx_P-B of FT:mat_peptide FJ562259_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562260_HBx_P-B Product feature CHAIN FJ562260_HBx_P-B of FT:mat_peptide FJ562260_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562262_HBx_P-B Product feature CHAIN FJ562262_HBx_P-B of FT:mat_peptide FJ562262_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I111). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562289_HBx_P-B Product feature CHAIN FJ562289_HBx_P-B of FT:mat_peptide FJ562289_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562296_HBx_P-B Product feature CHAIN FJ562296_HBx_P-B of FT:mat_peptide FJ562296_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562303_HBx_P-B Product feature CHAIN FJ562303_HBx_P-B of FT:mat_peptide FJ562303_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562311_HBx_P-B Product feature CHAIN FJ562311_HBx_P-B of FT:mat_peptide FJ562311_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562312_HBx_P-B Product feature CHAIN FJ562312_HBx_P-B of FT:mat_peptide FJ562312_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPASCNFFTSA
>gnl|hbvpro|FJ562316_HBx_P-B Product feature CHAIN FJ562316_HBx_P-B of FT:mat_peptide FJ562316_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562321_HBx_P-B Product feature CHAIN FJ562321_HBx_P-B of FT:mat_peptide FJ562321_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I214). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562322_HBx_P-B Product feature CHAIN FJ562322_HBx_P-B of FT:mat_peptide FJ562322_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ751769_HBx_P-B Product feature CHAIN FJ751769_HBx_P-B of FT:mat_peptide FJ751769_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ755833_HBx_P-B Product feature CHAIN FJ755833_HBx_P-B of FT:mat_peptide FJ755833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
GLSRLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVLTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787444_HBx_P-B Product feature CHAIN FJ787444_HBx_P-B of FT:mat_peptide FJ787444_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787475_HBx_P-B Product feature CHAIN FJ787475_HBx_P-B of FT:mat_peptide FJ787475_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVLFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ787476_HBx_P-B Product feature CHAIN FJ787476_HBx_P-B of FT:mat_peptide FJ787476_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLRGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ787477_HBx_P-B Product feature CHAIN FJ787477_HBx_P-B of FT:mat_peptide FJ787477_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899779_HBx_P-B Product feature CHAIN FJ899779_HBx_P-B of FT:mat_peptide FJ899779_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ899784_HBx_P-B Product feature CHAIN FJ899784_HBx_P-B of FT:mat_peptide FJ899784_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899785_HBx_P-B Product feature CHAIN FJ899785_HBx_P-B of FT:mat_peptide FJ899785_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRSTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899786_HBx_P-B Product feature CHAIN FJ899786_HBx_P-B of FT:mat_peptide FJ899786_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899787_HBx_P-B Product feature CHAIN FJ899787_HBx_P-B of FT:mat_peptide FJ899787_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPSASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899790_HBx_P-B Product feature CHAIN FJ899790_HBx_P-B of FT:mat_peptide FJ899790_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899791_HBx_P-B Product feature CHAIN FJ899791_HBx_P-B of FT:mat_peptide FJ899791_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358136_HBx_P-B Product feature CHAIN GQ358136_HBx_P-B of FT:mat_peptide GQ358136_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTCARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEDIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358137_HBx_P-B Product feature CHAIN GQ358137_HBx_P-B of FT:mat_peptide GQ358137_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFPSA
>gnl|hbvpro|GQ358138_HBx_P-B Product feature CHAIN GQ358138_HBx_P-B of FT:mat_peptide GQ358138_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358140_HBx_P-B Product feature CHAIN GQ358140_HBx_P-B of FT:mat_peptide GQ358140_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358141_HBx_P-B Product feature CHAIN GQ358141_HBx_P-B of FT:mat_peptide GQ358141_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358143_HBx_P-B Product feature CHAIN GQ358143_HBx_P-B of FT:mat_peptide GQ358143_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358144_HBx_P-B Product feature CHAIN GQ358144_HBx_P-B of FT:mat_peptide GQ358144_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKGFVLGGCRHKLVWSPAPCNFFPSA
>gnl|hbvpro|GQ358145_HBx_P-B Product feature CHAIN GQ358145_HBx_P-B of FT:mat_peptide GQ358145_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGAVPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358146_HBx_P-B Product feature CHAIN GQ358146_HBx_P-B of FT:mat_peptide GQ358146_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358147_HBx_P-B Product feature CHAIN GQ358147_HBx_P-B of FT:mat_peptide GQ358147_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358148_HBx_P-B Product feature CHAIN GQ358148_HBx_P-B of FT:mat_peptide GQ358148_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358149_HBx_P-B Product feature CHAIN GQ358149_HBx_P-B of FT:mat_peptide GQ358149_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358150_HBx_P-B Product feature CHAIN GQ358150_HBx_P-B of FT:mat_peptide GQ358150_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|GQ358151_HBx_P-B Product feature CHAIN GQ358151_HBx_P-B of FT:mat_peptide GQ358151_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358152_HBx_P-B Product feature CHAIN GQ358152_HBx_P-B of FT:mat_peptide GQ358152_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377525_HBx_P-B Product feature CHAIN GQ377525_HBx_P-B of FT:mat_peptide GQ377525_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSALSTTDLEAYFKDCVYTEWDELGEEVRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377537_HBx_P-B Product feature CHAIN GQ377537_HBx_P-B of FT:mat_peptide GQ377537_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377542_HBx_P-B Product feature CHAIN GQ377542_HBx_P-B of FT:mat_peptide GQ377542_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGDEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377547_HBx_P-B Product feature CHAIN GQ377547_HBx_P-B of FT:mat_peptide GQ377547_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377550_HBx_P-B Product feature CHAIN GQ377550_HBx_P-B of FT:mat_peptide GQ377550_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J81). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIFVLGGCRDKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377558_HBx_P-B Product feature CHAIN GQ377558_HBx_P-B of FT:mat_peptide GQ377558_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377561_HBx_P-B Product feature CHAIN GQ377561_HBx_P-B of FT:mat_peptide GQ377561_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377566_HBx_P-B Product feature CHAIN GQ377566_HBx_P-B of FT:mat_peptide GQ377566_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377567_HBx_P-B Product feature CHAIN GQ377567_HBx_P-B of FT:mat_peptide GQ377567_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPYVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSPVSTTDLEAYFKDCLFNDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377568_HBx_P-B Product feature CHAIN GQ377568_HBx_P-B of FT:mat_peptide GQ377568_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ377569_HBx_P-B Product feature CHAIN GQ377569_HBx_P-B of FT:mat_peptide GQ377569_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377582_HBx_P-B Product feature CHAIN GQ377582_HBx_P-B of FT:mat_peptide GQ377582_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLQKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GQ377587_HBx_P-B Product feature CHAIN GQ377587_HBx_P-B of FT:mat_peptide GQ377587_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377588_HBx_P-B Product feature CHAIN GQ377588_HBx_P-B of FT:mat_peptide GQ377588_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377606_HBx_P-B Product feature CHAIN GQ377606_HBx_P-B of FT:mat_peptide GQ377606_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377610_HBx_P-B Product feature CHAIN GQ377610_HBx_P-B of FT:mat_peptide GQ377610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEEFGEEIRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GQ377612_HBx_P-B Product feature CHAIN GQ377612_HBx_P-B of FT:mat_peptide GQ377612_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377622_HBx_P-B Product feature CHAIN GQ377622_HBx_P-B of FT:mat_peptide GQ377622_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVSLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377625_HBx_P-B Product feature CHAIN GQ377625_HBx_P-B of FT:mat_peptide GQ377625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVGSPAPCNFFTSA
>gnl|hbvpro|GQ377629_HBx_P-B Product feature CHAIN GQ377629_HBx_P-B of FT:mat_peptide GQ377629_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377638_HBx_P-B Product feature CHAIN GQ377638_HBx_P-B of FT:mat_peptide GQ377638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377641_HBx_P-B Product feature CHAIN GQ377641_HBx_P-B of FT:mat_peptide GQ377641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|GQ377643_HBx_P-B Product feature CHAIN GQ377643_HBx_P-B of FT:mat_peptide GQ377643_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377644_HBx_P-B Product feature CHAIN GQ377644_HBx_P-B of FT:mat_peptide GQ377644_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGAEGRLMSFVLVSCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475340_HBx_P-B Product feature CHAIN GQ475340_HBx_P-B of FT:mat_peptide GQ475340_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855522_HBx_P-B Product feature CHAIN GQ855522_HBx_P-B of FT:mat_peptide GQ855522_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 23). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCMFTEWEELGEEVRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|GQ855526_HBx_P-B Product feature CHAIN GQ855526_HBx_P-B of FT:mat_peptide GQ855526_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 103). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855529_HBx_P-B Product feature CHAIN GQ855529_HBx_P-B of FT:mat_peptide GQ855529_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 198). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855689_HBx_P-B Product feature CHAIN GQ855689_HBx_P-B of FT:mat_peptide GQ855689_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 3469). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHGAHLSLPGLPVCAFSSAGPCALRFTSARRME
TTANAHQNLTKALHNRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924603_HBx_P-B Product feature CHAIN GQ924603_HBx_P-B of FT:mat_peptide GQ924603_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924605_HBx_P-B Product feature CHAIN GQ924605_HBx_P-B of FT:mat_peptide GQ924605_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924606_HBx_P-B Product feature CHAIN GQ924606_HBx_P-B of FT:mat_peptide GQ924606_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924607_HBx_P-B Product feature CHAIN GQ924607_HBx_P-B of FT:mat_peptide GQ924607_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924608_HBx_P-B Product feature CHAIN GQ924608_HBx_P-B of FT:mat_peptide GQ924608_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924610_HBx_P-B Product feature CHAIN GQ924610_HBx_P-B of FT:mat_peptide GQ924610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924611_HBx_P-B Product feature CHAIN GQ924611_HBx_P-B of FT:mat_peptide GQ924611_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924617_HBx_P-B Product feature CHAIN GQ924617_HBx_P-B of FT:mat_peptide GQ924617_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924621_HBx_P-B Product feature CHAIN GQ924621_HBx_P-B of FT:mat_peptide GQ924621_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924624_HBx_P-B Product feature CHAIN GQ924624_HBx_P-B of FT:mat_peptide GQ924624_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGTLGTLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924625_HBx_P-B Product feature CHAIN GQ924625_HBx_P-B of FT:mat_peptide GQ924625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924626_HBx_P-B Product feature CHAIN GQ924626_HBx_P-B of FT:mat_peptide GQ924626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924627_HBx_P-B Product feature CHAIN GQ924627_HBx_P-B of FT:mat_peptide GQ924627_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924628_HBx_P-B Product feature CHAIN GQ924628_HBx_P-B of FT:mat_peptide GQ924628_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPAASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETKLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924630_HBx_P-B Product feature CHAIN GQ924630_HBx_P-B of FT:mat_peptide GQ924630_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924631_HBx_P-B Product feature CHAIN GQ924631_HBx_P-B of FT:mat_peptide GQ924631_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924632_HBx_P-B Product feature CHAIN GQ924632_HBx_P-B of FT:mat_peptide GQ924632_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924634_HBx_P-B Product feature CHAIN GQ924634_HBx_P-B of FT:mat_peptide GQ924634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924635_HBx_P-B Product feature CHAIN GQ924635_HBx_P-B of FT:mat_peptide GQ924635_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|GQ924637_HBx_P-B Product feature CHAIN GQ924637_HBx_P-B of FT:mat_peptide GQ924637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTLGLSAMSTIDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924638_HBx_P-B Product feature CHAIN GQ924638_HBx_P-B of FT:mat_peptide GQ924638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924639_HBx_P-B Product feature CHAIN GQ924639_HBx_P-B of FT:mat_peptide GQ924639_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924640_HBx_P-B Product feature CHAIN GQ924640_HBx_P-B of FT:mat_peptide GQ924640_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924641_HBx_P-B Product feature CHAIN GQ924641_HBx_P-B of FT:mat_peptide GQ924641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924645_HBx_P-B Product feature CHAIN GQ924645_HBx_P-B of FT:mat_peptide GQ924645_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924646_HBx_P-B Product feature CHAIN GQ924646_HBx_P-B of FT:mat_peptide GQ924646_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924647_HBx_P-B Product feature CHAIN GQ924647_HBx_P-B of FT:mat_peptide GQ924647_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVSTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924648_HBx_P-B Product feature CHAIN GQ924648_HBx_P-B of FT:mat_peptide GQ924648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924651_HBx_P-B Product feature CHAIN GQ924651_HBx_P-B of FT:mat_peptide GQ924651_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924653_HBx_P-B Product feature CHAIN GQ924653_HBx_P-B of FT:mat_peptide GQ924653_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924654_HBx_P-B Product feature CHAIN GQ924654_HBx_P-B of FT:mat_peptide GQ924654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924656_HBx_P-B Product feature CHAIN GQ924656_HBx_P-B of FT:mat_peptide GQ924656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHTRTLGLSVMSTTDLEAYFKDCVFTEWEESGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU357842_HBx_P-B Product feature CHAIN GU357842_HBx_P-B of FT:mat_peptide GU357842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU434372_HBx_P-B Product feature CHAIN GU434372_HBx_P-B of FT:mat_peptide GU434372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GU434373_HBx_P-B Product feature CHAIN GU434373_HBx_P-B of FT:mat_peptide GU434373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GU451682_HBx_P-B Product feature CHAIN GU451682_HBx_P-B of FT:mat_peptide GU451682_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815548_HBx_P-B Product feature CHAIN GU815548_HBx_P-B of FT:mat_peptide GU815548_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU815549_HBx_P-B Product feature CHAIN GU815549_HBx_P-B of FT:mat_peptide GU815549_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815550_HBx_P-B Product feature CHAIN GU815550_HBx_P-B of FT:mat_peptide GU815550_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815551_HBx_P-B Product feature CHAIN GU815551_HBx_P-B of FT:mat_peptide GU815551_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815552_HBx_P-B Product feature CHAIN GU815552_HBx_P-B of FT:mat_peptide GU815552_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815553_HBx_P-B Product feature CHAIN GU815553_HBx_P-B of FT:mat_peptide GU815553_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815554_HBx_P-B Product feature CHAIN GU815554_HBx_P-B of FT:mat_peptide GU815554_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815555_HBx_P-B Product feature CHAIN GU815555_HBx_P-B of FT:mat_peptide GU815555_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815556_HBx_P-B Product feature CHAIN GU815556_HBx_P-B of FT:mat_peptide GU815556_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815557_HBx_P-B Product feature CHAIN GU815557_HBx_P-B of FT:mat_peptide GU815557_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815558_HBx_P-B Product feature CHAIN GU815558_HBx_P-B of FT:mat_peptide GU815558_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815559_HBx_P-B Product feature CHAIN GU815559_HBx_P-B of FT:mat_peptide GU815559_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815560_HBx_P-B Product feature CHAIN GU815560_HBx_P-B of FT:mat_peptide GU815560_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815561_HBx_P-B Product feature CHAIN GU815561_HBx_P-B of FT:mat_peptide GU815561_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815562_HBx_P-B Product feature CHAIN GU815562_HBx_P-B of FT:mat_peptide GU815562_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815563_HBx_P-B Product feature CHAIN GU815563_HBx_P-B of FT:mat_peptide GU815563_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815564_HBx_P-B Product feature CHAIN GU815564_HBx_P-B of FT:mat_peptide GU815564_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815565_HBx_P-B Product feature CHAIN GU815565_HBx_P-B of FT:mat_peptide GU815565_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815566_HBx_P-B Product feature CHAIN GU815566_HBx_P-B of FT:mat_peptide GU815566_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815567_HBx_P-B Product feature CHAIN GU815567_HBx_P-B of FT:mat_peptide GU815567_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815568_HBx_P-B Product feature CHAIN GU815568_HBx_P-B of FT:mat_peptide GU815568_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815569_HBx_P-B Product feature CHAIN GU815569_HBx_P-B of FT:mat_peptide GU815569_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815570_HBx_P-B Product feature CHAIN GU815570_HBx_P-B of FT:mat_peptide GU815570_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815571_HBx_P-B Product feature CHAIN GU815571_HBx_P-B of FT:mat_peptide GU815571_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815573_HBx_P-B Product feature CHAIN GU815573_HBx_P-B of FT:mat_peptide GU815573_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815574_HBx_P-B Product feature CHAIN GU815574_HBx_P-B of FT:mat_peptide GU815574_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNTPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815575_HBx_P-B Product feature CHAIN GU815575_HBx_P-B of FT:mat_peptide GU815575_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815576_HBx_P-B Product feature CHAIN GU815576_HBx_P-B of FT:mat_peptide GU815576_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815577_HBx_P-B Product feature CHAIN GU815577_HBx_P-B of FT:mat_peptide GU815577_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNTPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815578_HBx_P-B Product feature CHAIN GU815578_HBx_P-B of FT:mat_peptide GU815578_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815579_HBx_P-B Product feature CHAIN GU815579_HBx_P-B of FT:mat_peptide GU815579_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEGLGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815581_HBx_P-B Product feature CHAIN GU815581_HBx_P-B of FT:mat_peptide GU815581_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815583_HBx_P-B Product feature CHAIN GU815583_HBx_P-B of FT:mat_peptide GU815583_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815584_HBx_P-B Product feature CHAIN GU815584_HBx_P-B of FT:mat_peptide GU815584_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815585_HBx_P-B Product feature CHAIN GU815585_HBx_P-B of FT:mat_peptide GU815585_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815586_HBx_P-B Product feature CHAIN GU815586_HBx_P-B of FT:mat_peptide GU815586_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815587_HBx_P-B Product feature CHAIN GU815587_HBx_P-B of FT:mat_peptide GU815587_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815588_HBx_P-B Product feature CHAIN GU815588_HBx_P-B of FT:mat_peptide GU815588_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815589_HBx_P-B Product feature CHAIN GU815589_HBx_P-B of FT:mat_peptide GU815589_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815590_HBx_P-B Product feature CHAIN GU815590_HBx_P-B of FT:mat_peptide GU815590_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSTRRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815591_HBx_P-B Product feature CHAIN GU815591_HBx_P-B of FT:mat_peptide GU815591_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815593_HBx_P-B Product feature CHAIN GU815593_HBx_P-B of FT:mat_peptide GU815593_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815594_HBx_P-B Product feature CHAIN GU815594_HBx_P-B of FT:mat_peptide GU815594_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815595_HBx_P-B Product feature CHAIN GU815595_HBx_P-B of FT:mat_peptide GU815595_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815596_HBx_P-B Product feature CHAIN GU815596_HBx_P-B of FT:mat_peptide GU815596_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815597_HBx_P-B Product feature CHAIN GU815597_HBx_P-B of FT:mat_peptide GU815597_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815598_HBx_P-B Product feature CHAIN GU815598_HBx_P-B of FT:mat_peptide GU815598_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815599_HBx_P-B Product feature CHAIN GU815599_HBx_P-B of FT:mat_peptide GU815599_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815600_HBx_P-B Product feature CHAIN GU815600_HBx_P-B of FT:mat_peptide GU815600_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815601_HBx_P-B Product feature CHAIN GU815601_HBx_P-B of FT:mat_peptide GU815601_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRELPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815602_HBx_P-B Product feature CHAIN GU815602_HBx_P-B of FT:mat_peptide GU815602_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLPLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815603_HBx_P-B Product feature CHAIN GU815603_HBx_P-B of FT:mat_peptide GU815603_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815604_HBx_P-B Product feature CHAIN GU815604_HBx_P-B of FT:mat_peptide GU815604_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815605_HBx_P-B Product feature CHAIN GU815605_HBx_P-B of FT:mat_peptide GU815605_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHFSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815606_HBx_P-B Product feature CHAIN GU815606_HBx_P-B of FT:mat_peptide GU815606_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815607_HBx_P-B Product feature CHAIN GU815607_HBx_P-B of FT:mat_peptide GU815607_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815608_HBx_P-B Product feature CHAIN GU815608_HBx_P-B of FT:mat_peptide GU815608_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815609_HBx_P-B Product feature CHAIN GU815609_HBx_P-B of FT:mat_peptide GU815609_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815610_HBx_P-B Product feature CHAIN GU815610_HBx_P-B of FT:mat_peptide GU815610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNPFTSA
>gnl|hbvpro|GU815611_HBx_P-B Product feature CHAIN GU815611_HBx_P-B of FT:mat_peptide GU815611_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815612_HBx_P-B Product feature CHAIN GU815612_HBx_P-B of FT:mat_peptide GU815612_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815613_HBx_P-B Product feature CHAIN GU815613_HBx_P-B of FT:mat_peptide GU815613_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815614_HBx_P-B Product feature CHAIN GU815614_HBx_P-B of FT:mat_peptide GU815614_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815616_HBx_P-B Product feature CHAIN GU815616_HBx_P-B of FT:mat_peptide GU815616_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815617_HBx_P-B Product feature CHAIN GU815617_HBx_P-B of FT:mat_peptide GU815617_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815618_HBx_P-B Product feature CHAIN GU815618_HBx_P-B of FT:mat_peptide GU815618_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815619_HBx_P-B Product feature CHAIN GU815619_HBx_P-B of FT:mat_peptide GU815619_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815620_HBx_P-B Product feature CHAIN GU815620_HBx_P-B of FT:mat_peptide GU815620_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815621_HBx_P-B Product feature CHAIN GU815621_HBx_P-B of FT:mat_peptide GU815621_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815622_HBx_P-B Product feature CHAIN GU815622_HBx_P-B of FT:mat_peptide GU815622_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815623_HBx_P-B Product feature CHAIN GU815623_HBx_P-B of FT:mat_peptide GU815623_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815624_HBx_P-B Product feature CHAIN GU815624_HBx_P-B of FT:mat_peptide GU815624_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815625_HBx_P-B Product feature CHAIN GU815625_HBx_P-B of FT:mat_peptide GU815625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815626_HBx_P-B Product feature CHAIN GU815626_HBx_P-B of FT:mat_peptide GU815626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815627_HBx_P-B Product feature CHAIN GU815627_HBx_P-B of FT:mat_peptide GU815627_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815628_HBx_P-B Product feature CHAIN GU815628_HBx_P-B of FT:mat_peptide GU815628_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815629_HBx_P-B Product feature CHAIN GU815629_HBx_P-B of FT:mat_peptide GU815629_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815630_HBx_P-B Product feature CHAIN GU815630_HBx_P-B of FT:mat_peptide GU815630_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815631_HBx_P-B Product feature CHAIN GU815631_HBx_P-B of FT:mat_peptide GU815631_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815632_HBx_P-B Product feature CHAIN GU815632_HBx_P-B of FT:mat_peptide GU815632_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815633_HBx_P-B Product feature CHAIN GU815633_HBx_P-B of FT:mat_peptide GU815633_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815634_HBx_P-B Product feature CHAIN GU815634_HBx_P-B of FT:mat_peptide GU815634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815635_HBx_P-B Product feature CHAIN GU815635_HBx_P-B of FT:mat_peptide GU815635_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815636_HBx_P-B Product feature CHAIN GU815636_HBx_P-B of FT:mat_peptide GU815636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815637_HBx_P-B Product feature CHAIN GU815637_HBx_P-B of FT:mat_peptide GU815637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815638_HBx_P-B Product feature CHAIN GU815638_HBx_P-B of FT:mat_peptide GU815638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815639_HBx_P-B Product feature CHAIN GU815639_HBx_P-B of FT:mat_peptide GU815639_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815640_HBx_P-B Product feature CHAIN GU815640_HBx_P-B of FT:mat_peptide GU815640_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815641_HBx_P-B Product feature CHAIN GU815641_HBx_P-B of FT:mat_peptide GU815641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815642_HBx_P-B Product feature CHAIN GU815642_HBx_P-B of FT:mat_peptide GU815642_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815643_HBx_P-B Product feature CHAIN GU815643_HBx_P-B of FT:mat_peptide GU815643_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815644_HBx_P-B Product feature CHAIN GU815644_HBx_P-B of FT:mat_peptide GU815644_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815645_HBx_P-B Product feature CHAIN GU815645_HBx_P-B of FT:mat_peptide GU815645_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815646_HBx_P-B Product feature CHAIN GU815646_HBx_P-B of FT:mat_peptide GU815646_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815647_HBx_P-B Product feature CHAIN GU815647_HBx_P-B of FT:mat_peptide GU815647_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815648_HBx_P-B Product feature CHAIN GU815648_HBx_P-B of FT:mat_peptide GU815648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815649_HBx_P-B Product feature CHAIN GU815649_HBx_P-B of FT:mat_peptide GU815649_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815650_HBx_P-B Product feature CHAIN GU815650_HBx_P-B of FT:mat_peptide GU815650_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815651_HBx_P-B Product feature CHAIN GU815651_HBx_P-B of FT:mat_peptide GU815651_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815652_HBx_P-B Product feature CHAIN GU815652_HBx_P-B of FT:mat_peptide GU815652_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815653_HBx_P-B Product feature CHAIN GU815653_HBx_P-B of FT:mat_peptide GU815653_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815654_HBx_P-B Product feature CHAIN GU815654_HBx_P-B of FT:mat_peptide GU815654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815656_HBx_P-B Product feature CHAIN GU815656_HBx_P-B of FT:mat_peptide GU815656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGSCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815657_HBx_P-B Product feature CHAIN GU815657_HBx_P-B of FT:mat_peptide GU815657_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815658_HBx_P-B Product feature CHAIN GU815658_HBx_P-B of FT:mat_peptide GU815658_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815659_HBx_P-B Product feature CHAIN GU815659_HBx_P-B of FT:mat_peptide GU815659_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815660_HBx_P-B Product feature CHAIN GU815660_HBx_P-B of FT:mat_peptide GU815660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815661_HBx_P-B Product feature CHAIN GU815661_HBx_P-B of FT:mat_peptide GU815661_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815662_HBx_P-B Product feature CHAIN GU815662_HBx_P-B of FT:mat_peptide GU815662_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815663_HBx_P-B Product feature CHAIN GU815663_HBx_P-B of FT:mat_peptide GU815663_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815664_HBx_P-B Product feature CHAIN GU815664_HBx_P-B of FT:mat_peptide GU815664_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815665_HBx_P-B Product feature CHAIN GU815665_HBx_P-B of FT:mat_peptide GU815665_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815666_HBx_P-B Product feature CHAIN GU815666_HBx_P-B of FT:mat_peptide GU815666_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815667_HBx_P-B Product feature CHAIN GU815667_HBx_P-B of FT:mat_peptide GU815667_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815668_HBx_P-B Product feature CHAIN GU815668_HBx_P-B of FT:mat_peptide GU815668_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815669_HBx_P-B Product feature CHAIN GU815669_HBx_P-B of FT:mat_peptide GU815669_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815670_HBx_P-B Product feature CHAIN GU815670_HBx_P-B of FT:mat_peptide GU815670_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCALSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTNLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815672_HBx_P-B Product feature CHAIN GU815672_HBx_P-B of FT:mat_peptide GU815672_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815673_HBx_P-B Product feature CHAIN GU815673_HBx_P-B of FT:mat_peptide GU815673_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815674_HBx_P-B Product feature CHAIN GU815674_HBx_P-B of FT:mat_peptide GU815674_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815675_HBx_P-B Product feature CHAIN GU815675_HBx_P-B of FT:mat_peptide GU815675_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815676_HBx_P-B Product feature CHAIN GU815676_HBx_P-B of FT:mat_peptide GU815676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815677_HBx_P-B Product feature CHAIN GU815677_HBx_P-B of FT:mat_peptide GU815677_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815678_HBx_P-B Product feature CHAIN GU815678_HBx_P-B of FT:mat_peptide GU815678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815679_HBx_P-B Product feature CHAIN GU815679_HBx_P-B of FT:mat_peptide GU815679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSPGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815680_HBx_P-B Product feature CHAIN GU815680_HBx_P-B of FT:mat_peptide GU815680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815681_HBx_P-B Product feature CHAIN GU815681_HBx_P-B of FT:mat_peptide GU815681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815683_HBx_P-B Product feature CHAIN GU815683_HBx_P-B of FT:mat_peptide GU815683_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815684_HBx_P-B Product feature CHAIN GU815684_HBx_P-B of FT:mat_peptide GU815684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815685_HBx_P-B Product feature CHAIN GU815685_HBx_P-B of FT:mat_peptide GU815685_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815686_HBx_P-B Product feature CHAIN GU815686_HBx_P-B of FT:mat_peptide GU815686_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815687_HBx_P-B Product feature CHAIN GU815687_HBx_P-B of FT:mat_peptide GU815687_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815688_HBx_P-B Product feature CHAIN GU815688_HBx_P-B of FT:mat_peptide GU815688_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNLFTSA
>gnl|hbvpro|GU815689_HBx_P-B Product feature CHAIN GU815689_HBx_P-B of FT:mat_peptide GU815689_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815691_HBx_P-B Product feature CHAIN GU815691_HBx_P-B of FT:mat_peptide GU815691_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815692_HBx_P-B Product feature CHAIN GU815692_HBx_P-B of FT:mat_peptide GU815692_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815693_HBx_P-B Product feature CHAIN GU815693_HBx_P-B of FT:mat_peptide GU815693_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815695_HBx_P-B Product feature CHAIN GU815695_HBx_P-B of FT:mat_peptide GU815695_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815696_HBx_P-B Product feature CHAIN GU815696_HBx_P-B of FT:mat_peptide GU815696_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815697_HBx_P-B Product feature CHAIN GU815697_HBx_P-B of FT:mat_peptide GU815697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815698_HBx_P-B Product feature CHAIN GU815698_HBx_P-B of FT:mat_peptide GU815698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815699_HBx_P-B Product feature CHAIN GU815699_HBx_P-B of FT:mat_peptide GU815699_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815700_HBx_P-B Product feature CHAIN GU815700_HBx_P-B of FT:mat_peptide GU815700_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815701_HBx_P-B Product feature CHAIN GU815701_HBx_P-B of FT:mat_peptide GU815701_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815702_HBx_P-B Product feature CHAIN GU815702_HBx_P-B of FT:mat_peptide GU815702_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815703_HBx_P-B Product feature CHAIN GU815703_HBx_P-B of FT:mat_peptide GU815703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815704_HBx_P-B Product feature CHAIN GU815704_HBx_P-B of FT:mat_peptide GU815704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRSKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815705_HBx_P-B Product feature CHAIN GU815705_HBx_P-B of FT:mat_peptide GU815705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815706_HBx_P-B Product feature CHAIN GU815706_HBx_P-B of FT:mat_peptide GU815706_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815707_HBx_P-B Product feature CHAIN GU815707_HBx_P-B of FT:mat_peptide GU815707_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNPFTSA
>gnl|hbvpro|GU815708_HBx_P-B Product feature CHAIN GU815708_HBx_P-B of FT:mat_peptide GU815708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815709_HBx_P-B Product feature CHAIN GU815709_HBx_P-B of FT:mat_peptide GU815709_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815710_HBx_P-B Product feature CHAIN GU815710_HBx_P-B of FT:mat_peptide GU815710_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815711_HBx_P-B Product feature CHAIN GU815711_HBx_P-B of FT:mat_peptide GU815711_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815712_HBx_P-B Product feature CHAIN GU815712_HBx_P-B of FT:mat_peptide GU815712_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815713_HBx_P-B Product feature CHAIN GU815713_HBx_P-B of FT:mat_peptide GU815713_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815715_HBx_P-B Product feature CHAIN GU815715_HBx_P-B of FT:mat_peptide GU815715_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815716_HBx_P-B Product feature CHAIN GU815716_HBx_P-B of FT:mat_peptide GU815716_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815717_HBx_P-B Product feature CHAIN GU815717_HBx_P-B of FT:mat_peptide GU815717_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815718_HBx_P-B Product feature CHAIN GU815718_HBx_P-B of FT:mat_peptide GU815718_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815719_HBx_P-B Product feature CHAIN GU815719_HBx_P-B of FT:mat_peptide GU815719_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815720_HBx_P-B Product feature CHAIN GU815720_HBx_P-B of FT:mat_peptide GU815720_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815721_HBx_P-B Product feature CHAIN GU815721_HBx_P-B of FT:mat_peptide GU815721_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815722_HBx_P-B Product feature CHAIN GU815722_HBx_P-B of FT:mat_peptide GU815722_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815723_HBx_P-B Product feature CHAIN GU815723_HBx_P-B of FT:mat_peptide GU815723_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815724_HBx_P-B Product feature CHAIN GU815724_HBx_P-B of FT:mat_peptide GU815724_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPADHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815725_HBx_P-B Product feature CHAIN GU815725_HBx_P-B of FT:mat_peptide GU815725_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815726_HBx_P-B Product feature CHAIN GU815726_HBx_P-B of FT:mat_peptide GU815726_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815727_HBx_P-B Product feature CHAIN GU815727_HBx_P-B of FT:mat_peptide GU815727_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDRGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815728_HBx_P-B Product feature CHAIN GU815728_HBx_P-B of FT:mat_peptide GU815728_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815729_HBx_P-B Product feature CHAIN GU815729_HBx_P-B of FT:mat_peptide GU815729_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815730_HBx_P-B Product feature CHAIN GU815730_HBx_P-B of FT:mat_peptide GU815730_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815731_HBx_P-B Product feature CHAIN GU815731_HBx_P-B of FT:mat_peptide GU815731_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815732_HBx_P-B Product feature CHAIN GU815732_HBx_P-B of FT:mat_peptide GU815732_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEIRLEVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815733_HBx_P-B Product feature CHAIN GU815733_HBx_P-B of FT:mat_peptide GU815733_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSTAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815734_HBx_P-B Product feature CHAIN GU815734_HBx_P-B of FT:mat_peptide GU815734_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815735_HBx_P-B Product feature CHAIN GU815735_HBx_P-B of FT:mat_peptide GU815735_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815736_HBx_P-B Product feature CHAIN GU815736_HBx_P-B of FT:mat_peptide GU815736_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815737_HBx_P-B Product feature CHAIN GU815737_HBx_P-B of FT:mat_peptide GU815737_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815738_HBx_P-B Product feature CHAIN GU815738_HBx_P-B of FT:mat_peptide GU815738_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815739_HBx_P-B Product feature CHAIN GU815739_HBx_P-B of FT:mat_peptide GU815739_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815740_HBx_P-B Product feature CHAIN GU815740_HBx_P-B of FT:mat_peptide GU815740_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815741_HBx_P-B Product feature CHAIN GU815741_HBx_P-B of FT:mat_peptide GU815741_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815742_HBx_P-B Product feature CHAIN GU815742_HBx_P-B of FT:mat_peptide GU815742_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815743_HBx_P-B Product feature CHAIN GU815743_HBx_P-B of FT:mat_peptide GU815743_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815744_HBx_P-B Product feature CHAIN GU815744_HBx_P-B of FT:mat_peptide GU815744_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815745_HBx_P-B Product feature CHAIN GU815745_HBx_P-B of FT:mat_peptide GU815745_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815746_HBx_P-B Product feature CHAIN GU815746_HBx_P-B of FT:mat_peptide GU815746_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815747_HBx_P-B Product feature CHAIN GU815747_HBx_P-B of FT:mat_peptide GU815747_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815748_HBx_P-B Product feature CHAIN GU815748_HBx_P-B of FT:mat_peptide GU815748_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815749_HBx_P-B Product feature CHAIN GU815749_HBx_P-B of FT:mat_peptide GU815749_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815750_HBx_P-B Product feature CHAIN GU815750_HBx_P-B of FT:mat_peptide GU815750_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815751_HBx_P-B Product feature CHAIN GU815751_HBx_P-B of FT:mat_peptide GU815751_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815752_HBx_P-B Product feature CHAIN GU815752_HBx_P-B of FT:mat_peptide GU815752_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815753_HBx_P-B Product feature CHAIN GU815753_HBx_P-B of FT:mat_peptide GU815753_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815754_HBx_P-B Product feature CHAIN GU815754_HBx_P-B of FT:mat_peptide GU815754_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815755_HBx_P-B Product feature CHAIN GU815755_HBx_P-B of FT:mat_peptide GU815755_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815756_HBx_P-B Product feature CHAIN GU815756_HBx_P-B of FT:mat_peptide GU815756_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815757_HBx_P-B Product feature CHAIN GU815757_HBx_P-B of FT:mat_peptide GU815757_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815759_HBx_P-B Product feature CHAIN GU815759_HBx_P-B of FT:mat_peptide GU815759_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815760_HBx_P-B Product feature CHAIN GU815760_HBx_P-B of FT:mat_peptide GU815760_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815761_HBx_P-B Product feature CHAIN GU815761_HBx_P-B of FT:mat_peptide GU815761_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815762_HBx_P-B Product feature CHAIN GU815762_HBx_P-B of FT:mat_peptide GU815762_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815764_HBx_P-B Product feature CHAIN GU815764_HBx_P-B of FT:mat_peptide GU815764_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815765_HBx_P-B Product feature CHAIN GU815765_HBx_P-B of FT:mat_peptide GU815765_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815766_HBx_P-B Product feature CHAIN GU815766_HBx_P-B of FT:mat_peptide GU815766_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815767_HBx_P-B Product feature CHAIN GU815767_HBx_P-B of FT:mat_peptide GU815767_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815768_HBx_P-B Product feature CHAIN GU815768_HBx_P-B of FT:mat_peptide GU815768_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815769_HBx_P-B Product feature CHAIN GU815769_HBx_P-B of FT:mat_peptide GU815769_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815770_HBx_P-B Product feature CHAIN GU815770_HBx_P-B of FT:mat_peptide GU815770_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPRVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815771_HBx_P-B Product feature CHAIN GU815771_HBx_P-B of FT:mat_peptide GU815771_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815772_HBx_P-B Product feature CHAIN GU815772_HBx_P-B of FT:mat_peptide GU815772_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815773_HBx_P-B Product feature CHAIN GU815773_HBx_P-B of FT:mat_peptide GU815773_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815774_HBx_P-B Product feature CHAIN GU815774_HBx_P-B of FT:mat_peptide GU815774_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815775_HBx_P-B Product feature CHAIN GU815775_HBx_P-B of FT:mat_peptide GU815775_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815776_HBx_P-B Product feature CHAIN GU815776_HBx_P-B of FT:mat_peptide GU815776_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815777_HBx_P-B Product feature CHAIN GU815777_HBx_P-B of FT:mat_peptide GU815777_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815778_HBx_P-B Product feature CHAIN GU815778_HBx_P-B of FT:mat_peptide GU815778_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815779_HBx_P-B Product feature CHAIN GU815779_HBx_P-B of FT:mat_peptide GU815779_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815780_HBx_P-B Product feature CHAIN GU815780_HBx_P-B of FT:mat_peptide GU815780_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815781_HBx_P-B Product feature CHAIN GU815781_HBx_P-B of FT:mat_peptide GU815781_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815782_HBx_P-B Product feature CHAIN GU815782_HBx_P-B of FT:mat_peptide GU815782_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815783_HBx_P-B Product feature CHAIN GU815783_HBx_P-B of FT:mat_peptide GU815783_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNPFTSA
>gnl|hbvpro|HM011466_HBx_P-B Product feature CHAIN HM011466_HBx_P-B of FT:mat_peptide HM011466_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011467_HBx_P-B Product feature CHAIN HM011467_HBx_P-B of FT:mat_peptide HM011467_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011469_HBx_P-B Product feature CHAIN HM011469_HBx_P-B of FT:mat_peptide HM011469_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011470_HBx_P-B Product feature CHAIN HM011470_HBx_P-B of FT:mat_peptide HM011470_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011471_HBx_P-B Product feature CHAIN HM011471_HBx_P-B of FT:mat_peptide HM011471_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011473_HBx_P-B Product feature CHAIN HM011473_HBx_P-B of FT:mat_peptide HM011473_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSXGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCPPAPXBFFTSA
>gnl|hbvpro|HM011474_HBx_P-B Product feature CHAIN HM011474_HBx_P-B of FT:mat_peptide HM011474_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPLAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWTLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|HM011475_HBx_P-B Product feature CHAIN HM011475_HBx_P-B of FT:mat_peptide HM011475_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPXCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGXRHKLVRSPAPCNFFTSA
>gnl|hbvpro|HM011476_HBx_P-B Product feature CHAIN HM011476_HBx_P-B of FT:mat_peptide HM011476_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011477_HBx_P-B Product feature CHAIN HM011477_HBx_P-B of FT:mat_peptide HM011477_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPLDVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPRNFFTSA
>gnl|hbvpro|HM011478_HBx_P-B Product feature CHAIN HM011478_HBx_P-B of FT:mat_peptide HM011478_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNXXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011480_HBx_P-B Product feature CHAIN HM011480_HBx_P-B of FT:mat_peptide HM011480_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011482_HBx_P-B Product feature CHAIN HM011482_HBx_P-B of FT:mat_peptide HM011482_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPXNFFTSAX
>gnl|hbvpro|HM011483_HBx_P-B Product feature CHAIN HM011483_HBx_P-B of FT:mat_peptide HM011483_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011484_HBx_P-B Product feature CHAIN HM011484_HBx_P-B of FT:mat_peptide HM011484_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011487_HBx_P-B Product feature CHAIN HM011487_HBx_P-B of FT:mat_peptide HM011487_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGKENRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011490_HBx_P-B Product feature CHAIN HM011490_HBx_P-B of FT:mat_peptide HM011490_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011492_HBx_P-B Product feature CHAIN HM011492_HBx_P-B of FT:mat_peptide HM011492_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011494_HBx_P-B Product feature CHAIN HM011494_HBx_P-B of FT:mat_peptide HM011494_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|HM011496_HBx_P-B Product feature CHAIN HM011496_HBx_P-B of FT:mat_peptide HM011496_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011499_HBx_P-B Product feature CHAIN HM011499_HBx_P-B of FT:mat_peptide HM011499_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGXHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011503_HBx_P-B Product feature CHAIN HM011503_HBx_P-B of FT:mat_peptide HM011503_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011504_HBx_P-B Product feature CHAIN HM011504_HBx_P-B of FT:mat_peptide HM011504_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM153811_HBx_P-B Product feature CHAIN HM153811_HBx_P-B of FT:mat_peptide HM153811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 712005001256). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700546_HBx_P-B Product feature CHAIN HQ700546_HBx_P-B of FT:mat_peptide HQ700546_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700548_HBx_P-B Product feature CHAIN HQ700548_HBx_P-B of FT:mat_peptide HQ700548_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700549_HBx_P-B Product feature CHAIN HQ700549_HBx_P-B of FT:mat_peptide HQ700549_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF412801_HBx_P-B Product feature CHAIN JF412801_HBx_P-B of FT:mat_peptide JF412801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF436921_HBx_P-B Product feature CHAIN JF436921_HBx_P-B of FT:mat_peptide JF436921_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRELPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF899335_HBx_P-B Product feature CHAIN JF899335_HBx_P-B of FT:mat_peptide JF899335_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN406371_HBx_P-B Product feature CHAIN JN406371_HBx_P-B of FT:mat_peptide JN406371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792893_HBx_P-B Product feature CHAIN JN792893_HBx_P-B of FT:mat_peptide JN792893_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2004). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792894_HBx_P-B Product feature CHAIN JN792894_HBx_P-B of FT:mat_peptide JN792894_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792895_HBx_P-B Product feature CHAIN JN792895_HBx_P-B of FT:mat_peptide JN792895_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792896_HBx_P-B Product feature CHAIN JN792896_HBx_P-B of FT:mat_peptide JN792896_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792897_HBx_P-B Product feature CHAIN JN792897_HBx_P-B of FT:mat_peptide JN792897_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792898_HBx_P-B Product feature CHAIN JN792898_HBx_P-B of FT:mat_peptide JN792898_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792899_HBx_P-B Product feature CHAIN JN792899_HBx_P-B of FT:mat_peptide JN792899_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792900_HBx_P-B Product feature CHAIN JN792900_HBx_P-B of FT:mat_peptide JN792900_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792901_HBx_P-B Product feature CHAIN JN792901_HBx_P-B of FT:mat_peptide JN792901_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792902_HBx_P-B Product feature CHAIN JN792902_HBx_P-B of FT:mat_peptide JN792902_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827419_HBx_P-B Product feature CHAIN JN827419_HBx_P-B of FT:mat_peptide JN827419_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|JQ027311_HBx_P-B Product feature CHAIN JQ027311_HBx_P-B of FT:mat_peptide JQ027311_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPYNFFTSA
>gnl|hbvpro|JQ027313_HBx_P-B Product feature CHAIN JQ027313_HBx_P-B of FT:mat_peptide JQ027313_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027315_HBx_P-B Product feature CHAIN JQ027315_HBx_P-B of FT:mat_peptide JQ027315_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEELRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ027316_HBx_P-B Product feature CHAIN JQ027316_HBx_P-B of FT:mat_peptide JQ027316_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027325_HBx_P-B Product feature CHAIN JQ027325_HBx_P-B of FT:mat_peptide JQ027325_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027329_HBx_P-B Product feature CHAIN JQ027329_HBx_P-B of FT:mat_peptide JQ027329_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPGNFFTSA
>gnl|hbvpro|JQ027330_HBx_P-B Product feature CHAIN JQ027330_HBx_P-B of FT:mat_peptide JQ027330_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKVCVFIEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027331_HBx_P-B Product feature CHAIN JQ027331_HBx_P-B of FT:mat_peptide JQ027331_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKVCVFIEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027334_HBx_P-B Product feature CHAIN JQ027334_HBx_P-B of FT:mat_peptide JQ027334_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040125_HBx_P-B Product feature CHAIN JQ040125_HBx_P-B of FT:mat_peptide JQ040125_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040128_HBx_P-B Product feature CHAIN JQ040128_HBx_P-B of FT:mat_peptide JQ040128_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040138_HBx_P-B Product feature CHAIN JQ040138_HBx_P-B of FT:mat_peptide JQ040138_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040147_HBx_P-B Product feature CHAIN JQ040147_HBx_P-B of FT:mat_peptide JQ040147_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040157_HBx_P-B Product feature CHAIN JQ040157_HBx_P-B of FT:mat_peptide JQ040157_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040169_HBx_P-B Product feature CHAIN JQ040169_HBx_P-B of FT:mat_peptide JQ040169_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G237). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPIVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ040170_HBx_P-B Product feature CHAIN JQ040170_HBx_P-B of FT:mat_peptide JQ040170_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLXPMSTTDLEAYFKDCVFNEWEEXGEEVRXKVXVLGGCMHXLVCXPXPCNFFTSA
>gnl|hbvpro|JQ040171_HBx_P-B Product feature CHAIN JQ040171_HBx_P-B of FT:mat_peptide JQ040171_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040173_HBx_P-B Product feature CHAIN JQ040173_HBx_P-B of FT:mat_peptide JQ040173_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ341793_HBx_P-B Product feature CHAIN JQ341793_HBx_P-B of FT:mat_peptide JQ341793_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341794_HBx_P-B Product feature CHAIN JQ341794_HBx_P-B of FT:mat_peptide JQ341794_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341795_HBx_P-B Product feature CHAIN JQ341795_HBx_P-B of FT:mat_peptide JQ341795_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEXRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JQ341796_HBx_P-B Product feature CHAIN JQ341796_HBx_P-B of FT:mat_peptide JQ341796_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341797_HBx_P-B Product feature CHAIN JQ341797_HBx_P-B of FT:mat_peptide JQ341797_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341798_HBx_P-B Product feature CHAIN JQ341798_HBx_P-B of FT:mat_peptide JQ341798_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAXPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELXEEIRXKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341799_HBx_P-B Product feature CHAIN JQ341799_HBx_P-B of FT:mat_peptide JQ341799_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341800_HBx_P-B Product feature CHAIN JQ341800_HBx_P-B of FT:mat_peptide JQ341800_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341802_HBx_P-B Product feature CHAIN JQ341802_HBx_P-B of FT:mat_peptide JQ341802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341803_HBx_P-B Product feature CHAIN JQ341803_HBx_P-B of FT:mat_peptide JQ341803_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341804_HBx_P-B Product feature CHAIN JQ341804_HBx_P-B of FT:mat_peptide JQ341804_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341807_HBx_P-B Product feature CHAIN JQ341807_HBx_P-B of FT:mat_peptide JQ341807_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341808_HBx_P-B Product feature CHAIN JQ341808_HBx_P-B of FT:mat_peptide JQ341808_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLXALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|JQ341809_HBx_P-B Product feature CHAIN JQ341809_HBx_P-B of FT:mat_peptide JQ341809_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341810_HBx_P-B Product feature CHAIN JQ341810_HBx_P-B of FT:mat_peptide JQ341810_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341811_HBx_P-B Product feature CHAIN JQ341811_HBx_P-B of FT:mat_peptide JQ341811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXXPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEXRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JQ341812_HBx_P-B Product feature CHAIN JQ341812_HBx_P-B of FT:mat_peptide JQ341812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341813_HBx_P-B Product feature CHAIN JQ341813_HBx_P-B of FT:mat_peptide JQ341813_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRPPAPCNFFTSA
>gnl|hbvpro|JQ341814_HBx_P-B Product feature CHAIN JQ341814_HBx_P-B of FT:mat_peptide JQ341814_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341815_HBx_P-B Product feature CHAIN JQ341815_HBx_P-B of FT:mat_peptide JQ341815_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno23). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ341816_HBx_P-B Product feature CHAIN JQ341816_HBx_P-B of FT:mat_peptide JQ341816_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341817_HBx_P-B Product feature CHAIN JQ341817_HBx_P-B of FT:mat_peptide JQ341817_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341818_HBx_P-B Product feature CHAIN JQ341818_HBx_P-B of FT:mat_peptide JQ341818_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341819_HBx_P-B Product feature CHAIN JQ341819_HBx_P-B of FT:mat_peptide JQ341819_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341821_HBx_P-B Product feature CHAIN JQ341821_HBx_P-B of FT:mat_peptide JQ341821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JQ341822_HBx_P-B Product feature CHAIN JQ341822_HBx_P-B of FT:mat_peptide JQ341822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341823_HBx_P-B Product feature CHAIN JQ341823_HBx_P-B of FT:mat_peptide JQ341823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341824_HBx_P-B Product feature CHAIN JQ341824_HBx_P-B of FT:mat_peptide JQ341824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341825_HBx_P-B Product feature CHAIN JQ341825_HBx_P-B of FT:mat_peptide JQ341825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSEMSTTDLEAYFKDCVFNEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341826_HBx_P-B Product feature CHAIN JQ341826_HBx_P-B of FT:mat_peptide JQ341826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341827_HBx_P-B Product feature CHAIN JQ341827_HBx_P-B of FT:mat_peptide JQ341827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341828_HBx_P-B Product feature CHAIN JQ341828_HBx_P-B of FT:mat_peptide JQ341828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341830_HBx_P-B Product feature CHAIN JQ341830_HBx_P-B of FT:mat_peptide JQ341830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341831_HBx_P-B Product feature CHAIN JQ341831_HBx_P-B of FT:mat_peptide JQ341831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGVETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341833_HBx_P-B Product feature CHAIN JQ341833_HBx_P-B of FT:mat_peptide JQ341833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDRVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341835_HBx_P-B Product feature CHAIN JQ341835_HBx_P-B of FT:mat_peptide JQ341835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341836_HBx_P-B Product feature CHAIN JQ341836_HBx_P-B of FT:mat_peptide JQ341836_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno44). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPPVXPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341837_HBx_P-B Product feature CHAIN JQ341837_HBx_P-B of FT:mat_peptide JQ341837_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341838_HBx_P-B Product feature CHAIN JQ341838_HBx_P-B of FT:mat_peptide JQ341838_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALGNLPKVLHKRTLGLSAMSTTDLEAYFKDCEDTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341839_HBx_P-B Product feature CHAIN JQ341839_HBx_P-B of FT:mat_peptide JQ341839_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno47). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341840_HBx_P-B Product feature CHAIN JQ341840_HBx_P-B of FT:mat_peptide JQ341840_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVXAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRXE
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341842_HBx_P-B Product feature CHAIN JQ341842_HBx_P-B of FT:mat_peptide JQ341842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341843_HBx_P-B Product feature CHAIN JQ341843_HBx_P-B of FT:mat_peptide JQ341843_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341844_HBx_P-B Product feature CHAIN JQ341844_HBx_P-B of FT:mat_peptide JQ341844_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341845_HBx_P-B Product feature CHAIN JQ341845_HBx_P-B of FT:mat_peptide JQ341845_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRXKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341848_HBx_P-B Product feature CHAIN JQ341848_HBx_P-B of FT:mat_peptide JQ341848_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno56). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLXKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341850_HBx_P-B Product feature CHAIN JQ341850_HBx_P-B of FT:mat_peptide JQ341850_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno58). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVXPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGAEARLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|JQ341853_HBx_P-B Product feature CHAIN JQ341853_HBx_P-B of FT:mat_peptide JQ341853_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429079_HBx_P-B Product feature CHAIN JQ429079_HBx_P-B of FT:mat_peptide JQ429079_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08.10.002). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429080_HBx_P-B Product feature CHAIN JQ429080_HBx_P-B of FT:mat_peptide JQ429080_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.40.033). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429081_HBx_P-B Product feature CHAIN JQ429081_HBx_P-B of FT:mat_peptide JQ429081_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429082_HBx_P-B Product feature CHAIN JQ429082_HBx_P-B of FT:mat_peptide JQ429082_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.41.591). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ688405_HBx_P-B Product feature CHAIN JQ688405_HBx_P-B of FT:mat_peptide JQ688405_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707734_HBx_P-B Product feature CHAIN JQ707734_HBx_P-B of FT:mat_peptide JQ707734_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707735_HBx_P-B Product feature CHAIN JQ707735_HBx_P-B of FT:mat_peptide JQ707735_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707736_HBx_P-B Product feature CHAIN JQ707736_HBx_P-B of FT:mat_peptide JQ707736_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_11). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707737_HBx_P-B Product feature CHAIN JQ707737_HBx_P-B of FT:mat_peptide JQ707737_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707738_HBx_P-B Product feature CHAIN JQ707738_HBx_P-B of FT:mat_peptide JQ707738_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707739_HBx_P-B Product feature CHAIN JQ707739_HBx_P-B of FT:mat_peptide JQ707739_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707740_HBx_P-B Product feature CHAIN JQ707740_HBx_P-B of FT:mat_peptide JQ707740_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707741_HBx_P-B Product feature CHAIN JQ707741_HBx_P-B of FT:mat_peptide JQ707741_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_19). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707742_HBx_P-B Product feature CHAIN JQ707742_HBx_P-B of FT:mat_peptide JQ707742_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707743_HBx_P-B Product feature CHAIN JQ707743_HBx_P-B of FT:mat_peptide JQ707743_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707744_HBx_P-B Product feature CHAIN JQ707744_HBx_P-B of FT:mat_peptide JQ707744_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALQPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707745_HBx_P-B Product feature CHAIN JQ707745_HBx_P-B of FT:mat_peptide JQ707745_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707746_HBx_P-B Product feature CHAIN JQ707746_HBx_P-B of FT:mat_peptide JQ707746_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_24-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707747_HBx_P-B Product feature CHAIN JQ707747_HBx_P-B of FT:mat_peptide JQ707747_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707748_HBx_P-B Product feature CHAIN JQ707748_HBx_P-B of FT:mat_peptide JQ707748_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_26). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707749_HBx_P-B Product feature CHAIN JQ707749_HBx_P-B of FT:mat_peptide JQ707749_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707750_HBx_P-B Product feature CHAIN JQ707750_HBx_P-B of FT:mat_peptide JQ707750_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707751_HBx_P-B Product feature CHAIN JQ707751_HBx_P-B of FT:mat_peptide JQ707751_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_30). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707752_HBx_P-B Product feature CHAIN JQ707752_HBx_P-B of FT:mat_peptide JQ707752_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_31). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707753_HBx_P-B Product feature CHAIN JQ707753_HBx_P-B of FT:mat_peptide JQ707753_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707754_HBx_P-B Product feature CHAIN JQ707754_HBx_P-B of FT:mat_peptide JQ707754_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_33). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707755_HBx_P-B Product feature CHAIN JQ707755_HBx_P-B of FT:mat_peptide JQ707755_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707756_HBx_P-B Product feature CHAIN JQ707756_HBx_P-B of FT:mat_peptide JQ707756_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_39). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707757_HBx_P-B Product feature CHAIN JQ707757_HBx_P-B of FT:mat_peptide JQ707757_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_40). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MVARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707758_HBx_P-B Product feature CHAIN JQ707758_HBx_P-B of FT:mat_peptide JQ707758_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707759_HBx_P-B Product feature CHAIN JQ707759_HBx_P-B of FT:mat_peptide JQ707759_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707760_HBx_P-B Product feature CHAIN JQ707760_HBx_P-B of FT:mat_peptide JQ707760_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_44). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707761_HBx_P-B Product feature CHAIN JQ707761_HBx_P-B of FT:mat_peptide JQ707761_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_45). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707762_HBx_P-B Product feature CHAIN JQ707762_HBx_P-B of FT:mat_peptide JQ707762_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPERDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707763_HBx_P-B Product feature CHAIN JQ707763_HBx_P-B of FT:mat_peptide JQ707763_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707764_HBx_P-B Product feature CHAIN JQ707764_HBx_P-B of FT:mat_peptide JQ707764_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707765_HBx_P-B Product feature CHAIN JQ707765_HBx_P-B of FT:mat_peptide JQ707765_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707766_HBx_P-B Product feature CHAIN JQ707766_HBx_P-B of FT:mat_peptide JQ707766_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707767_HBx_P-B Product feature CHAIN JQ707767_HBx_P-B of FT:mat_peptide JQ707767_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801471_HBx_P-B Product feature CHAIN JQ801471_HBx_P-B of FT:mat_peptide JQ801471_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801474_HBx_P-B Product feature CHAIN JQ801474_HBx_P-B of FT:mat_peptide JQ801474_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801479_HBx_P-B Product feature CHAIN JQ801479_HBx_P-B of FT:mat_peptide JQ801479_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801485_HBx_P-B Product feature CHAIN JQ801485_HBx_P-B of FT:mat_peptide JQ801485_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLAALSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ801494_HBx_P-B Product feature CHAIN JQ801494_HBx_P-B of FT:mat_peptide JQ801494_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801506_HBx_P-B Product feature CHAIN JQ801506_HBx_P-B of FT:mat_peptide JQ801506_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPSVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEMRLKVFVLGGCRHKLVCSPXPCHFFTSA
>gnl|hbvpro|JQ801507_HBx_P-B Product feature CHAIN JQ801507_HBx_P-B of FT:mat_peptide JQ801507_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDQRAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801512_HBx_P-B Product feature CHAIN JQ801512_HBx_P-B of FT:mat_peptide JQ801512_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSLAPCNFFTSA
>gnl|hbvpro|JQ801514_HBx_P-B Product feature CHAIN JQ801514_HBx_P-B of FT:mat_peptide JQ801514_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801516_HBx_P-B Product feature CHAIN JQ801516_HBx_P-B of FT:mat_peptide JQ801516_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801524_HBx_P-B Product feature CHAIN JQ801524_HBx_P-B of FT:mat_peptide JQ801524_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026879_HBx_P-B Product feature CHAIN JX026879_HBx_P-B of FT:mat_peptide JX026879_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX026883_HBx_P-B Product feature CHAIN JX026883_HBx_P-B of FT:mat_peptide JX026883_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-50). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHERTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIYALGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026886_HBx_P-B Product feature CHAIN JX026886_HBx_P-B of FT:mat_peptide JX026886_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-73). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQPDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429897_HBx_P-B Product feature CHAIN JX429897_HBx_P-B of FT:mat_peptide JX429897_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLSLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX429899_HBx_P-B Product feature CHAIN JX429899_HBx_P-B of FT:mat_peptide JX429899_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429900_HBx_P-B Product feature CHAIN JX429900_HBx_P-B of FT:mat_peptide JX429900_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429901_HBx_P-B Product feature CHAIN JX429901_HBx_P-B of FT:mat_peptide JX429901_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429902_HBx_P-B Product feature CHAIN JX429902_HBx_P-B of FT:mat_peptide JX429902_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429908_HBx_P-B Product feature CHAIN JX429908_HBx_P-B of FT:mat_peptide JX429908_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429910_HBx_P-B Product feature CHAIN JX429910_HBx_P-B of FT:mat_peptide JX429910_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504531_HBx_P-B Product feature CHAIN JX504531_HBx_P-B of FT:mat_peptide JX504531_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=153 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMV
LVNTHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEDLGEEVRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX504532_HBx_P-B Product feature CHAIN JX504532_HBx_P-B of FT:mat_peptide JX504532_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGAEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504533_HBx_P-B Product feature CHAIN JX504533_HBx_P-B of FT:mat_peptide JX504533_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNVHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFNEWEELGAEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504538_HBx_P-B Product feature CHAIN JX504538_HBx_P-B of FT:mat_peptide JX504538_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKSTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504543_HBx_P-B Product feature CHAIN JX504543_HBx_P-B of FT:mat_peptide JX504543_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NNJ-19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX507210_HBx_P-B Product feature CHAIN JX507210_HBx_P-B of FT:mat_peptide JX507210_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHENLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX507213_HBx_P-B Product feature CHAIN JX507213_HBx_P-B of FT:mat_peptide JX507213_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTXGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLXVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JX507215_HBx_P-B Product feature CHAIN JX507215_HBx_P-B of FT:mat_peptide JX507215_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 310). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEFGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661470_HBx_P-B Product feature CHAIN JX661470_HBx_P-B of FT:mat_peptide JX661470_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1221-B12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSNYGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661471_HBx_P-B Product feature CHAIN JX661471_HBx_P-B of FT:mat_peptide JX661471_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1202-B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661472_HBx_P-B Product feature CHAIN JX661472_HBx_P-B of FT:mat_peptide JX661472_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1224-B13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661473_HBx_P-B Product feature CHAIN JX661473_HBx_P-B of FT:mat_peptide JX661473_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1220-B11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPHLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661474_HBx_P-B Product feature CHAIN JX661474_HBx_P-B of FT:mat_peptide JX661474_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1229-B15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661475_HBx_P-B Product feature CHAIN JX661475_HBx_P-B of FT:mat_peptide JX661475_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1216-B9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661476_HBx_P-B Product feature CHAIN JX661476_HBx_P-B of FT:mat_peptide JX661476_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1227-B14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661477_HBx_P-B Product feature CHAIN JX661477_HBx_P-B of FT:mat_peptide JX661477_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1209-B5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGDEVRLKVLYLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661478_HBx_P-B Product feature CHAIN JX661478_HBx_P-B of FT:mat_peptide JX661478_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1211-B7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661479_HBx_P-B Product feature CHAIN JX661479_HBx_P-B of FT:mat_peptide JX661479_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1219-B10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGAEVRLMIFVLGGLRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661480_HBx_P-B Product feature CHAIN JX661480_HBx_P-B of FT:mat_peptide JX661480_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1210-B6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661481_HBx_P-B Product feature CHAIN JX661481_HBx_P-B of FT:mat_peptide JX661481_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1214-B8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVFPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVLYLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661482_HBx_P-B Product feature CHAIN JX661482_HBx_P-B of FT:mat_peptide JX661482_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1204-B2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVCVLGGCCYERVCSPAPCNFFTLA
>gnl|hbvpro|JX661483_HBx_P-B Product feature CHAIN JX661483_HBx_P-B of FT:mat_peptide JX661483_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1205-B3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVCVLGGCCYERVCSPAPCNFFTLA
>gnl|hbvpro|JX661484_HBx_P-B Product feature CHAIN JX661484_HBx_P-B of FT:mat_peptide JX661484_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1206-B4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX869998_HBx_P-B Product feature CHAIN JX869998_HBx_P-B of FT:mat_peptide JX869998_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 317). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX869999_HBx_P-B Product feature CHAIN JX869999_HBx_P-B of FT:mat_peptide JX869999_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGTLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX870001_HBx_P-B Product feature CHAIN JX870001_HBx_P-B of FT:mat_peptide JX870001_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JX978431_HBx_P-B Product feature CHAIN JX978431_HBx_P-B of FT:mat_peptide JX978431_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate X02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163805_HBx_P-B Product feature CHAIN KC163805_HBx_P-B of FT:mat_peptide KC163805_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3009). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEMRLTVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163809_HBx_P-B Product feature CHAIN KC163809_HBx_P-B of FT:mat_peptide KC163809_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3043). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLEALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEKLGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163810_HBx_P-B Product feature CHAIN KC163810_HBx_P-B of FT:mat_peptide KC163810_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3004). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163811_HBx_P-B Product feature CHAIN KC163811_HBx_P-B of FT:mat_peptide KC163811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3010). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163812_HBx_P-B Product feature CHAIN KC163812_HBx_P-B of FT:mat_peptide KC163812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3024). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163813_HBx_P-B Product feature CHAIN KC163813_HBx_P-B of FT:mat_peptide KC163813_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3029). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163814_HBx_P-B Product feature CHAIN KC163814_HBx_P-B of FT:mat_peptide KC163814_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3046). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCRLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163815_HBx_P-B Product feature CHAIN KC163815_HBx_P-B of FT:mat_peptide KC163815_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3048). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRILGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163816_HBx_P-B Product feature CHAIN KC163816_HBx_P-B of FT:mat_peptide KC163816_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3002). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163817_HBx_P-B Product feature CHAIN KC163817_HBx_P-B of FT:mat_peptide KC163817_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3003). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163818_HBx_P-B Product feature CHAIN KC163818_HBx_P-B of FT:mat_peptide KC163818_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3013). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163819_HBx_P-B Product feature CHAIN KC163819_HBx_P-B of FT:mat_peptide KC163819_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163820_HBx_P-B Product feature CHAIN KC163820_HBx_P-B of FT:mat_peptide KC163820_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3016). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163821_HBx_P-B Product feature CHAIN KC163821_HBx_P-B of FT:mat_peptide KC163821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3018). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163822_HBx_P-B Product feature CHAIN KC163822_HBx_P-B of FT:mat_peptide KC163822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3025). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163823_HBx_P-B Product feature CHAIN KC163823_HBx_P-B of FT:mat_peptide KC163823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3026). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163824_HBx_P-B Product feature CHAIN KC163824_HBx_P-B of FT:mat_peptide KC163824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3027). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163825_HBx_P-B Product feature CHAIN KC163825_HBx_P-B of FT:mat_peptide KC163825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3031). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163826_HBx_P-B Product feature CHAIN KC163826_HBx_P-B of FT:mat_peptide KC163826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3033). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163827_HBx_P-B Product feature CHAIN KC163827_HBx_P-B of FT:mat_peptide KC163827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163828_HBx_P-B Product feature CHAIN KC163828_HBx_P-B of FT:mat_peptide KC163828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3035). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163829_HBx_P-B Product feature CHAIN KC163829_HBx_P-B of FT:mat_peptide KC163829_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3040). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163830_HBx_P-B Product feature CHAIN KC163830_HBx_P-B of FT:mat_peptide KC163830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3021). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163831_HBx_P-B Product feature CHAIN KC163831_HBx_P-B of FT:mat_peptide KC163831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3044). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163833_HBx_P-B Product feature CHAIN KC163833_HBx_P-B of FT:mat_peptide KC163833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC315393_HBx_P-B Product feature CHAIN KC315393_HBx_P-B of FT:mat_peptide KC315393_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0912). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC492739_HBx_P-B Product feature CHAIN KC492739_HBx_P-B of FT:mat_peptide KC492739_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MT). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC492740_HBx_P-B Product feature CHAIN KC492740_HBx_P-B of FT:mat_peptide KC492740_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Del). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC510641_HBx_P-B Product feature CHAIN KC510641_HBx_P-B of FT:mat_peptide KC510641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCGFFTSA
>gnl|hbvpro|KC510642_HBx_P-B Product feature CHAIN KC510642_HBx_P-B of FT:mat_peptide KC510642_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPRGFFTSA
>gnl|hbvpro|KC510643_HBx_P-B Product feature CHAIN KC510643_HBx_P-B of FT:mat_peptide KC510643_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510644_HBx_P-B Product feature CHAIN KC510644_HBx_P-B of FT:mat_peptide KC510644_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNPHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLMRSRCPRDFFTSA
>gnl|hbvpro|KC510646_HBx_P-B Product feature CHAIN KC510646_HBx_P-B of FT:mat_peptide KC510646_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSPTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVRSRGPRGFFTSA
>gnl|hbvpro|KC510647_HBx_P-B Product feature CHAIN KC510647_HBx_P-B of FT:mat_peptide KC510647_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510648_HBx_P-B Product feature CHAIN KC510648_HBx_P-B of FT:mat_peptide KC510648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNPHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLMRSRCPCGFFTSA
>gnl|hbvpro|KC510649_HBx_P-B Product feature CHAIN KC510649_HBx_P-B of FT:mat_peptide KC510649_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCGFFTSA
>gnl|hbvpro|KC510650_HBx_P-B Product feature CHAIN KC510650_HBx_P-B of FT:mat_peptide KC510650_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510651_HBx_P-B Product feature CHAIN KC510651_HBx_P-B of FT:mat_peptide KC510651_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510652_HBx_P-B Product feature CHAIN KC510652_HBx_P-B of FT:mat_peptide KC510652_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510653_HBx_P-B Product feature CHAIN KC510653_HBx_P-B of FT:mat_peptide KC510653_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSPTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVRSRGPCGFFTSA
>gnl|hbvpro|KC510654_HBx_P-B Product feature CHAIN KC510654_HBx_P-B of FT:mat_peptide KC510654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510655_HBx_P-B Product feature CHAIN KC510655_HBx_P-B of FT:mat_peptide KC510655_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510656_HBx_P-B Product feature CHAIN KC510656_HBx_P-B of FT:mat_peptide KC510656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVRSRGPCGFFTSA
>gnl|hbvpro|KC510657_HBx_P-B Product feature CHAIN KC510657_HBx_P-B of FT:mat_peptide KC510657_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510658_HBx_P-B Product feature CHAIN KC510658_HBx_P-B of FT:mat_peptide KC510658_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCGFFTSA
>gnl|hbvpro|KC510659_HBx_P-B Product feature CHAIN KC510659_HBx_P-B of FT:mat_peptide KC510659_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSPTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510660_HBx_P-B Product feature CHAIN KC510660_HBx_P-B of FT:mat_peptide KC510660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC774362_HBx_P-B Product feature CHAIN KC774362_HBx_P-B of FT:mat_peptide KC774362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz1107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDPGAHLSLRGLPVCAFSSTGPCALRFTSARSME
TTVNAHRNLPKVLHKRTLVLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774363_HBx_P-B Product feature CHAIN KC774363_HBx_P-B of FT:mat_peptide KC774363_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774365_HBx_P-B Product feature CHAIN KC774365_HBx_P-B of FT:mat_peptide KC774365_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774366_HBx_P-B Product feature CHAIN KC774366_HBx_P-B of FT:mat_peptide KC774366_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774367_HBx_P-B Product feature CHAIN KC774367_HBx_P-B of FT:mat_peptide KC774367_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2147). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774368_HBx_P-B Product feature CHAIN KC774368_HBx_P-B of FT:mat_peptide KC774368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1012). Complete genome. [Hepadnaviridae] (length=154 residues).
MGGRLCCQMDPARDVLCLRPVGAESRGRPLPGPLGALPPAFPPVVPTDHGAHLSLRGLPVCAFSFAGPCALCFTFARCKE
TPVNAHRNLPKVLHKRTLGLSAKSTTDLEAYFKDSLFTEWEELGEEVKLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774369_HBx_P-B Product feature CHAIN KC774369_HBx_P-B of FT:mat_peptide KC774369_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQMDPARDVLCLRPVGAESRGRPPPGPLGALPPASPFAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRNFGLLAMSTTDPEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774370_HBx_P-B Product feature CHAIN KC774370_HBx_P-B of FT:mat_peptide KC774370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1014). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAFPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774371_HBx_P-B Product feature CHAIN KC774371_HBx_P-B of FT:mat_peptide KC774371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1036). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774372_HBx_P-B Product feature CHAIN KC774372_HBx_P-B of FT:mat_peptide KC774372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDPGGPLSLRGLPVCAFSSAGPCALCFPSARRME
TPVNAPRNFPKVLQKRIFVLSEMSTTDLEAYFKNCVFNEWEELGEDIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774373_HBx_P-B Product feature CHAIN KC774373_HBx_P-B of FT:mat_peptide KC774373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774374_HBx_P-B Product feature CHAIN KC774374_HBx_P-B of FT:mat_peptide KC774374_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1053). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774375_HBx_P-B Product feature CHAIN KC774375_HBx_P-B of FT:mat_peptide KC774375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGDLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTYARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774376_HBx_P-B Product feature CHAIN KC774376_HBx_P-B of FT:mat_peptide KC774376_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1056). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774377_HBx_P-B Product feature CHAIN KC774377_HBx_P-B of FT:mat_peptide KC774377_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774378_HBx_P-B Product feature CHAIN KC774378_HBx_P-B of FT:mat_peptide KC774378_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1015). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774379_HBx_P-B Product feature CHAIN KC774379_HBx_P-B of FT:mat_peptide KC774379_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1023). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774380_HBx_P-B Product feature CHAIN KC774380_HBx_P-B of FT:mat_peptide KC774380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774381_HBx_P-B Product feature CHAIN KC774381_HBx_P-B of FT:mat_peptide KC774381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1062). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774382_HBx_P-B Product feature CHAIN KC774382_HBx_P-B of FT:mat_peptide KC774382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRNLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVVAGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774383_HBx_P-B Product feature CHAIN KC774383_HBx_P-B of FT:mat_peptide KC774383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1081). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774384_HBx_P-B Product feature CHAIN KC774384_HBx_P-B of FT:mat_peptide KC774384_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774385_HBx_P-B Product feature CHAIN KC774385_HBx_P-B of FT:mat_peptide KC774385_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1099). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774386_HBx_P-B Product feature CHAIN KC774386_HBx_P-B of FT:mat_peptide KC774386_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPTPPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774387_HBx_P-B Product feature CHAIN KC774387_HBx_P-B of FT:mat_peptide KC774387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774388_HBx_P-B Product feature CHAIN KC774388_HBx_P-B of FT:mat_peptide KC774388_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774389_HBx_P-B Product feature CHAIN KC774389_HBx_P-B of FT:mat_peptide KC774389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774390_HBx_P-B Product feature CHAIN KC774390_HBx_P-B of FT:mat_peptide KC774390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2158). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774391_HBx_P-B Product feature CHAIN KC774391_HBx_P-B of FT:mat_peptide KC774391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2163). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774392_HBx_P-B Product feature CHAIN KC774392_HBx_P-B of FT:mat_peptide KC774392_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2169). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774393_HBx_P-B Product feature CHAIN KC774393_HBx_P-B of FT:mat_peptide KC774393_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1068). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLTGPLGALPPASPPIVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNSHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774394_HBx_P-B Product feature CHAIN KC774394_HBx_P-B of FT:mat_peptide KC774394_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1070). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774395_HBx_P-B Product feature CHAIN KC774395_HBx_P-B of FT:mat_peptide KC774395_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1073). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774396_HBx_P-B Product feature CHAIN KC774396_HBx_P-B of FT:mat_peptide KC774396_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1182). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774397_HBx_P-B Product feature CHAIN KC774397_HBx_P-B of FT:mat_peptide KC774397_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFRDCVFTEWEELGEEVRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774398_HBx_P-B Product feature CHAIN KC774398_HBx_P-B of FT:mat_peptide KC774398_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774399_HBx_P-B Product feature CHAIN KC774399_HBx_P-B of FT:mat_peptide KC774399_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1556). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774400_HBx_P-B Product feature CHAIN KC774400_HBx_P-B of FT:mat_peptide KC774400_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1585). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSVLSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774401_HBx_P-B Product feature CHAIN KC774401_HBx_P-B of FT:mat_peptide KC774401_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1663). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774402_HBx_P-B Product feature CHAIN KC774402_HBx_P-B of FT:mat_peptide KC774402_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1670). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774403_HBx_P-B Product feature CHAIN KC774403_HBx_P-B of FT:mat_peptide KC774403_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774404_HBx_P-B Product feature CHAIN KC774404_HBx_P-B of FT:mat_peptide KC774404_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774405_HBx_P-B Product feature CHAIN KC774405_HBx_P-B of FT:mat_peptide KC774405_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLRALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYIKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774406_HBx_P-B Product feature CHAIN KC774406_HBx_P-B of FT:mat_peptide KC774406_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVICLRPVGAESCGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774407_HBx_P-B Product feature CHAIN KC774407_HBx_P-B of FT:mat_peptide KC774407_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774408_HBx_P-B Product feature CHAIN KC774408_HBx_P-B of FT:mat_peptide KC774408_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2012). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774409_HBx_P-B Product feature CHAIN KC774409_HBx_P-B of FT:mat_peptide KC774409_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774410_HBx_P-B Product feature CHAIN KC774410_HBx_P-B of FT:mat_peptide KC774410_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774411_HBx_P-B Product feature CHAIN KC774411_HBx_P-B of FT:mat_peptide KC774411_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2025). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774412_HBx_P-B Product feature CHAIN KC774412_HBx_P-B of FT:mat_peptide KC774412_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774413_HBx_P-B Product feature CHAIN KC774413_HBx_P-B of FT:mat_peptide KC774413_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2037). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774415_HBx_P-B Product feature CHAIN KC774415_HBx_P-B of FT:mat_peptide KC774415_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774416_HBx_P-B Product feature CHAIN KC774416_HBx_P-B of FT:mat_peptide KC774416_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1016). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLYLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774417_HBx_P-B Product feature CHAIN KC774417_HBx_P-B of FT:mat_peptide KC774417_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1028). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774418_HBx_P-B Product feature CHAIN KC774418_HBx_P-B of FT:mat_peptide KC774418_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774419_HBx_P-B Product feature CHAIN KC774419_HBx_P-B of FT:mat_peptide KC774419_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1083). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814873_HBx_P-B Product feature CHAIN KC814873_HBx_P-B of FT:mat_peptide KC814873_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209422C). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLTNAREVLCLRPVGAESRGRPLPGPLGALPSASSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLMIFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KC814875_HBx_P-B Product feature CHAIN KC814875_HBx_P-B of FT:mat_peptide KC814875_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209424C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
FAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKCCCLLAPCNFFTSA
>gnl|hbvpro|KC814883_HBx_P-B Product feature CHAIN KC814883_HBx_P-B of FT:mat_peptide KC814883_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209432C). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLTNRREVLCLRPVGAESRGRPLSGPLGALPPPSPPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRDLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFGLRGGRHRLICSPPPCNFFTSA
>gnl|hbvpro|KC814890_HBx_P-B Product feature CHAIN KC814890_HBx_P-B of FT:mat_peptide KC814890_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M020944P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSLIPCNFFTSS
>gnl|hbvpro|KC814917_HBx_P-B Product feature CHAIN KC814917_HBx_P-B of FT:mat_peptide KC814917_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209431P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSLIACNFFTSA
>gnl|hbvpro|KC814918_HBx_P-B Product feature CHAIN KC814918_HBx_P-B of FT:mat_peptide KC814918_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209432P). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLKLARDSLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSLPSCNFFTSA
>gnl|hbvpro|KJ173297_HBx_P-B Product feature CHAIN KJ173297_HBx_P-B of FT:mat_peptide KJ173297_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008C(e46n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173298_HBx_P-B Product feature CHAIN KJ173298_HBx_P-B of FT:mat_peptide KJ173298_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008M(e47)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173339_HBx_P-B Product feature CHAIN KJ173339_HBx_P-B of FT:mat_peptide KJ173339_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001C(e201)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEDVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173340_HBx_P-B Product feature CHAIN KJ173340_HBx_P-B of FT:mat_peptide KJ173340_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001M(e202)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEDVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173341_HBx_P-B Product feature CHAIN KJ173341_HBx_P-B of FT:mat_peptide KJ173341_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003C(e204)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173342_HBx_P-B Product feature CHAIN KJ173342_HBx_P-B of FT:mat_peptide KJ173342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003M(e205)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173343_HBx_P-B Product feature CHAIN KJ173343_HBx_P-B of FT:mat_peptide KJ173343_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX007C(e211)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173345_HBx_P-B Product feature CHAIN KJ173345_HBx_P-B of FT:mat_peptide KJ173345_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX008C(e214)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173347_HBx_P-B Product feature CHAIN KJ173347_HBx_P-B of FT:mat_peptide KJ173347_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012C(e220)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173348_HBx_P-B Product feature CHAIN KJ173348_HBx_P-B of FT:mat_peptide KJ173348_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012M(e221)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173351_HBx_P-B Product feature CHAIN KJ173351_HBx_P-B of FT:mat_peptide KJ173351_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025C(e234)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTTYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173352_HBx_P-B Product feature CHAIN KJ173352_HBx_P-B of FT:mat_peptide KJ173352_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025M(e235n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173353_HBx_P-B Product feature CHAIN KJ173353_HBx_P-B of FT:mat_peptide KJ173353_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027C(e237)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173354_HBx_P-B Product feature CHAIN KJ173354_HBx_P-B of FT:mat_peptide KJ173354_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027M(e235n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173355_HBx_P-B Product feature CHAIN KJ173355_HBx_P-B of FT:mat_peptide KJ173355_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032C(e247n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173356_HBx_P-B Product feature CHAIN KJ173356_HBx_P-B of FT:mat_peptide KJ173356_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032M(e248n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173357_HBx_P-B Product feature CHAIN KJ173357_HBx_P-B of FT:mat_peptide KJ173357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX065C(e313)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRAVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGAEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173359_HBx_P-B Product feature CHAIN KJ173359_HBx_P-B of FT:mat_peptide KJ173359_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161C(m162)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173360_HBx_P-B Product feature CHAIN KJ173360_HBx_P-B of FT:mat_peptide KJ173360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161M(m161)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARWNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173361_HBx_P-B Product feature CHAIN KJ173361_HBx_P-B of FT:mat_peptide KJ173361_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041C(m42)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173362_HBx_P-B Product feature CHAIN KJ173362_HBx_P-B of FT:mat_peptide KJ173362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041M(m41)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173363_HBx_P-B Product feature CHAIN KJ173363_HBx_P-B of FT:mat_peptide KJ173363_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-C(006)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173364_HBx_P-B Product feature CHAIN KJ173364_HBx_P-B of FT:mat_peptide KJ173364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-M(007)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173365_HBx_P-B Product feature CHAIN KJ173365_HBx_P-B of FT:mat_peptide KJ173365_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-C(009)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173366_HBx_P-B Product feature CHAIN KJ173366_HBx_P-B of FT:mat_peptide KJ173366_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-M(011)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173367_HBx_P-B Product feature CHAIN KJ173367_HBx_P-B of FT:mat_peptide KJ173367_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-C(B1)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173368_HBx_P-B Product feature CHAIN KJ173368_HBx_P-B of FT:mat_peptide KJ173368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-M(B3)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173369_HBx_P-B Product feature CHAIN KJ173369_HBx_P-B of FT:mat_peptide KJ173369_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-C(B37)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173370_HBx_P-B Product feature CHAIN KJ173370_HBx_P-B of FT:mat_peptide KJ173370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-M(B39)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173371_HBx_P-B Product feature CHAIN KJ173371_HBx_P-B of FT:mat_peptide KJ173371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P009-C(B135)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173372_HBx_P-B Product feature CHAIN KJ173372_HBx_P-B of FT:mat_peptide KJ173372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P009-M2(B137)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173373_HBx_P-B Product feature CHAIN KJ173373_HBx_P-B of FT:mat_peptide KJ173373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-C1(147a)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPNVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173374_HBx_P-B Product feature CHAIN KJ173374_HBx_P-B of FT:mat_peptide KJ173374_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-M(B149)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173375_HBx_P-B Product feature CHAIN KJ173375_HBx_P-B of FT:mat_peptide KJ173375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004C(e107)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173376_HBx_P-B Product feature CHAIN KJ173376_HBx_P-B of FT:mat_peptide KJ173376_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004M(e108)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173377_HBx_P-B Product feature CHAIN KJ173377_HBx_P-B of FT:mat_peptide KJ173377_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY014C(e115)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ173378_HBx_P-B Product feature CHAIN KJ173378_HBx_P-B of FT:mat_peptide KJ173378_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY014M(e116)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ173379_HBx_P-B Product feature CHAIN KJ173379_HBx_P-B of FT:mat_peptide KJ173379_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019C(e121)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173380_HBx_P-B Product feature CHAIN KJ173380_HBx_P-B of FT:mat_peptide KJ173380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019M(e122)). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHNRTLGLLAMSTTDLEAYFKDCVFTECEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173381_HBx_P-B Product feature CHAIN KJ173381_HBx_P-B of FT:mat_peptide KJ173381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-C(FY137Cn).fas). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173382_HBx_P-B Product feature CHAIN KJ173382_HBx_P-B of FT:mat_peptide KJ173382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137An).fas). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173383_HBx_P-B Product feature CHAIN KJ173383_HBx_P-B of FT:mat_peptide KJ173383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YZ009C(e30)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173384_HBx_P-B Product feature CHAIN KJ173384_HBx_P-B of FT:mat_peptide KJ173384_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YZ009M(e31)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173385_HBx_P-B Product feature CHAIN KJ173385_HBx_P-B of FT:mat_peptide KJ173385_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-M(m603)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173386_HBx_P-B Product feature CHAIN KJ173386_HBx_P-B of FT:mat_peptide KJ173386_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-C(m604)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPSALRLTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173387_HBx_P-B Product feature CHAIN KJ173387_HBx_P-B of FT:mat_peptide KJ173387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-M(m607)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173388_HBx_P-B Product feature CHAIN KJ173388_HBx_P-B of FT:mat_peptide KJ173388_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-C(m608)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173389_HBx_P-B Product feature CHAIN KJ173389_HBx_P-B of FT:mat_peptide KJ173389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-M(m617)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173390_HBx_P-B Product feature CHAIN KJ173390_HBx_P-B of FT:mat_peptide KJ173390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-C(m618)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173397_HBx_P-B Product feature CHAIN KJ173397_HBx_P-B of FT:mat_peptide KJ173397_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-M(134A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173398_HBx_P-B Product feature CHAIN KJ173398_HBx_P-B of FT:mat_peptide KJ173398_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-C(134B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173399_HBx_P-B Product feature CHAIN KJ173399_HBx_P-B of FT:mat_peptide KJ173399_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-M(4161A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173400_HBx_P-B Product feature CHAIN KJ173400_HBx_P-B of FT:mat_peptide KJ173400_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-C(4230B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173401_HBx_P-B Product feature CHAIN KJ173401_HBx_P-B of FT:mat_peptide KJ173401_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-M(6720A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPAVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173402_HBx_P-B Product feature CHAIN KJ173402_HBx_P-B of FT:mat_peptide KJ173402_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-C(3733B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPAVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173403_HBx_P-B Product feature CHAIN KJ173403_HBx_P-B of FT:mat_peptide KJ173403_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-M(6641M)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ173404_HBx_P-B Product feature CHAIN KJ173404_HBx_P-B of FT:mat_peptide KJ173404_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-C(3953B)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ173405_HBx_P-B Product feature CHAIN KJ173405_HBx_P-B of FT:mat_peptide KJ173405_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-M(6642A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173406_HBx_P-B Product feature CHAIN KJ173406_HBx_P-B of FT:mat_peptide KJ173406_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N11-C(3965B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173407_HBx_P-B Product feature CHAIN KJ173407_HBx_P-B of FT:mat_peptide KJ173407_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-M(6650A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173408_HBx_P-B Product feature CHAIN KJ173408_HBx_P-B of FT:mat_peptide KJ173408_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N13-C(4198B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173409_HBx_P-B Product feature CHAIN KJ173409_HBx_P-B of FT:mat_peptide KJ173409_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-M(6692A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173410_HBx_P-B Product feature CHAIN KJ173410_HBx_P-B of FT:mat_peptide KJ173410_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N14-C(4171B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173411_HBx_P-B Product feature CHAIN KJ173411_HBx_P-B of FT:mat_peptide KJ173411_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-M(6579A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173412_HBx_P-B Product feature CHAIN KJ173412_HBx_P-B of FT:mat_peptide KJ173412_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N15-C(4159b)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173413_HBx_P-B Product feature CHAIN KJ173413_HBx_P-B of FT:mat_peptide KJ173413_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173414_HBx_P-B Product feature CHAIN KJ173414_HBx_P-B of FT:mat_peptide KJ173414_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_C(FY137B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173415_HBx_P-B Product feature CHAIN KJ173415_HBx_P-B of FT:mat_peptide KJ173415_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-V(FY137C)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173416_HBx_P-B Product feature CHAIN KJ173416_HBx_P-B of FT:mat_peptide KJ173416_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201M(e401)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ173417_HBx_P-B Product feature CHAIN KJ173417_HBx_P-B of FT:mat_peptide KJ173417_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N201C(e402)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ173420_HBx_P-B Product feature CHAIN KJ173420_HBx_P-B of FT:mat_peptide KJ173420_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203M(e405)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173421_HBx_P-B Product feature CHAIN KJ173421_HBx_P-B of FT:mat_peptide KJ173421_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N203C(e406)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173422_HBx_P-B Product feature CHAIN KJ173422_HBx_P-B of FT:mat_peptide KJ173422_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204M(e407)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSSMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173423_HBx_P-B Product feature CHAIN KJ173423_HBx_P-B of FT:mat_peptide KJ173423_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N204C(e408)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSSMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173424_HBx_P-B Product feature CHAIN KJ173424_HBx_P-B of FT:mat_peptide KJ173424_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205M(e409)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173425_HBx_P-B Product feature CHAIN KJ173425_HBx_P-B of FT:mat_peptide KJ173425_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N205C(e410)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410490_HBx_P-B Product feature CHAIN KJ410490_HBx_P-B of FT:mat_peptide KJ410490_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HK_1329). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|KJ410500_HBx_P-B Product feature CHAIN KJ410500_HBx_P-B of FT:mat_peptide KJ410500_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK321). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALLFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ410502_HBx_P-B Product feature CHAIN KJ410502_HBx_P-B of FT:mat_peptide KJ410502_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK318). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHERTLGLSAMSTTDLEAYFKDCVFTEWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410507_HBx_P-B Product feature CHAIN KJ410507_HBx_P-B of FT:mat_peptide KJ410507_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK6840). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410516_HBx_P-B Product feature CHAIN KJ410516_HBx_P-B of FT:mat_peptide KJ410516_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4777). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410517_HBx_P-B Product feature CHAIN KJ410517_HBx_P-B of FT:mat_peptide KJ410517_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Occult_HK4901). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ790200_HBx_P-B Product feature CHAIN KJ790200_HBx_P-B of FT:mat_peptide KJ790200_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ803752_HBx_P-B Product feature CHAIN KJ803752_HBx_P-B of FT:mat_peptide KJ803752_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY155693). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803755_HBx_P-B Product feature CHAIN KJ803755_HBx_P-B of FT:mat_peptide KJ803755_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY247131). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803756_HBx_P-B Product feature CHAIN KJ803756_HBx_P-B of FT:mat_peptide KJ803756_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727495). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGAEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803758_HBx_P-B Product feature CHAIN KJ803758_HBx_P-B of FT:mat_peptide KJ803758_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY484998). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCLPAPCNFFTSA
>gnl|hbvpro|KJ803763_HBx_P-B Product feature CHAIN KJ803763_HBx_P-B of FT:mat_peptide KJ803763_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY790800). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803764_HBx_P-B Product feature CHAIN KJ803764_HBx_P-B of FT:mat_peptide KJ803764_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY043147). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803768_HBx_P-B Product feature CHAIN KJ803768_HBx_P-B of FT:mat_peptide KJ803768_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY495063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKVVCSPAPCNFFTSA
>gnl|hbvpro|KJ803773_HBx_P-B Product feature CHAIN KJ803773_HBx_P-B of FT:mat_peptide KJ803773_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY727093). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHVNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803775_HBx_P-B Product feature CHAIN KJ803775_HBx_P-B of FT:mat_peptide KJ803775_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY741196). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHVNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGERVRLKVFVLGGCRHKLVCSPAPCNFFTFS
>gnl|hbvpro|KJ803781_HBx_P-B Product feature CHAIN KJ803781_HBx_P-B of FT:mat_peptide KJ803781_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY799421). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803783_HBx_P-B Product feature CHAIN KJ803783_HBx_P-B of FT:mat_peptide KJ803783_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY266289). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNIFTSA
>gnl|hbvpro|KJ803784_HBx_P-B Product feature CHAIN KJ803784_HBx_P-B of FT:mat_peptide KJ803784_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY781114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803786_HBx_P-B Product feature CHAIN KJ803786_HBx_P-B of FT:mat_peptide KJ803786_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY846440). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803787_HBx_P-B Product feature CHAIN KJ803787_HBx_P-B of FT:mat_peptide KJ803787_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY853571). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803789_HBx_P-B Product feature CHAIN KJ803789_HBx_P-B of FT:mat_peptide KJ803789_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY303852). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFSLSA
>gnl|hbvpro|KJ803795_HBx_P-B Product feature CHAIN KJ803795_HBx_P-B of FT:mat_peptide KJ803795_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY789421). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGLLIGELGDVLRGWKAKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803796_HBx_P-B Product feature CHAIN KJ803796_HBx_P-B of FT:mat_peptide KJ803796_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY711763). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCVFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIGELGDVLRGWKAKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803797_HBx_P-B Product feature CHAIN KJ803797_HBx_P-B of FT:mat_peptide KJ803797_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY775775). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803801_HBx_P-B Product feature CHAIN KJ803801_HBx_P-B of FT:mat_peptide KJ803801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY035746). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803805_HBx_P-B Product feature CHAIN KJ803805_HBx_P-B of FT:mat_peptide KJ803805_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY491666). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEGDELMIFVLGGCRHKVVCSPAPCNFFTSA
>gnl|hbvpro|KJ803808_HBx_P-B Product feature CHAIN KJ803808_HBx_P-B of FT:mat_peptide KJ803808_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY571290). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803816_HBx_P-B Product feature CHAIN KJ803816_HBx_P-B of FT:mat_peptide KJ803816_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY540630). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIFVLGGCRHKVVCSPAPCNFFTSA
>gnl|hbvpro|KJ803817_HBx_P-B Product feature CHAIN KJ803817_HBx_P-B of FT:mat_peptide KJ803817_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY241913). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803819_HBx_P-B Product feature CHAIN KJ803819_HBx_P-B of FT:mat_peptide KJ803819_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY131767). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDRWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803820_HBx_P-B Product feature CHAIN KJ803820_HBx_P-B of FT:mat_peptide KJ803820_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY081397). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARNVLCLRPVGAESRGRPLPGSLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803824_HBx_P-B Product feature CHAIN KJ803824_HBx_P-B of FT:mat_peptide KJ803824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY502457). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKWVCSPAPCNFFTSA
>gnl|hbvpro|KJ803825_HBx_P-B Product feature CHAIN KJ803825_HBx_P-B of FT:mat_peptide KJ803825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY381508). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPASPHLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGWRDKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843165_HBx_P-B Product feature CHAIN KJ843165_HBx_P-B of FT:mat_peptide KJ843165_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ag03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM213032_HBx_P-B Product feature CHAIN KM213032_HBx_P-B of FT:mat_peptide KM213032_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LRF-k1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHKNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGVEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM213034_HBx_P-B Product feature CHAIN KM213034_HBx_P-B of FT:mat_peptide KM213034_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYG-k1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM213035_HBx_P-B Product feature CHAIN KM213035_HBx_P-B of FT:mat_peptide KM213035_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MRG-k1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM213036_HBx_P-B Product feature CHAIN KM213036_HBx_P-B of FT:mat_peptide KM213036_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CSW-k1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KM359440_HBx_P-B Product feature CHAIN KM359440_HBx_P-B of FT:mat_peptide KM359440_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FF3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFPSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM392072_HBx_P-B Product feature CHAIN KM392072_HBx_P-B of FT:mat_peptide KM392072_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|KM392083_HBx_P-B Product feature CHAIN KM392083_HBx_P-B of FT:mat_peptide KM392083_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate V41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM875416_HBx_P-B Product feature CHAIN KM875416_HBx_P-B of FT:mat_peptide KM875416_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt9N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM875417_HBx_P-B Product feature CHAIN KM875417_HBx_P-B of FT:mat_peptide KM875417_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt9T). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM875418_HBx_P-B Product feature CHAIN KM875418_HBx_P-B of FT:mat_peptide KM875418_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt10N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KM875420_HBx_P-B Product feature CHAIN KM875420_HBx_P-B of FT:mat_peptide KM875420_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt11N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KM875426_HBx_P-B Product feature CHAIN KM875426_HBx_P-B of FT:mat_peptide KM875426_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt14N). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFFTSA
>gnl|hbvpro|KM875427_HBx_P-B Product feature CHAIN KM875427_HBx_P-B of FT:mat_peptide KM875427_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pt14T). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPWNFFFTSA
>gnl|hbvpro|KP036970_HBx_P-B Product feature CHAIN KP036970_HBx_P-B of FT:mat_peptide KP036970_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-YA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148314_HBx_P-B Product feature CHAIN KP148314_HBx_P-B of FT:mat_peptide KP148314_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGLCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148317_HBx_P-B Product feature CHAIN KP148317_HBx_P-B of FT:mat_peptide KP148317_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSATSTTDLEAYFKDCLLNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148318_HBx_P-B Product feature CHAIN KP148318_HBx_P-B of FT:mat_peptide KP148318_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148319_HBx_P-B Product feature CHAIN KP148319_HBx_P-B of FT:mat_peptide KP148319_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148320_HBx_P-B Product feature CHAIN KP148320_HBx_P-B of FT:mat_peptide KP148320_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148321_HBx_P-B Product feature CHAIN KP148321_HBx_P-B of FT:mat_peptide KP148321_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148322_HBx_P-B Product feature CHAIN KP148322_HBx_P-B of FT:mat_peptide KP148322_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148323_HBx_P-B Product feature CHAIN KP148323_HBx_P-B of FT:mat_peptide KP148323_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148324_HBx_P-B Product feature CHAIN KP148324_HBx_P-B of FT:mat_peptide KP148324_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLGPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148325_HBx_P-B Product feature CHAIN KP148325_HBx_P-B of FT:mat_peptide KP148325_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148326_HBx_P-B Product feature CHAIN KP148326_HBx_P-B of FT:mat_peptide KP148326_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148327_HBx_P-B Product feature CHAIN KP148327_HBx_P-B of FT:mat_peptide KP148327_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148328_HBx_P-B Product feature CHAIN KP148328_HBx_P-B of FT:mat_peptide KP148328_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148329_HBx_P-B Product feature CHAIN KP148329_HBx_P-B of FT:mat_peptide KP148329_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-99). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALSPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARPME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148330_HBx_P-B Product feature CHAIN KP148330_HBx_P-B of FT:mat_peptide KP148330_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGSCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148331_HBx_P-B Product feature CHAIN KP148331_HBx_P-B of FT:mat_peptide KP148331_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148332_HBx_P-B Product feature CHAIN KP148332_HBx_P-B of FT:mat_peptide KP148332_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148333_HBx_P-B Product feature CHAIN KP148333_HBx_P-B of FT:mat_peptide KP148333_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148334_HBx_P-B Product feature CHAIN KP148334_HBx_P-B of FT:mat_peptide KP148334_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148335_HBx_P-B Product feature CHAIN KP148335_HBx_P-B of FT:mat_peptide KP148335_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D243-3-130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLQVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148336_HBx_P-B Product feature CHAIN KP148336_HBx_P-B of FT:mat_peptide KP148336_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148338_HBx_P-B Product feature CHAIN KP148338_HBx_P-B of FT:mat_peptide KP148338_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKAFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148339_HBx_P-B Product feature CHAIN KP148339_HBx_P-B of FT:mat_peptide KP148339_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148340_HBx_P-B Product feature CHAIN KP148340_HBx_P-B of FT:mat_peptide KP148340_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148341_HBx_P-B Product feature CHAIN KP148341_HBx_P-B of FT:mat_peptide KP148341_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148342_HBx_P-B Product feature CHAIN KP148342_HBx_P-B of FT:mat_peptide KP148342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148343_HBx_P-B Product feature CHAIN KP148343_HBx_P-B of FT:mat_peptide KP148343_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148344_HBx_P-B Product feature CHAIN KP148344_HBx_P-B of FT:mat_peptide KP148344_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148345_HBx_P-B Product feature CHAIN KP148345_HBx_P-B of FT:mat_peptide KP148345_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148346_HBx_P-B Product feature CHAIN KP148346_HBx_P-B of FT:mat_peptide KP148346_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148347_HBx_P-B Product feature CHAIN KP148347_HBx_P-B of FT:mat_peptide KP148347_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148348_HBx_P-B Product feature CHAIN KP148348_HBx_P-B of FT:mat_peptide KP148348_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148349_HBx_P-B Product feature CHAIN KP148349_HBx_P-B of FT:mat_peptide KP148349_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D282-26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148356_HBx_P-B Product feature CHAIN KP148356_HBx_P-B of FT:mat_peptide KP148356_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCMFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148357_HBx_P-B Product feature CHAIN KP148357_HBx_P-B of FT:mat_peptide KP148357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148359_HBx_P-B Product feature CHAIN KP148359_HBx_P-B of FT:mat_peptide KP148359_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148360_HBx_P-B Product feature CHAIN KP148360_HBx_P-B of FT:mat_peptide KP148360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCMFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148361_HBx_P-B Product feature CHAIN KP148361_HBx_P-B of FT:mat_peptide KP148361_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVGLKVFVLGGCGHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148362_HBx_P-B Product feature CHAIN KP148362_HBx_P-B of FT:mat_peptide KP148362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-73). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148363_HBx_P-B Product feature CHAIN KP148363_HBx_P-B of FT:mat_peptide KP148363_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGARLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148364_HBx_P-B Product feature CHAIN KP148364_HBx_P-B of FT:mat_peptide KP148364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148365_HBx_P-B Product feature CHAIN KP148365_HBx_P-B of FT:mat_peptide KP148365_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148366_HBx_P-B Product feature CHAIN KP148366_HBx_P-B of FT:mat_peptide KP148366_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D93-3-110). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEVRLKVFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KP148367_HBx_P-B Product feature CHAIN KP148367_HBx_P-B of FT:mat_peptide KP148367_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAGSRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148368_HBx_P-B Product feature CHAIN KP148368_HBx_P-B of FT:mat_peptide KP148368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148369_HBx_P-B Product feature CHAIN KP148369_HBx_P-B of FT:mat_peptide KP148369_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148370_HBx_P-B Product feature CHAIN KP148370_HBx_P-B of FT:mat_peptide KP148370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148371_HBx_P-B Product feature CHAIN KP148371_HBx_P-B of FT:mat_peptide KP148371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFSEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148372_HBx_P-B Product feature CHAIN KP148372_HBx_P-B of FT:mat_peptide KP148372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-9). Complete genome. [Hepadnaviridae] (length=154 residues).
LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148373_HBx_P-B Product feature CHAIN KP148373_HBx_P-B of FT:mat_peptide KP148373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148374_HBx_P-B Product feature CHAIN KP148374_HBx_P-B of FT:mat_peptide KP148374_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGARLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148375_HBx_P-B Product feature CHAIN KP148375_HBx_P-B of FT:mat_peptide KP148375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148376_HBx_P-B Product feature CHAIN KP148376_HBx_P-B of FT:mat_peptide KP148376_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148377_HBx_P-B Product feature CHAIN KP148377_HBx_P-B of FT:mat_peptide KP148377_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148378_HBx_P-B Product feature CHAIN KP148378_HBx_P-B of FT:mat_peptide KP148378_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148379_HBx_P-B Product feature CHAIN KP148379_HBx_P-B of FT:mat_peptide KP148379_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148380_HBx_P-B Product feature CHAIN KP148380_HBx_P-B of FT:mat_peptide KP148380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148382_HBx_P-B Product feature CHAIN KP148382_HBx_P-B of FT:mat_peptide KP148382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148383_HBx_P-B Product feature CHAIN KP148383_HBx_P-B of FT:mat_peptide KP148383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLACSPAPCNFFTSA
>gnl|hbvpro|KP148384_HBx_P-B Product feature CHAIN KP148384_HBx_P-B of FT:mat_peptide KP148384_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148385_HBx_P-B Product feature CHAIN KP148385_HBx_P-B of FT:mat_peptide KP148385_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148386_HBx_P-B Product feature CHAIN KP148386_HBx_P-B of FT:mat_peptide KP148386_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148387_HBx_P-B Product feature CHAIN KP148387_HBx_P-B of FT:mat_peptide KP148387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148388_HBx_P-B Product feature CHAIN KP148388_HBx_P-B of FT:mat_peptide KP148388_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148389_HBx_P-B Product feature CHAIN KP148389_HBx_P-B of FT:mat_peptide KP148389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148390_HBx_P-B Product feature CHAIN KP148390_HBx_P-B of FT:mat_peptide KP148390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148391_HBx_P-B Product feature CHAIN KP148391_HBx_P-B of FT:mat_peptide KP148391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148392_HBx_P-B Product feature CHAIN KP148392_HBx_P-B of FT:mat_peptide KP148392_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148394_HBx_P-B Product feature CHAIN KP148394_HBx_P-B of FT:mat_peptide KP148394_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARYVLCLRPVGAESRGQPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148395_HBx_P-B Product feature CHAIN KP148395_HBx_P-B of FT:mat_peptide KP148395_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148396_HBx_P-B Product feature CHAIN KP148396_HBx_P-B of FT:mat_peptide KP148396_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-58). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148397_HBx_P-B Product feature CHAIN KP148397_HBx_P-B of FT:mat_peptide KP148397_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148398_HBx_P-B Product feature CHAIN KP148398_HBx_P-B of FT:mat_peptide KP148398_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148399_HBx_P-B Product feature CHAIN KP148399_HBx_P-B of FT:mat_peptide KP148399_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-61). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148400_HBx_P-B Product feature CHAIN KP148400_HBx_P-B of FT:mat_peptide KP148400_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-65). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148401_HBx_P-B Product feature CHAIN KP148401_HBx_P-B of FT:mat_peptide KP148401_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148402_HBx_P-B Product feature CHAIN KP148402_HBx_P-B of FT:mat_peptide KP148402_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-70). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148403_HBx_P-B Product feature CHAIN KP148403_HBx_P-B of FT:mat_peptide KP148403_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H11-3-71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148405_HBx_P-B Product feature CHAIN KP148405_HBx_P-B of FT:mat_peptide KP148405_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148406_HBx_P-B Product feature CHAIN KP148406_HBx_P-B of FT:mat_peptide KP148406_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148407_HBx_P-B Product feature CHAIN KP148407_HBx_P-B of FT:mat_peptide KP148407_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148409_HBx_P-B Product feature CHAIN KP148409_HBx_P-B of FT:mat_peptide KP148409_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148410_HBx_P-B Product feature CHAIN KP148410_HBx_P-B of FT:mat_peptide KP148410_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148411_HBx_P-B Product feature CHAIN KP148411_HBx_P-B of FT:mat_peptide KP148411_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTST
>gnl|hbvpro|KP148413_HBx_P-B Product feature CHAIN KP148413_HBx_P-B of FT:mat_peptide KP148413_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148414_HBx_P-B Product feature CHAIN KP148414_HBx_P-B of FT:mat_peptide KP148414_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDRGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148415_HBx_P-B Product feature CHAIN KP148415_HBx_P-B of FT:mat_peptide KP148415_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148416_HBx_P-B Product feature CHAIN KP148416_HBx_P-B of FT:mat_peptide KP148416_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148418_HBx_P-B Product feature CHAIN KP148418_HBx_P-B of FT:mat_peptide KP148418_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-58). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPPPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148419_HBx_P-B Product feature CHAIN KP148419_HBx_P-B of FT:mat_peptide KP148419_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148420_HBx_P-B Product feature CHAIN KP148420_HBx_P-B of FT:mat_peptide KP148420_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-66). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRVKVFVLGGCRHKLVWPPAPCNFFTSA
>gnl|hbvpro|KP148421_HBx_P-B Product feature CHAIN KP148421_HBx_P-B of FT:mat_peptide KP148421_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-72). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148423_HBx_P-B Product feature CHAIN KP148423_HBx_P-B of FT:mat_peptide KP148423_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148424_HBx_P-B Product feature CHAIN KP148424_HBx_P-B of FT:mat_peptide KP148424_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148425_HBx_P-B Product feature CHAIN KP148425_HBx_P-B of FT:mat_peptide KP148425_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148426_HBx_P-B Product feature CHAIN KP148426_HBx_P-B of FT:mat_peptide KP148426_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-92). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPEVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148427_HBx_P-B Product feature CHAIN KP148427_HBx_P-B of FT:mat_peptide KP148427_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148429_HBx_P-B Product feature CHAIN KP148429_HBx_P-B of FT:mat_peptide KP148429_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148430_HBx_P-B Product feature CHAIN KP148430_HBx_P-B of FT:mat_peptide KP148430_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H54-2-105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLSVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTFGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148433_HBx_P-B Product feature CHAIN KP148433_HBx_P-B of FT:mat_peptide KP148433_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148435_HBx_P-B Product feature CHAIN KP148435_HBx_P-B of FT:mat_peptide KP148435_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148437_HBx_P-B Product feature CHAIN KP148437_HBx_P-B of FT:mat_peptide KP148437_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148438_HBx_P-B Product feature CHAIN KP148438_HBx_P-B of FT:mat_peptide KP148438_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148439_HBx_P-B Product feature CHAIN KP148439_HBx_P-B of FT:mat_peptide KP148439_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFISARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148440_HBx_P-B Product feature CHAIN KP148440_HBx_P-B of FT:mat_peptide KP148440_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H75-26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEACFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148451_HBx_P-B Product feature CHAIN KP148451_HBx_P-B of FT:mat_peptide KP148451_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y147-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148452_HBx_P-B Product feature CHAIN KP148452_HBx_P-B of FT:mat_peptide KP148452_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSTRRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148453_HBx_P-B Product feature CHAIN KP148453_HBx_P-B of FT:mat_peptide KP148453_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148455_HBx_P-B Product feature CHAIN KP148455_HBx_P-B of FT:mat_peptide KP148455_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148456_HBx_P-B Product feature CHAIN KP148456_HBx_P-B of FT:mat_peptide KP148456_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148457_HBx_P-B Product feature CHAIN KP148457_HBx_P-B of FT:mat_peptide KP148457_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y167-3-24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148458_HBx_P-B Product feature CHAIN KP148458_HBx_P-B of FT:mat_peptide KP148458_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148459_HBx_P-B Product feature CHAIN KP148459_HBx_P-B of FT:mat_peptide KP148459_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPATCNFFTSA
>gnl|hbvpro|KP148460_HBx_P-B Product feature CHAIN KP148460_HBx_P-B of FT:mat_peptide KP148460_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148461_HBx_P-B Product feature CHAIN KP148461_HBx_P-B of FT:mat_peptide KP148461_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y165-3-46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGFSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148579_HBx_P-B Product feature CHAIN KP148579_HBx_P-B of FT:mat_peptide KP148579_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPKVLHKRTLGLSAMSTTDLEAYFKNCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148580_HBx_P-B Product feature CHAIN KP148580_HBx_P-B of FT:mat_peptide KP148580_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148581_HBx_P-B Product feature CHAIN KP148581_HBx_P-B of FT:mat_peptide KP148581_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148582_HBx_P-B Product feature CHAIN KP148582_HBx_P-B of FT:mat_peptide KP148582_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148583_HBx_P-B Product feature CHAIN KP148583_HBx_P-B of FT:mat_peptide KP148583_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Y300-24). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCWHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP406170_HBx_P-B Product feature CHAIN KP406170_HBx_P-B of FT:mat_peptide KP406170_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2_2_4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRQNSIRPIVSRITLTSA
>gnl|hbvpro|KP659219_HBx_P-B Product feature CHAIN KP659219_HBx_P-B of FT:mat_peptide KP659219_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659220_HBx_P-B Product feature CHAIN KP659220_HBx_P-B of FT:mat_peptide KP659220_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMLFVLGGCRHKLVCSPAPXNFFTSA
>gnl|hbvpro|KP659221_HBx_P-B Product feature CHAIN KP659221_HBx_P-B of FT:mat_peptide KP659221_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-8). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659223_HBx_P-B Product feature CHAIN KP659223_HBx_P-B of FT:mat_peptide KP659223_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659224_HBx_P-B Product feature CHAIN KP659224_HBx_P-B of FT:mat_peptide KP659224_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska-13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659234_HBx_P-B Product feature CHAIN KP659234_HBx_P-B of FT:mat_peptide KP659234_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1500). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIKLKVFVLGGWKHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659235_HBx_P-B Product feature CHAIN KP659235_HBx_P-B of FT:mat_peptide KP659235_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-1602). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659237_HBx_P-B Product feature CHAIN KP659237_HBx_P-B of FT:mat_peptide KP659237_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-2456). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659245_HBx_P-B Product feature CHAIN KP659245_HBx_P-B of FT:mat_peptide KP659245_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-571_2012). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEESGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659246_HBx_P-B Product feature CHAIN KP659246_HBx_P-B of FT:mat_peptide KP659246_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-1B-2611). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP659247_HBx_P-B Product feature CHAIN KP659247_HBx_P-B of FT:mat_peptide KP659247_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-0B-1290). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659248_HBx_P-B Product feature CHAIN KP659248_HBx_P-B of FT:mat_peptide KP659248_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU268). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|KP659249_HBx_P-B Product feature CHAIN KP659249_HBx_P-B of FT:mat_peptide KP659249_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU389). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALPPXSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLXKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEDMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659250_HBx_P-B Product feature CHAIN KP659250_HBx_P-B of FT:mat_peptide KP659250_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU2128). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDFLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLXKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659251_HBx_P-B Product feature CHAIN KP659251_HBx_P-B of FT:mat_peptide KP659251_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659252_HBx_P-B Product feature CHAIN KP659252_HBx_P-B of FT:mat_peptide KP659252_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU795). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659253_HBx_P-B Product feature CHAIN KP659253_HBx_P-B of FT:mat_peptide KP659253_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU817). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFXSARRME
TTVNXHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659254_HBx_P-B Product feature CHAIN KP659254_HBx_P-B of FT:mat_peptide KP659254_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU1163). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP659255_HBx_P-B Product feature CHAIN KP659255_HBx_P-B of FT:mat_peptide KP659255_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Canada-NU2144). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVXTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPYNFFTSA
>gnl|hbvpro|KR152339_HBx_P-B Product feature CHAIN KR152339_HBx_P-B of FT:mat_peptide KR152339_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KR232337_HBx_P-B Product feature CHAIN KR232337_HBx_P-B of FT:mat_peptide KR232337_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPTASPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KR812011_HBx_P-B Product feature CHAIN KR812011_HBx_P-B of FT:mat_peptide KR812011_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 87NT.4.). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=152 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPPPCNFLK
>gnl|hbvpro|KT749820_HBx_P-B Product feature CHAIN KT749820_HBx_P-B of FT:mat_peptide KT749820_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FL22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEEMGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT749853_HBx_P-B Product feature CHAIN KT749853_HBx_P-B of FT:mat_peptide KT749853_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FL17c). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU234318_HBx_P-B Product feature CHAIN KU234318_HBx_P-B of FT:mat_peptide KU234318_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDRVFTEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679959_HBx_P-B Product feature CHAIN KU679959_HBx_P-B of FT:mat_peptide KU679959_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 126_EA_Gap). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963799_HBx_P-B Product feature CHAIN KU963799_HBx_P-B of FT:mat_peptide KU963799_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963800_HBx_P-B Product feature CHAIN KU963800_HBx_P-B of FT:mat_peptide KU963800_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963801_HBx_P-B Product feature CHAIN KU963801_HBx_P-B of FT:mat_peptide KU963801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963802_HBx_P-B Product feature CHAIN KU963802_HBx_P-B of FT:mat_peptide KU963802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963803_HBx_P-B Product feature CHAIN KU963803_HBx_P-B of FT:mat_peptide KU963803_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963804_HBx_P-B Product feature CHAIN KU963804_HBx_P-B of FT:mat_peptide KU963804_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963805_HBx_P-B Product feature CHAIN KU963805_HBx_P-B of FT:mat_peptide KU963805_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963806_HBx_P-B Product feature CHAIN KU963806_HBx_P-B of FT:mat_peptide KU963806_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963807_HBx_P-B Product feature CHAIN KU963807_HBx_P-B of FT:mat_peptide KU963807_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963808_HBx_P-B Product feature CHAIN KU963808_HBx_P-B of FT:mat_peptide KU963808_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963809_HBx_P-B Product feature CHAIN KU963809_HBx_P-B of FT:mat_peptide KU963809_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963810_HBx_P-B Product feature CHAIN KU963810_HBx_P-B of FT:mat_peptide KU963810_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963811_HBx_P-B Product feature CHAIN KU963811_HBx_P-B of FT:mat_peptide KU963811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963812_HBx_P-B Product feature CHAIN KU963812_HBx_P-B of FT:mat_peptide KU963812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963813_HBx_P-B Product feature CHAIN KU963813_HBx_P-B of FT:mat_peptide KU963813_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963814_HBx_P-B Product feature CHAIN KU963814_HBx_P-B of FT:mat_peptide KU963814_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963815_HBx_P-B Product feature CHAIN KU963815_HBx_P-B of FT:mat_peptide KU963815_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963816_HBx_P-B Product feature CHAIN KU963816_HBx_P-B of FT:mat_peptide KU963816_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963817_HBx_P-B Product feature CHAIN KU963817_HBx_P-B of FT:mat_peptide KU963817_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963818_HBx_P-B Product feature CHAIN KU963818_HBx_P-B of FT:mat_peptide KU963818_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963819_HBx_P-B Product feature CHAIN KU963819_HBx_P-B of FT:mat_peptide KU963819_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963820_HBx_P-B Product feature CHAIN KU963820_HBx_P-B of FT:mat_peptide KU963820_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963821_HBx_P-B Product feature CHAIN KU963821_HBx_P-B of FT:mat_peptide KU963821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963822_HBx_P-B Product feature CHAIN KU963822_HBx_P-B of FT:mat_peptide KU963822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963823_HBx_P-B Product feature CHAIN KU963823_HBx_P-B of FT:mat_peptide KU963823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963824_HBx_P-B Product feature CHAIN KU963824_HBx_P-B of FT:mat_peptide KU963824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFSSA
>gnl|hbvpro|KU963825_HBx_P-B Product feature CHAIN KU963825_HBx_P-B of FT:mat_peptide KU963825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963826_HBx_P-B Product feature CHAIN KU963826_HBx_P-B of FT:mat_peptide KU963826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963827_HBx_P-B Product feature CHAIN KU963827_HBx_P-B of FT:mat_peptide KU963827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963828_HBx_P-B Product feature CHAIN KU963828_HBx_P-B of FT:mat_peptide KU963828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963829_HBx_P-B Product feature CHAIN KU963829_HBx_P-B of FT:mat_peptide KU963829_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963830_HBx_P-B Product feature CHAIN KU963830_HBx_P-B of FT:mat_peptide KU963830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963831_HBx_P-B Product feature CHAIN KU963831_HBx_P-B of FT:mat_peptide KU963831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963832_HBx_P-B Product feature CHAIN KU963832_HBx_P-B of FT:mat_peptide KU963832_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963833_HBx_P-B Product feature CHAIN KU963833_HBx_P-B of FT:mat_peptide KU963833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963834_HBx_P-B Product feature CHAIN KU963834_HBx_P-B of FT:mat_peptide KU963834_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963835_HBx_P-B Product feature CHAIN KU963835_HBx_P-B of FT:mat_peptide KU963835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963836_HBx_P-B Product feature CHAIN KU963836_HBx_P-B of FT:mat_peptide KU963836_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963837_HBx_P-B Product feature CHAIN KU963837_HBx_P-B of FT:mat_peptide KU963837_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963838_HBx_P-B Product feature CHAIN KU963838_HBx_P-B of FT:mat_peptide KU963838_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963839_HBx_P-B Product feature CHAIN KU963839_HBx_P-B of FT:mat_peptide KU963839_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963840_HBx_P-B Product feature CHAIN KU963840_HBx_P-B of FT:mat_peptide KU963840_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963841_HBx_P-B Product feature CHAIN KU963841_HBx_P-B of FT:mat_peptide KU963841_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963842_HBx_P-B Product feature CHAIN KU963842_HBx_P-B of FT:mat_peptide KU963842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963843_HBx_P-B Product feature CHAIN KU963843_HBx_P-B of FT:mat_peptide KU963843_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963844_HBx_P-B Product feature CHAIN KU963844_HBx_P-B of FT:mat_peptide KU963844_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963845_HBx_P-B Product feature CHAIN KU963845_HBx_P-B of FT:mat_peptide KU963845_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963846_HBx_P-B Product feature CHAIN KU963846_HBx_P-B of FT:mat_peptide KU963846_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963847_HBx_P-B Product feature CHAIN KU963847_HBx_P-B of FT:mat_peptide KU963847_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963848_HBx_P-B Product feature CHAIN KU963848_HBx_P-B of FT:mat_peptide KU963848_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963849_HBx_P-B Product feature CHAIN KU963849_HBx_P-B of FT:mat_peptide KU963849_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963850_HBx_P-B Product feature CHAIN KU963850_HBx_P-B of FT:mat_peptide KU963850_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963851_HBx_P-B Product feature CHAIN KU963851_HBx_P-B of FT:mat_peptide KU963851_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963852_HBx_P-B Product feature CHAIN KU963852_HBx_P-B of FT:mat_peptide KU963852_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963853_HBx_P-B Product feature CHAIN KU963853_HBx_P-B of FT:mat_peptide KU963853_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963854_HBx_P-B Product feature CHAIN KU963854_HBx_P-B of FT:mat_peptide KU963854_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963855_HBx_P-B Product feature CHAIN KU963855_HBx_P-B of FT:mat_peptide KU963855_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEVVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963945_HBx_P-B Product feature CHAIN KU963945_HBx_P-B of FT:mat_peptide KU963945_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963946_HBx_P-B Product feature CHAIN KU963946_HBx_P-B of FT:mat_peptide KU963946_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963947_HBx_P-B Product feature CHAIN KU963947_HBx_P-B of FT:mat_peptide KU963947_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963948_HBx_P-B Product feature CHAIN KU963948_HBx_P-B of FT:mat_peptide KU963948_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963949_HBx_P-B Product feature CHAIN KU963949_HBx_P-B of FT:mat_peptide KU963949_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963950_HBx_P-B Product feature CHAIN KU963950_HBx_P-B of FT:mat_peptide KU963950_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963951_HBx_P-B Product feature CHAIN KU963951_HBx_P-B of FT:mat_peptide KU963951_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963952_HBx_P-B Product feature CHAIN KU963952_HBx_P-B of FT:mat_peptide KU963952_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPEPCNFFTSA
>gnl|hbvpro|KU963953_HBx_P-B Product feature CHAIN KU963953_HBx_P-B of FT:mat_peptide KU963953_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963954_HBx_P-B Product feature CHAIN KU963954_HBx_P-B of FT:mat_peptide KU963954_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963955_HBx_P-B Product feature CHAIN KU963955_HBx_P-B of FT:mat_peptide KU963955_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963956_HBx_P-B Product feature CHAIN KU963956_HBx_P-B of FT:mat_peptide KU963956_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963957_HBx_P-B Product feature CHAIN KU963957_HBx_P-B of FT:mat_peptide KU963957_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963958_HBx_P-B Product feature CHAIN KU963958_HBx_P-B of FT:mat_peptide KU963958_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963959_HBx_P-B Product feature CHAIN KU963959_HBx_P-B of FT:mat_peptide KU963959_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963960_HBx_P-B Product feature CHAIN KU963960_HBx_P-B of FT:mat_peptide KU963960_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963961_HBx_P-B Product feature CHAIN KU963961_HBx_P-B of FT:mat_peptide KU963961_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963962_HBx_P-B Product feature CHAIN KU963962_HBx_P-B of FT:mat_peptide KU963962_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963963_HBx_P-B Product feature CHAIN KU963963_HBx_P-B of FT:mat_peptide KU963963_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963964_HBx_P-B Product feature CHAIN KU963964_HBx_P-B of FT:mat_peptide KU963964_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963965_HBx_P-B Product feature CHAIN KU963965_HBx_P-B of FT:mat_peptide KU963965_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963966_HBx_P-B Product feature CHAIN KU963966_HBx_P-B of FT:mat_peptide KU963966_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963967_HBx_P-B Product feature CHAIN KU963967_HBx_P-B of FT:mat_peptide KU963967_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCTLRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963968_HBx_P-B Product feature CHAIN KU963968_HBx_P-B of FT:mat_peptide KU963968_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963969_HBx_P-B Product feature CHAIN KU963969_HBx_P-B of FT:mat_peptide KU963969_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963970_HBx_P-B Product feature CHAIN KU963970_HBx_P-B of FT:mat_peptide KU963970_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963971_HBx_P-B Product feature CHAIN KU963971_HBx_P-B of FT:mat_peptide KU963971_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963972_HBx_P-B Product feature CHAIN KU963972_HBx_P-B of FT:mat_peptide KU963972_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963973_HBx_P-B Product feature CHAIN KU963973_HBx_P-B of FT:mat_peptide KU963973_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963974_HBx_P-B Product feature CHAIN KU963974_HBx_P-B of FT:mat_peptide KU963974_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963975_HBx_P-B Product feature CHAIN KU963975_HBx_P-B of FT:mat_peptide KU963975_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12_16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963976_HBx_P-B Product feature CHAIN KU963976_HBx_P-B of FT:mat_peptide KU963976_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963977_HBx_P-B Product feature CHAIN KU963977_HBx_P-B of FT:mat_peptide KU963977_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963978_HBx_P-B Product feature CHAIN KU963978_HBx_P-B of FT:mat_peptide KU963978_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963979_HBx_P-B Product feature CHAIN KU963979_HBx_P-B of FT:mat_peptide KU963979_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963980_HBx_P-B Product feature CHAIN KU963980_HBx_P-B of FT:mat_peptide KU963980_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963981_HBx_P-B Product feature CHAIN KU963981_HBx_P-B of FT:mat_peptide KU963981_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963982_HBx_P-B Product feature CHAIN KU963982_HBx_P-B of FT:mat_peptide KU963982_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963983_HBx_P-B Product feature CHAIN KU963983_HBx_P-B of FT:mat_peptide KU963983_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963984_HBx_P-B Product feature CHAIN KU963984_HBx_P-B of FT:mat_peptide KU963984_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963985_HBx_P-B Product feature CHAIN KU963985_HBx_P-B of FT:mat_peptide KU963985_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963986_HBx_P-B Product feature CHAIN KU963986_HBx_P-B of FT:mat_peptide KU963986_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963987_HBx_P-B Product feature CHAIN KU963987_HBx_P-B of FT:mat_peptide KU963987_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963988_HBx_P-B Product feature CHAIN KU963988_HBx_P-B of FT:mat_peptide KU963988_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU963989_HBx_P-B Product feature CHAIN KU963989_HBx_P-B of FT:mat_peptide KU963989_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 13_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964079_HBx_P-B Product feature CHAIN KU964079_HBx_P-B of FT:mat_peptide KU964079_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964080_HBx_P-B Product feature CHAIN KU964080_HBx_P-B of FT:mat_peptide KU964080_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964081_HBx_P-B Product feature CHAIN KU964081_HBx_P-B of FT:mat_peptide KU964081_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964082_HBx_P-B Product feature CHAIN KU964082_HBx_P-B of FT:mat_peptide KU964082_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964083_HBx_P-B Product feature CHAIN KU964083_HBx_P-B of FT:mat_peptide KU964083_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964084_HBx_P-B Product feature CHAIN KU964084_HBx_P-B of FT:mat_peptide KU964084_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964085_HBx_P-B Product feature CHAIN KU964085_HBx_P-B of FT:mat_peptide KU964085_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964086_HBx_P-B Product feature CHAIN KU964086_HBx_P-B of FT:mat_peptide KU964086_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964087_HBx_P-B Product feature CHAIN KU964087_HBx_P-B of FT:mat_peptide KU964087_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964088_HBx_P-B Product feature CHAIN KU964088_HBx_P-B of FT:mat_peptide KU964088_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964089_HBx_P-B Product feature CHAIN KU964089_HBx_P-B of FT:mat_peptide KU964089_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964090_HBx_P-B Product feature CHAIN KU964090_HBx_P-B of FT:mat_peptide KU964090_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964091_HBx_P-B Product feature CHAIN KU964091_HBx_P-B of FT:mat_peptide KU964091_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964092_HBx_P-B Product feature CHAIN KU964092_HBx_P-B of FT:mat_peptide KU964092_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 20_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964093_HBx_P-B Product feature CHAIN KU964093_HBx_P-B of FT:mat_peptide KU964093_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964094_HBx_P-B Product feature CHAIN KU964094_HBx_P-B of FT:mat_peptide KU964094_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964095_HBx_P-B Product feature CHAIN KU964095_HBx_P-B of FT:mat_peptide KU964095_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964096_HBx_P-B Product feature CHAIN KU964096_HBx_P-B of FT:mat_peptide KU964096_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964097_HBx_P-B Product feature CHAIN KU964097_HBx_P-B of FT:mat_peptide KU964097_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964098_HBx_P-B Product feature CHAIN KU964098_HBx_P-B of FT:mat_peptide KU964098_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964099_HBx_P-B Product feature CHAIN KU964099_HBx_P-B of FT:mat_peptide KU964099_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964100_HBx_P-B Product feature CHAIN KU964100_HBx_P-B of FT:mat_peptide KU964100_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964101_HBx_P-B Product feature CHAIN KU964101_HBx_P-B of FT:mat_peptide KU964101_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964102_HBx_P-B Product feature CHAIN KU964102_HBx_P-B of FT:mat_peptide KU964102_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964103_HBx_P-B Product feature CHAIN KU964103_HBx_P-B of FT:mat_peptide KU964103_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964104_HBx_P-B Product feature CHAIN KU964104_HBx_P-B of FT:mat_peptide KU964104_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964105_HBx_P-B Product feature CHAIN KU964105_HBx_P-B of FT:mat_peptide KU964105_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964106_HBx_P-B Product feature CHAIN KU964106_HBx_P-B of FT:mat_peptide KU964106_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964107_HBx_P-B Product feature CHAIN KU964107_HBx_P-B of FT:mat_peptide KU964107_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964108_HBx_P-B Product feature CHAIN KU964108_HBx_P-B of FT:mat_peptide KU964108_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964109_HBx_P-B Product feature CHAIN KU964109_HBx_P-B of FT:mat_peptide KU964109_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964110_HBx_P-B Product feature CHAIN KU964110_HBx_P-B of FT:mat_peptide KU964110_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964111_HBx_P-B Product feature CHAIN KU964111_HBx_P-B of FT:mat_peptide KU964111_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964112_HBx_P-B Product feature CHAIN KU964112_HBx_P-B of FT:mat_peptide KU964112_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964113_HBx_P-B Product feature CHAIN KU964113_HBx_P-B of FT:mat_peptide KU964113_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964114_HBx_P-B Product feature CHAIN KU964114_HBx_P-B of FT:mat_peptide KU964114_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPEPCNFFTSA
>gnl|hbvpro|KU964115_HBx_P-B Product feature CHAIN KU964115_HBx_P-B of FT:mat_peptide KU964115_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGVEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964116_HBx_P-B Product feature CHAIN KU964116_HBx_P-B of FT:mat_peptide KU964116_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964117_HBx_P-B Product feature CHAIN KU964117_HBx_P-B of FT:mat_peptide KU964117_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_10). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGVEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964118_HBx_P-B Product feature CHAIN KU964118_HBx_P-B of FT:mat_peptide KU964118_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964119_HBx_P-B Product feature CHAIN KU964119_HBx_P-B of FT:mat_peptide KU964119_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964120_HBx_P-B Product feature CHAIN KU964120_HBx_P-B of FT:mat_peptide KU964120_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964121_HBx_P-B Product feature CHAIN KU964121_HBx_P-B of FT:mat_peptide KU964121_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964122_HBx_P-B Product feature CHAIN KU964122_HBx_P-B of FT:mat_peptide KU964122_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 22_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964123_HBx_P-B Product feature CHAIN KU964123_HBx_P-B of FT:mat_peptide KU964123_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964124_HBx_P-B Product feature CHAIN KU964124_HBx_P-B of FT:mat_peptide KU964124_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964125_HBx_P-B Product feature CHAIN KU964125_HBx_P-B of FT:mat_peptide KU964125_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964126_HBx_P-B Product feature CHAIN KU964126_HBx_P-B of FT:mat_peptide KU964126_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964127_HBx_P-B Product feature CHAIN KU964127_HBx_P-B of FT:mat_peptide KU964127_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964128_HBx_P-B Product feature CHAIN KU964128_HBx_P-B of FT:mat_peptide KU964128_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964129_HBx_P-B Product feature CHAIN KU964129_HBx_P-B of FT:mat_peptide KU964129_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964130_HBx_P-B Product feature CHAIN KU964130_HBx_P-B of FT:mat_peptide KU964130_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964131_HBx_P-B Product feature CHAIN KU964131_HBx_P-B of FT:mat_peptide KU964131_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964132_HBx_P-B Product feature CHAIN KU964132_HBx_P-B of FT:mat_peptide KU964132_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964133_HBx_P-B Product feature CHAIN KU964133_HBx_P-B of FT:mat_peptide KU964133_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964134_HBx_P-B Product feature CHAIN KU964134_HBx_P-B of FT:mat_peptide KU964134_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964135_HBx_P-B Product feature CHAIN KU964135_HBx_P-B of FT:mat_peptide KU964135_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964136_HBx_P-B Product feature CHAIN KU964136_HBx_P-B of FT:mat_peptide KU964136_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964137_HBx_P-B Product feature CHAIN KU964137_HBx_P-B of FT:mat_peptide KU964137_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 23_15). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFLKSSR
>gnl|hbvpro|KU964138_HBx_P-B Product feature CHAIN KU964138_HBx_P-B of FT:mat_peptide KU964138_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964139_HBx_P-B Product feature CHAIN KU964139_HBx_P-B of FT:mat_peptide KU964139_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964140_HBx_P-B Product feature CHAIN KU964140_HBx_P-B of FT:mat_peptide KU964140_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964141_HBx_P-B Product feature CHAIN KU964141_HBx_P-B of FT:mat_peptide KU964141_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964142_HBx_P-B Product feature CHAIN KU964142_HBx_P-B of FT:mat_peptide KU964142_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964143_HBx_P-B Product feature CHAIN KU964143_HBx_P-B of FT:mat_peptide KU964143_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964144_HBx_P-B Product feature CHAIN KU964144_HBx_P-B of FT:mat_peptide KU964144_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964145_HBx_P-B Product feature CHAIN KU964145_HBx_P-B of FT:mat_peptide KU964145_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964146_HBx_P-B Product feature CHAIN KU964146_HBx_P-B of FT:mat_peptide KU964146_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964147_HBx_P-B Product feature CHAIN KU964147_HBx_P-B of FT:mat_peptide KU964147_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964148_HBx_P-B Product feature CHAIN KU964148_HBx_P-B of FT:mat_peptide KU964148_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964149_HBx_P-B Product feature CHAIN KU964149_HBx_P-B of FT:mat_peptide KU964149_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964150_HBx_P-B Product feature CHAIN KU964150_HBx_P-B of FT:mat_peptide KU964150_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964151_HBx_P-B Product feature CHAIN KU964151_HBx_P-B of FT:mat_peptide KU964151_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964152_HBx_P-B Product feature CHAIN KU964152_HBx_P-B of FT:mat_peptide KU964152_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964153_HBx_P-B Product feature CHAIN KU964153_HBx_P-B of FT:mat_peptide KU964153_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964154_HBx_P-B Product feature CHAIN KU964154_HBx_P-B of FT:mat_peptide KU964154_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964155_HBx_P-B Product feature CHAIN KU964155_HBx_P-B of FT:mat_peptide KU964155_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964156_HBx_P-B Product feature CHAIN KU964156_HBx_P-B of FT:mat_peptide KU964156_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964157_HBx_P-B Product feature CHAIN KU964157_HBx_P-B of FT:mat_peptide KU964157_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964158_HBx_P-B Product feature CHAIN KU964158_HBx_P-B of FT:mat_peptide KU964158_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964159_HBx_P-B Product feature CHAIN KU964159_HBx_P-B of FT:mat_peptide KU964159_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964160_HBx_P-B Product feature CHAIN KU964160_HBx_P-B of FT:mat_peptide KU964160_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964161_HBx_P-B Product feature CHAIN KU964161_HBx_P-B of FT:mat_peptide KU964161_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964162_HBx_P-B Product feature CHAIN KU964162_HBx_P-B of FT:mat_peptide KU964162_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964163_HBx_P-B Product feature CHAIN KU964163_HBx_P-B of FT:mat_peptide KU964163_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964164_HBx_P-B Product feature CHAIN KU964164_HBx_P-B of FT:mat_peptide KU964164_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964165_HBx_P-B Product feature CHAIN KU964165_HBx_P-B of FT:mat_peptide KU964165_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964166_HBx_P-B Product feature CHAIN KU964166_HBx_P-B of FT:mat_peptide KU964166_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964167_HBx_P-B Product feature CHAIN KU964167_HBx_P-B of FT:mat_peptide KU964167_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964168_HBx_P-B Product feature CHAIN KU964168_HBx_P-B of FT:mat_peptide KU964168_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25_16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KU964244_HBx_P-B Product feature CHAIN KU964244_HBx_P-B of FT:mat_peptide KU964244_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964245_HBx_P-B Product feature CHAIN KU964245_HBx_P-B of FT:mat_peptide KU964245_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964246_HBx_P-B Product feature CHAIN KU964246_HBx_P-B of FT:mat_peptide KU964246_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964247_HBx_P-B Product feature CHAIN KU964247_HBx_P-B of FT:mat_peptide KU964247_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964248_HBx_P-B Product feature CHAIN KU964248_HBx_P-B of FT:mat_peptide KU964248_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964249_HBx_P-B Product feature CHAIN KU964249_HBx_P-B of FT:mat_peptide KU964249_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964250_HBx_P-B Product feature CHAIN KU964250_HBx_P-B of FT:mat_peptide KU964250_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964251_HBx_P-B Product feature CHAIN KU964251_HBx_P-B of FT:mat_peptide KU964251_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964252_HBx_P-B Product feature CHAIN KU964252_HBx_P-B of FT:mat_peptide KU964252_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964253_HBx_P-B Product feature CHAIN KU964253_HBx_P-B of FT:mat_peptide KU964253_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964254_HBx_P-B Product feature CHAIN KU964254_HBx_P-B of FT:mat_peptide KU964254_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964255_HBx_P-B Product feature CHAIN KU964255_HBx_P-B of FT:mat_peptide KU964255_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964256_HBx_P-B Product feature CHAIN KU964256_HBx_P-B of FT:mat_peptide KU964256_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964257_HBx_P-B Product feature CHAIN KU964257_HBx_P-B of FT:mat_peptide KU964257_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964258_HBx_P-B Product feature CHAIN KU964258_HBx_P-B of FT:mat_peptide KU964258_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964259_HBx_P-B Product feature CHAIN KU964259_HBx_P-B of FT:mat_peptide KU964259_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964260_HBx_P-B Product feature CHAIN KU964260_HBx_P-B of FT:mat_peptide KU964260_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964261_HBx_P-B Product feature CHAIN KU964261_HBx_P-B of FT:mat_peptide KU964261_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964262_HBx_P-B Product feature CHAIN KU964262_HBx_P-B of FT:mat_peptide KU964262_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964263_HBx_P-B Product feature CHAIN KU964263_HBx_P-B of FT:mat_peptide KU964263_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964264_HBx_P-B Product feature CHAIN KU964264_HBx_P-B of FT:mat_peptide KU964264_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEGRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964265_HBx_P-B Product feature CHAIN KU964265_HBx_P-B of FT:mat_peptide KU964265_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964266_HBx_P-B Product feature CHAIN KU964266_HBx_P-B of FT:mat_peptide KU964266_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964267_HBx_P-B Product feature CHAIN KU964267_HBx_P-B of FT:mat_peptide KU964267_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964268_HBx_P-B Product feature CHAIN KU964268_HBx_P-B of FT:mat_peptide KU964268_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964269_HBx_P-B Product feature CHAIN KU964269_HBx_P-B of FT:mat_peptide KU964269_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964270_HBx_P-B Product feature CHAIN KU964270_HBx_P-B of FT:mat_peptide KU964270_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964271_HBx_P-B Product feature CHAIN KU964271_HBx_P-B of FT:mat_peptide KU964271_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964272_HBx_P-B Product feature CHAIN KU964272_HBx_P-B of FT:mat_peptide KU964272_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964273_HBx_P-B Product feature CHAIN KU964273_HBx_P-B of FT:mat_peptide KU964273_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964274_HBx_P-B Product feature CHAIN KU964274_HBx_P-B of FT:mat_peptide KU964274_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964275_HBx_P-B Product feature CHAIN KU964275_HBx_P-B of FT:mat_peptide KU964275_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964276_HBx_P-B Product feature CHAIN KU964276_HBx_P-B of FT:mat_peptide KU964276_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964277_HBx_P-B Product feature CHAIN KU964277_HBx_P-B of FT:mat_peptide KU964277_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964278_HBx_P-B Product feature CHAIN KU964278_HBx_P-B of FT:mat_peptide KU964278_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964279_HBx_P-B Product feature CHAIN KU964279_HBx_P-B of FT:mat_peptide KU964279_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964280_HBx_P-B Product feature CHAIN KU964280_HBx_P-B of FT:mat_peptide KU964280_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964281_HBx_P-B Product feature CHAIN KU964281_HBx_P-B of FT:mat_peptide KU964281_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964282_HBx_P-B Product feature CHAIN KU964282_HBx_P-B of FT:mat_peptide KU964282_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964283_HBx_P-B Product feature CHAIN KU964283_HBx_P-B of FT:mat_peptide KU964283_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|KU964284_HBx_P-B Product feature CHAIN KU964284_HBx_P-B of FT:mat_peptide KU964284_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964285_HBx_P-B Product feature CHAIN KU964285_HBx_P-B of FT:mat_peptide KU964285_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964286_HBx_P-B Product feature CHAIN KU964286_HBx_P-B of FT:mat_peptide KU964286_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 34_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPIPCNFFTSA
>gnl|hbvpro|KU964287_HBx_P-B Product feature CHAIN KU964287_HBx_P-B of FT:mat_peptide KU964287_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964288_HBx_P-B Product feature CHAIN KU964288_HBx_P-B of FT:mat_peptide KU964288_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964289_HBx_P-B Product feature CHAIN KU964289_HBx_P-B of FT:mat_peptide KU964289_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964290_HBx_P-B Product feature CHAIN KU964290_HBx_P-B of FT:mat_peptide KU964290_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964291_HBx_P-B Product feature CHAIN KU964291_HBx_P-B of FT:mat_peptide KU964291_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964292_HBx_P-B Product feature CHAIN KU964292_HBx_P-B of FT:mat_peptide KU964292_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964293_HBx_P-B Product feature CHAIN KU964293_HBx_P-B of FT:mat_peptide KU964293_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964294_HBx_P-B Product feature CHAIN KU964294_HBx_P-B of FT:mat_peptide KU964294_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964295_HBx_P-B Product feature CHAIN KU964295_HBx_P-B of FT:mat_peptide KU964295_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964296_HBx_P-B Product feature CHAIN KU964296_HBx_P-B of FT:mat_peptide KU964296_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964297_HBx_P-B Product feature CHAIN KU964297_HBx_P-B of FT:mat_peptide KU964297_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964298_HBx_P-B Product feature CHAIN KU964298_HBx_P-B of FT:mat_peptide KU964298_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964299_HBx_P-B Product feature CHAIN KU964299_HBx_P-B of FT:mat_peptide KU964299_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964300_HBx_P-B Product feature CHAIN KU964300_HBx_P-B of FT:mat_peptide KU964300_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964301_HBx_P-B Product feature CHAIN KU964301_HBx_P-B of FT:mat_peptide KU964301_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964302_HBx_P-B Product feature CHAIN KU964302_HBx_P-B of FT:mat_peptide KU964302_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 35_16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964381_HBx_P-B Product feature CHAIN KU964381_HBx_P-B of FT:mat_peptide KU964381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964382_HBx_P-B Product feature CHAIN KU964382_HBx_P-B of FT:mat_peptide KU964382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964383_HBx_P-B Product feature CHAIN KU964383_HBx_P-B of FT:mat_peptide KU964383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964384_HBx_P-B Product feature CHAIN KU964384_HBx_P-B of FT:mat_peptide KU964384_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964385_HBx_P-B Product feature CHAIN KU964385_HBx_P-B of FT:mat_peptide KU964385_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964386_HBx_P-B Product feature CHAIN KU964386_HBx_P-B of FT:mat_peptide KU964386_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_8). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964387_HBx_P-B Product feature CHAIN KU964387_HBx_P-B of FT:mat_peptide KU964387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_9). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964388_HBx_P-B Product feature CHAIN KU964388_HBx_P-B of FT:mat_peptide KU964388_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964389_HBx_P-B Product feature CHAIN KU964389_HBx_P-B of FT:mat_peptide KU964389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964390_HBx_P-B Product feature CHAIN KU964390_HBx_P-B of FT:mat_peptide KU964390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_12). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLCGLPVCAFSSAGPCSLRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964391_HBx_P-B Product feature CHAIN KU964391_HBx_P-B of FT:mat_peptide KU964391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964392_HBx_P-B Product feature CHAIN KU964392_HBx_P-B of FT:mat_peptide KU964392_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_14). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964393_HBx_P-B Product feature CHAIN KU964393_HBx_P-B of FT:mat_peptide KU964393_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964394_HBx_P-B Product feature CHAIN KU964394_HBx_P-B of FT:mat_peptide KU964394_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 32_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964395_HBx_P-B Product feature CHAIN KU964395_HBx_P-B of FT:mat_peptide KU964395_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964396_HBx_P-B Product feature CHAIN KU964396_HBx_P-B of FT:mat_peptide KU964396_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_16). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KU964397_HBx_P-B Product feature CHAIN KU964397_HBx_P-B of FT:mat_peptide KU964397_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 31_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KX276770_HBx_P-B Product feature CHAIN KX276770_HBx_P-B of FT:mat_peptide KX276770_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276771_HBx_P-B Product feature CHAIN KX276771_HBx_P-B of FT:mat_peptide KX276771_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRXVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEVRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KX276772_HBx_P-B Product feature CHAIN KX276772_HBx_P-B of FT:mat_peptide KX276772_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276773_HBx_P-B Product feature CHAIN KX276773_HBx_P-B of FT:mat_peptide KX276773_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAVSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276774_HBx_P-B Product feature CHAIN KX276774_HBx_P-B of FT:mat_peptide KX276774_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAXRLCCQLDPARDVLCLRPVGAESRGRPLXGXLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSALSTTXLEAYXKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KX276775_HBx_P-B Product feature CHAIN KX276775_HBx_P-B of FT:mat_peptide KX276775_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276776_HBx_P-B Product feature CHAIN KX276776_HBx_P-B of FT:mat_peptide KX276776_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLXCQLDXXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVXSLAPCNFFTSA
>gnl|hbvpro|KX276777_HBx_P-B Product feature CHAIN KX276777_HBx_P-B of FT:mat_peptide KX276777_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276778_HBx_P-B Product feature CHAIN KX276778_HBx_P-B of FT:mat_peptide KX276778_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276779_HBx_P-B Product feature CHAIN KX276779_HBx_P-B of FT:mat_peptide KX276779_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPXPCNFFTSA
>gnl|hbvpro|KX276781_HBx_P-B Product feature CHAIN KX276781_HBx_P-B of FT:mat_peptide KX276781_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276782_HBx_P-B Product feature CHAIN KX276782_HBx_P-B of FT:mat_peptide KX276782_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276783_HBx_P-B Product feature CHAIN KX276783_HBx_P-B of FT:mat_peptide KX276783_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTXNAXWNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276784_HBx_P-B Product feature CHAIN KX276784_HBx_P-B of FT:mat_peptide KX276784_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276785_HBx_P-B Product feature CHAIN KX276785_HBx_P-B of FT:mat_peptide KX276785_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALGNLPKVLHKRTLGLSAMSVTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276786_HBx_P-B Product feature CHAIN KX276786_HBx_P-B of FT:mat_peptide KX276786_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTXHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNXHRNLPKVLHKRTLGLSAXSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSQAPCNFFTSA
>gnl|hbvpro|KX276787_HBx_P-B Product feature CHAIN KX276787_HBx_P-B of FT:mat_peptide KX276787_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276788_HBx_P-B Product feature CHAIN KX276788_HBx_P-B of FT:mat_peptide KX276788_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNPHGNLPKVLHKRTLGLSAMSTTDLEAYFKDRVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276789_HBx_P-B Product feature CHAIN KX276789_HBx_P-B of FT:mat_peptide KX276789_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KX276790_HBx_P-B Product feature CHAIN KX276790_HBx_P-B of FT:mat_peptide KX276790_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTXHGSHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|KX276791_HBx_P-B Product feature CHAIN KX276791_HBx_P-B of FT:mat_peptide KX276791_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLXVFVLGGCXHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276792_HBx_P-B Product feature CHAIN KX276792_HBx_P-B of FT:mat_peptide KX276792_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KX276793_HBx_P-B Product feature CHAIN KX276793_HBx_P-B of FT:mat_peptide KX276793_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276794_HBx_P-B Product feature CHAIN KX276794_HBx_P-B of FT:mat_peptide KX276794_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXWNLPKVLXKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|KX276796_HBx_P-B Product feature CHAIN KX276796_HBx_P-B of FT:mat_peptide KX276796_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPXPCNFFTSA
>gnl|hbvpro|KX276797_HBx_P-B Product feature CHAIN KX276797_HBx_P-B of FT:mat_peptide KX276797_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276798_HBx_P-B Product feature CHAIN KX276798_HBx_P-B of FT:mat_peptide KX276798_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVXXPAXCNFFTSA
>gnl|hbvpro|KX276799_HBx_P-B Product feature CHAIN KX276799_HBx_P-B of FT:mat_peptide KX276799_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276800_HBx_P-B Product feature CHAIN KX276800_HBx_P-B of FT:mat_peptide KX276800_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDXARBVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTXDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276801_HBx_P-B Product feature CHAIN KX276801_HBx_P-B of FT:mat_peptide KX276801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276802_HBx_P-B Product feature CHAIN KX276802_HBx_P-B of FT:mat_peptide KX276802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPGVPTDHGAXLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCAPAPCDFFTSA
>gnl|hbvpro|KX276803_HBx_P-B Product feature CHAIN KX276803_HBx_P-B of FT:mat_peptide KX276803_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSXGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276804_HBx_P-B Product feature CHAIN KX276804_HBx_P-B of FT:mat_peptide KX276804_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276805_HBx_P-B Product feature CHAIN KX276805_HBx_P-B of FT:mat_peptide KX276805_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276806_HBx_P-B Product feature CHAIN KX276806_HBx_P-B of FT:mat_peptide KX276806_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDXARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLXKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVXSPAPCBFFTSA
>gnl|hbvpro|KX276807_HBx_P-B Product feature CHAIN KX276807_HBx_P-B of FT:mat_peptide KX276807_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGLPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNXPWNLPKVLXKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276808_HBx_P-B Product feature CHAIN KX276808_HBx_P-B of FT:mat_peptide KX276808_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276809_HBx_P-B Product feature CHAIN KX276809_HBx_P-B of FT:mat_peptide KX276809_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|KX276810_HBx_P-B Product feature CHAIN KX276810_HBx_P-B of FT:mat_peptide KX276810_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNXXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVXSPXXCNFFTSA
>gnl|hbvpro|KX276811_HBx_P-B Product feature CHAIN KX276811_HBx_P-B of FT:mat_peptide KX276811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KX276812_HBx_P-B Product feature CHAIN KX276812_HBx_P-B of FT:mat_peptide KX276812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEEYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276813_HBx_P-B Product feature CHAIN KX276813_HBx_P-B of FT:mat_peptide KX276813_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLXXFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KX276814_HBx_P-B Product feature CHAIN KX276814_HBx_P-B of FT:mat_peptide KX276814_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRXKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276815_HBx_P-B Product feature CHAIN KX276815_HBx_P-B of FT:mat_peptide KX276815_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276817_HBx_P-B Product feature CHAIN KX276817_HBx_P-B of FT:mat_peptide KX276817_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARBVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHGXHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276818_HBx_P-B Product feature CHAIN KX276818_HBx_P-B of FT:mat_peptide KX276818_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPXXAESRGRPLPGXLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSXMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCXHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276819_HBx_P-B Product feature CHAIN KX276819_HBx_P-B of FT:mat_peptide KX276819_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCXFFTSA
>gnl|hbvpro|KX276820_HBx_P-B Product feature CHAIN KX276820_HBx_P-B of FT:mat_peptide KX276820_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276821_HBx_P-B Product feature CHAIN KX276821_HBx_P-B of FT:mat_peptide KX276821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPXSPSXVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TXVNAXWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPRNFFTSA
>gnl|hbvpro|KX276822_HBx_P-B Product feature CHAIN KX276822_HBx_P-B of FT:mat_peptide KX276822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276823_HBx_P-B Product feature CHAIN KX276823_HBx_P-B of FT:mat_peptide KX276823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLXAMSTTDLEAYFKDCVFTEWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276824_HBx_P-B Product feature CHAIN KX276824_HBx_P-B of FT:mat_peptide KX276824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRLE
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEIRLKVFVLGGCRHKLVCSPAPGNFFTSA
>gnl|hbvpro|KX276825_HBx_P-B Product feature CHAIN KX276825_HBx_P-B of FT:mat_peptide KX276825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276827_HBx_P-B Product feature CHAIN KX276827_HBx_P-B of FT:mat_peptide KX276827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPXSPXAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276828_HBx_P-B Product feature CHAIN KX276828_HBx_P-B of FT:mat_peptide KX276828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276829_HBx_P-B Product feature CHAIN KX276829_HBx_P-B of FT:mat_peptide KX276829_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX276830_HBx_P-B Product feature CHAIN KX276830_HBx_P-B of FT:mat_peptide KX276830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVSTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPFNFFTSA
>gnl|hbvpro|KX276858_HBx_P-B Product feature CHAIN KX276858_HBx_P-B of FT:mat_peptide KX276858_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPXVPADHGXHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429616_HBx_P-B Product feature CHAIN KX429616_HBx_P-B of FT:mat_peptide KX429616_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429620_HBx_P-B Product feature CHAIN KX429620_HBx_P-B of FT:mat_peptide KX429620_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR5). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429621_HBx_P-B Product feature CHAIN KX429621_HBx_P-B of FT:mat_peptide KX429621_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR6). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429622_HBx_P-B Product feature CHAIN KX429622_HBx_P-B of FT:mat_peptide KX429622_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR7). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429623_HBx_P-B Product feature CHAIN KX429623_HBx_P-B of FT:mat_peptide KX429623_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR8). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429624_HBx_P-B Product feature CHAIN KX429624_HBx_P-B of FT:mat_peptide KX429624_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR9). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429626_HBx_P-B Product feature CHAIN KX429626_HBx_P-B of FT:mat_peptide KX429626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR11). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429627_HBx_P-B Product feature CHAIN KX429627_HBx_P-B of FT:mat_peptide KX429627_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR12). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429628_HBx_P-B Product feature CHAIN KX429628_HBx_P-B of FT:mat_peptide KX429628_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR13). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEGEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429630_HBx_P-B Product feature CHAIN KX429630_HBx_P-B of FT:mat_peptide KX429630_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR15). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEMGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429631_HBx_P-B Product feature CHAIN KX429631_HBx_P-B of FT:mat_peptide KX429631_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RR16). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRAKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429647_HBx_P-B Product feature CHAIN KX429647_HBx_P-B of FT:mat_peptide KX429647_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JS32). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX429648_HBx_P-B Product feature CHAIN KX429648_HBx_P-B of FT:mat_peptide KX429648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JS33). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|KX429651_HBx_P-B Product feature CHAIN KX429651_HBx_P-B of FT:mat_peptide KX429651_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JS36). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX765841_HBx_P-B Product feature CHAIN KX765841_HBx_P-B of FT:mat_peptide KX765841_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PID:1074). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX765854_HBx_P-B Product feature CHAIN KX765854_HBx_P-B of FT:mat_peptide KX765854_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PID:9149). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX765856_HBx_P-B Product feature CHAIN KX765856_HBx_P-B of FT:mat_peptide KX765856_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PID:9231). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPGIPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTTSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY417926_HBx_P-B Product feature CHAIN KY417926_HBx_P-B of FT:mat_peptide KY417926_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-20721). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPSNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470830_HBx_P-B Product feature CHAIN KY470830_HBx_P-B of FT:mat_peptide KY470830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-2-15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470832_HBx_P-B Product feature CHAIN KY470832_HBx_P-B of FT:mat_peptide KY470832_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470833_HBx_P-B Product feature CHAIN KY470833_HBx_P-B of FT:mat_peptide KY470833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470834_HBx_P-B Product feature CHAIN KY470834_HBx_P-B of FT:mat_peptide KY470834_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470835_HBx_P-B Product feature CHAIN KY470835_HBx_P-B of FT:mat_peptide KY470835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-D7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470836_HBx_P-B Product feature CHAIN KY470836_HBx_P-B of FT:mat_peptide KY470836_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470837_HBx_P-B Product feature CHAIN KY470837_HBx_P-B of FT:mat_peptide KY470837_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470838_HBx_P-B Product feature CHAIN KY470838_HBx_P-B of FT:mat_peptide KY470838_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-E3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGPSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470839_HBx_P-B Product feature CHAIN KY470839_HBx_P-B of FT:mat_peptide KY470839_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470840_HBx_P-B Product feature CHAIN KY470840_HBx_P-B of FT:mat_peptide KY470840_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470841_HBx_P-B Product feature CHAIN KY470841_HBx_P-B of FT:mat_peptide KY470841_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10-F5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470953_HBx_P-B Product feature CHAIN KY470953_HBx_P-B of FT:mat_peptide KY470953_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGAEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470954_HBx_P-B Product feature CHAIN KY470954_HBx_P-B of FT:mat_peptide KY470954_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470956_HBx_P-B Product feature CHAIN KY470956_HBx_P-B of FT:mat_peptide KY470956_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-D2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEREELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470960_HBx_P-B Product feature CHAIN KY470960_HBx_P-B of FT:mat_peptide KY470960_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-E11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470961_HBx_P-B Product feature CHAIN KY470961_HBx_P-B of FT:mat_peptide KY470961_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-E8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470962_HBx_P-B Product feature CHAIN KY470962_HBx_P-B of FT:mat_peptide KY470962_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYL-F10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY629635_HBx_P-B Product feature CHAIN KY629635_HBx_P-B of FT:mat_peptide KY629635_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TYM03009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY629636_HBx_P-B Product feature CHAIN KY629636_HBx_P-B of FT:mat_peptide KY629636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TYM03036). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGVESRRRPLPGPLGALPTASPSAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881721_HBx_P-B Product feature CHAIN KY881721_HBx_P-B of FT:mat_peptide KY881721_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881722_HBx_P-B Product feature CHAIN KY881722_HBx_P-B of FT:mat_peptide KY881722_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881723_HBx_P-B Product feature CHAIN KY881723_HBx_P-B of FT:mat_peptide KY881723_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881724_HBx_P-B Product feature CHAIN KY881724_HBx_P-B of FT:mat_peptide KY881724_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881725_HBx_P-B Product feature CHAIN KY881725_HBx_P-B of FT:mat_peptide KY881725_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881726_HBx_P-B Product feature CHAIN KY881726_HBx_P-B of FT:mat_peptide KY881726_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881727_HBx_P-B Product feature CHAIN KY881727_HBx_P-B of FT:mat_peptide KY881727_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881728_HBx_P-B Product feature CHAIN KY881728_HBx_P-B of FT:mat_peptide KY881728_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881729_HBx_P-B Product feature CHAIN KY881729_HBx_P-B of FT:mat_peptide KY881729_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881730_HBx_P-B Product feature CHAIN KY881730_HBx_P-B of FT:mat_peptide KY881730_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881731_HBx_P-B Product feature CHAIN KY881731_HBx_P-B of FT:mat_peptide KY881731_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881732_HBx_P-B Product feature CHAIN KY881732_HBx_P-B of FT:mat_peptide KY881732_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881733_HBx_P-B Product feature CHAIN KY881733_HBx_P-B of FT:mat_peptide KY881733_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881734_HBx_P-B Product feature CHAIN KY881734_HBx_P-B of FT:mat_peptide KY881734_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881735_HBx_P-B Product feature CHAIN KY881735_HBx_P-B of FT:mat_peptide KY881735_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881740_HBx_P-B Product feature CHAIN KY881740_HBx_P-B of FT:mat_peptide KY881740_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881741_HBx_P-B Product feature CHAIN KY881741_HBx_P-B of FT:mat_peptide KY881741_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881745_HBx_P-B Product feature CHAIN KY881745_HBx_P-B of FT:mat_peptide KY881745_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881746_HBx_P-B Product feature CHAIN KY881746_HBx_P-B of FT:mat_peptide KY881746_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881747_HBx_P-B Product feature CHAIN KY881747_HBx_P-B of FT:mat_peptide KY881747_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881752_HBx_P-B Product feature CHAIN KY881752_HBx_P-B of FT:mat_peptide KY881752_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881753_HBx_P-B Product feature CHAIN KY881753_HBx_P-B of FT:mat_peptide KY881753_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881756_HBx_P-B Product feature CHAIN KY881756_HBx_P-B of FT:mat_peptide KY881756_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881757_HBx_P-B Product feature CHAIN KY881757_HBx_P-B of FT:mat_peptide KY881757_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881759_HBx_P-B Product feature CHAIN KY881759_HBx_P-B of FT:mat_peptide KY881759_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881760_HBx_P-B Product feature CHAIN KY881760_HBx_P-B of FT:mat_peptide KY881760_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881761_HBx_P-B Product feature CHAIN KY881761_HBx_P-B of FT:mat_peptide KY881761_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881778_HBx_P-B Product feature CHAIN KY881778_HBx_P-B of FT:mat_peptide KY881778_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881779_HBx_P-B Product feature CHAIN KY881779_HBx_P-B of FT:mat_peptide KY881779_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate control-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881780_HBx_P-B Product feature CHAIN KY881780_HBx_P-B of FT:mat_peptide KY881780_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881781_HBx_P-B Product feature CHAIN KY881781_HBx_P-B of FT:mat_peptide KY881781_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGPPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTPGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881782_HBx_P-B Product feature CHAIN KY881782_HBx_P-B of FT:mat_peptide KY881782_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881783_HBx_P-B Product feature CHAIN KY881783_HBx_P-B of FT:mat_peptide KY881783_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881784_HBx_P-B Product feature CHAIN KY881784_HBx_P-B of FT:mat_peptide KY881784_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWKELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881785_HBx_P-B Product feature CHAIN KY881785_HBx_P-B of FT:mat_peptide KY881785_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MPARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881786_HBx_P-B Product feature CHAIN KY881786_HBx_P-B of FT:mat_peptide KY881786_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881787_HBx_P-B Product feature CHAIN KY881787_HBx_P-B of FT:mat_peptide KY881787_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881788_HBx_P-B Product feature CHAIN KY881788_HBx_P-B of FT:mat_peptide KY881788_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881789_HBx_P-B Product feature CHAIN KY881789_HBx_P-B of FT:mat_peptide KY881789_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881790_HBx_P-B Product feature CHAIN KY881790_HBx_P-B of FT:mat_peptide KY881790_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881791_HBx_P-B Product feature CHAIN KY881791_HBx_P-B of FT:mat_peptide KY881791_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881793_HBx_P-B Product feature CHAIN KY881793_HBx_P-B of FT:mat_peptide KY881793_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMILVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881794_HBx_P-B Product feature CHAIN KY881794_HBx_P-B of FT:mat_peptide KY881794_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881795_HBx_P-B Product feature CHAIN KY881795_HBx_P-B of FT:mat_peptide KY881795_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881796_HBx_P-B Product feature CHAIN KY881796_HBx_P-B of FT:mat_peptide KY881796_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881797_HBx_P-B Product feature CHAIN KY881797_HBx_P-B of FT:mat_peptide KY881797_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEGVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881798_HBx_P-B Product feature CHAIN KY881798_HBx_P-B of FT:mat_peptide KY881798_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881799_HBx_P-B Product feature CHAIN KY881799_HBx_P-B of FT:mat_peptide KY881799_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881800_HBx_P-B Product feature CHAIN KY881800_HBx_P-B of FT:mat_peptide KY881800_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALCFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881801_HBx_P-B Product feature CHAIN KY881801_HBx_P-B of FT:mat_peptide KY881801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881808_HBx_P-B Product feature CHAIN KY881808_HBx_P-B of FT:mat_peptide KY881808_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881820_HBx_P-B Product feature CHAIN KY881820_HBx_P-B of FT:mat_peptide KY881820_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881821_HBx_P-B Product feature CHAIN KY881821_HBx_P-B of FT:mat_peptide KY881821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAECSEGHSTGTLRALPPASPSVVQTEHGAHLSLRGPRVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881822_HBx_P-B Product feature CHAIN KY881822_HBx_P-B of FT:mat_peptide KY881822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEKLGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881823_HBx_P-B Product feature CHAIN KY881823_HBx_P-B of FT:mat_peptide KY881823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHPSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881824_HBx_P-B Product feature CHAIN KY881824_HBx_P-B of FT:mat_peptide KY881824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881825_HBx_P-B Product feature CHAIN KY881825_HBx_P-B of FT:mat_peptide KY881825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLSVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881826_HBx_P-B Product feature CHAIN KY881826_HBx_P-B of FT:mat_peptide KY881826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLVIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881827_HBx_P-B Product feature CHAIN KY881827_HBx_P-B of FT:mat_peptide KY881827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881828_HBx_P-B Product feature CHAIN KY881828_HBx_P-B of FT:mat_peptide KY881828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881829_HBx_P-B Product feature CHAIN KY881829_HBx_P-B of FT:mat_peptide KY881829_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881830_HBx_P-B Product feature CHAIN KY881830_HBx_P-B of FT:mat_peptide KY881830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881831_HBx_P-B Product feature CHAIN KY881831_HBx_P-B of FT:mat_peptide KY881831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881833_HBx_P-B Product feature CHAIN KY881833_HBx_P-B of FT:mat_peptide KY881833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGSCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881834_HBx_P-B Product feature CHAIN KY881834_HBx_P-B of FT:mat_peptide KY881834_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881835_HBx_P-B Product feature CHAIN KY881835_HBx_P-B of FT:mat_peptide KY881835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881836_HBx_P-B Product feature CHAIN KY881836_HBx_P-B of FT:mat_peptide KY881836_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLSKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881837_HBx_P-B Product feature CHAIN KY881837_HBx_P-B of FT:mat_peptide KY881837_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MTARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881838_HBx_P-B Product feature CHAIN KY881838_HBx_P-B of FT:mat_peptide KY881838_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881839_HBx_P-B Product feature CHAIN KY881839_HBx_P-B of FT:mat_peptide KY881839_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWGELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881841_HBx_P-B Product feature CHAIN KY881841_HBx_P-B of FT:mat_peptide KY881841_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881842_HBx_P-B Product feature CHAIN KY881842_HBx_P-B of FT:mat_peptide KY881842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881843_HBx_P-B Product feature CHAIN KY881843_HBx_P-B of FT:mat_peptide KY881843_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLRLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881844_HBx_P-B Product feature CHAIN KY881844_HBx_P-B of FT:mat_peptide KY881844_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881845_HBx_P-B Product feature CHAIN KY881845_HBx_P-B of FT:mat_peptide KY881845_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHGAHLSLRGLPVCAFSSARPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KY881846_HBx_P-B Product feature CHAIN KY881846_HBx_P-B of FT:mat_peptide KY881846_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881847_HBx_P-B Product feature CHAIN KY881847_HBx_P-B of FT:mat_peptide KY881847_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881848_HBx_P-B Product feature CHAIN KY881848_HBx_P-B of FT:mat_peptide KY881848_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881849_HBx_P-B Product feature CHAIN KY881849_HBx_P-B of FT:mat_peptide KY881849_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KY881850_HBx_P-B Product feature CHAIN KY881850_HBx_P-B of FT:mat_peptide KY881850_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMATTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881851_HBx_P-B Product feature CHAIN KY881851_HBx_P-B of FT:mat_peptide KY881851_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881852_HBx_P-B Product feature CHAIN KY881852_HBx_P-B of FT:mat_peptide KY881852_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881853_HBx_P-B Product feature CHAIN KY881853_HBx_P-B of FT:mat_peptide KY881853_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPVSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KY881854_HBx_P-B Product feature CHAIN KY881854_HBx_P-B of FT:mat_peptide KY881854_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881855_HBx_P-B Product feature CHAIN KY881855_HBx_P-B of FT:mat_peptide KY881855_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881856_HBx_P-B Product feature CHAIN KY881856_HBx_P-B of FT:mat_peptide KY881856_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRALGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881857_HBx_P-B Product feature CHAIN KY881857_HBx_P-B of FT:mat_peptide KY881857_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881858_HBx_P-B Product feature CHAIN KY881858_HBx_P-B of FT:mat_peptide KY881858_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881859_HBx_P-B Product feature CHAIN KY881859_HBx_P-B of FT:mat_peptide KY881859_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881860_HBx_P-B Product feature CHAIN KY881860_HBx_P-B of FT:mat_peptide KY881860_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHRNLPKALHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881861_HBx_P-B Product feature CHAIN KY881861_HBx_P-B of FT:mat_peptide KY881861_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881862_HBx_P-B Product feature CHAIN KY881862_HBx_P-B of FT:mat_peptide KY881862_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881863_HBx_P-B Product feature CHAIN KY881863_HBx_P-B of FT:mat_peptide KY881863_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDRVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881864_HBx_P-B Product feature CHAIN KY881864_HBx_P-B of FT:mat_peptide KY881864_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLKAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KY881865_HBx_P-B Product feature CHAIN KY881865_HBx_P-B of FT:mat_peptide KY881865_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KY881866_HBx_P-B Product feature CHAIN KY881866_HBx_P-B of FT:mat_peptide KY881866_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881867_HBx_P-B Product feature CHAIN KY881867_HBx_P-B of FT:mat_peptide KY881867_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881868_HBx_P-B Product feature CHAIN KY881868_HBx_P-B of FT:mat_peptide KY881868_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881869_HBx_P-B Product feature CHAIN KY881869_HBx_P-B of FT:mat_peptide KY881869_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881893_HBx_P-B Product feature CHAIN KY881893_HBx_P-B of FT:mat_peptide KY881893_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881894_HBx_P-B Product feature CHAIN KY881894_HBx_P-B of FT:mat_peptide KY881894_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881895_HBx_P-B Product feature CHAIN KY881895_HBx_P-B of FT:mat_peptide KY881895_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881896_HBx_P-B Product feature CHAIN KY881896_HBx_P-B of FT:mat_peptide KY881896_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881897_HBx_P-B Product feature CHAIN KY881897_HBx_P-B of FT:mat_peptide KY881897_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881898_HBx_P-B Product feature CHAIN KY881898_HBx_P-B of FT:mat_peptide KY881898_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881899_HBx_P-B Product feature CHAIN KY881899_HBx_P-B of FT:mat_peptide KY881899_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881900_HBx_P-B Product feature CHAIN KY881900_HBx_P-B of FT:mat_peptide KY881900_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881901_HBx_P-B Product feature CHAIN KY881901_HBx_P-B of FT:mat_peptide KY881901_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881902_HBx_P-B Product feature CHAIN KY881902_HBx_P-B of FT:mat_peptide KY881902_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCTFFTSA
>gnl|hbvpro|KY881903_HBx_P-B Product feature CHAIN KY881903_HBx_P-B of FT:mat_peptide KY881903_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881904_HBx_P-B Product feature CHAIN KY881904_HBx_P-B of FT:mat_peptide KY881904_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881905_HBx_P-B Product feature CHAIN KY881905_HBx_P-B of FT:mat_peptide KY881905_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881906_HBx_P-B Product feature CHAIN KY881906_HBx_P-B of FT:mat_peptide KY881906_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881907_HBx_P-B Product feature CHAIN KY881907_HBx_P-B of FT:mat_peptide KY881907_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881908_HBx_P-B Product feature CHAIN KY881908_HBx_P-B of FT:mat_peptide KY881908_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881909_HBx_P-B Product feature CHAIN KY881909_HBx_P-B of FT:mat_peptide KY881909_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881910_HBx_P-B Product feature CHAIN KY881910_HBx_P-B of FT:mat_peptide KY881910_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881911_HBx_P-B Product feature CHAIN KY881911_HBx_P-B of FT:mat_peptide KY881911_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881912_HBx_P-B Product feature CHAIN KY881912_HBx_P-B of FT:mat_peptide KY881912_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881913_HBx_P-B Product feature CHAIN KY881913_HBx_P-B of FT:mat_peptide KY881913_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881914_HBx_P-B Product feature CHAIN KY881914_HBx_P-B of FT:mat_peptide KY881914_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881944_HBx_P-B Product feature CHAIN KY881944_HBx_P-B of FT:mat_peptide KY881944_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881945_HBx_P-B Product feature CHAIN KY881945_HBx_P-B of FT:mat_peptide KY881945_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881946_HBx_P-B Product feature CHAIN KY881946_HBx_P-B of FT:mat_peptide KY881946_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881947_HBx_P-B Product feature CHAIN KY881947_HBx_P-B of FT:mat_peptide KY881947_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881948_HBx_P-B Product feature CHAIN KY881948_HBx_P-B of FT:mat_peptide KY881948_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881949_HBx_P-B Product feature CHAIN KY881949_HBx_P-B of FT:mat_peptide KY881949_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881950_HBx_P-B Product feature CHAIN KY881950_HBx_P-B of FT:mat_peptide KY881950_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881951_HBx_P-B Product feature CHAIN KY881951_HBx_P-B of FT:mat_peptide KY881951_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881952_HBx_P-B Product feature CHAIN KY881952_HBx_P-B of FT:mat_peptide KY881952_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881953_HBx_P-B Product feature CHAIN KY881953_HBx_P-B of FT:mat_peptide KY881953_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881954_HBx_P-B Product feature CHAIN KY881954_HBx_P-B of FT:mat_peptide KY881954_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881955_HBx_P-B Product feature CHAIN KY881955_HBx_P-B of FT:mat_peptide KY881955_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881956_HBx_P-B Product feature CHAIN KY881956_HBx_P-B of FT:mat_peptide KY881956_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881957_HBx_P-B Product feature CHAIN KY881957_HBx_P-B of FT:mat_peptide KY881957_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881958_HBx_P-B Product feature CHAIN KY881958_HBx_P-B of FT:mat_peptide KY881958_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient-08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279268_HBx_P-B Product feature CHAIN LC279268_HBx_P-B of FT:mat_peptide LC279268_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_1st_child_serum). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279269_HBx_P-B Product feature CHAIN LC279269_HBx_P-B of FT:mat_peptide LC279269_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_1st_child_UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279270_HBx_P-B Product feature CHAIN LC279270_HBx_P-B of FT:mat_peptide LC279270_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_2nd_child_serum). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279271_HBx_P-B Product feature CHAIN LC279271_HBx_P-B of FT:mat_peptide LC279271_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_2nd_child_UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279272_HBx_P-B Product feature CHAIN LC279272_HBx_P-B of FT:mat_peptide LC279272_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_3rd_child_UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279273_HBx_P-B Product feature CHAIN LC279273_HBx_P-B of FT:mat_peptide LC279273_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ku_mother_serum). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349868_HBx_P-B Product feature CHAIN LC349868_HBx_P-B of FT:mat_peptide LC349868_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349869_HBx_P-B Product feature CHAIN LC349869_HBx_P-B of FT:mat_peptide LC349869_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349870_HBx_P-B Product feature CHAIN LC349870_HBx_P-B of FT:mat_peptide LC349870_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349871_HBx_P-B Product feature CHAIN LC349871_HBx_P-B of FT:mat_peptide LC349871_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPASPSAVQTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349872_HBx_P-B Product feature CHAIN LC349872_HBx_P-B of FT:mat_peptide LC349872_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349873_HBx_P-B Product feature CHAIN LC349873_HBx_P-B of FT:mat_peptide LC349873_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349874_HBx_P-B Product feature CHAIN LC349874_HBx_P-B of FT:mat_peptide LC349874_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMIFVLGGCGHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349875_HBx_P-B Product feature CHAIN LC349875_HBx_P-B of FT:mat_peptide LC349875_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349877_HBx_P-B Product feature CHAIN LC349877_HBx_P-B of FT:mat_peptide LC349877_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349878_HBx_P-B Product feature CHAIN LC349878_HBx_P-B of FT:mat_peptide LC349878_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC349879_HBx_P-B Product feature CHAIN LC349879_HBx_P-B of FT:mat_peptide LC349879_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC416037_HBx_P-B Product feature CHAIN LC416037_HBx_P-B of FT:mat_peptide LC416037_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TKI_2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|M54923_HBx_P-B Product feature CHAIN M54923_HBx_P-B of FT:mat_peptide M54923_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRSVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSPTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059357_HBx_P-B Product feature CHAIN MF059357_HBx_P-B of FT:mat_peptide MF059357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A100). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059358_HBx_P-B Product feature CHAIN MF059358_HBx_P-B of FT:mat_peptide MF059358_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A104). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059359_HBx_P-B Product feature CHAIN MF059359_HBx_P-B of FT:mat_peptide MF059359_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A105). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059360_HBx_P-B Product feature CHAIN MF059360_HBx_P-B of FT:mat_peptide MF059360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A107). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059361_HBx_P-B Product feature CHAIN MF059361_HBx_P-B of FT:mat_peptide MF059361_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A108). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059362_HBx_P-B Product feature CHAIN MF059362_HBx_P-B of FT:mat_peptide MF059362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A109). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059363_HBx_P-B Product feature CHAIN MF059363_HBx_P-B of FT:mat_peptide MF059363_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A110). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059364_HBx_P-B Product feature CHAIN MF059364_HBx_P-B of FT:mat_peptide MF059364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A111). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059365_HBx_P-B Product feature CHAIN MF059365_HBx_P-B of FT:mat_peptide MF059365_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A112). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059366_HBx_P-B Product feature CHAIN MF059366_HBx_P-B of FT:mat_peptide MF059366_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A114). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059367_HBx_P-B Product feature CHAIN MF059367_HBx_P-B of FT:mat_peptide MF059367_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A115). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059368_HBx_P-B Product feature CHAIN MF059368_HBx_P-B of FT:mat_peptide MF059368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A117). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059369_HBx_P-B Product feature CHAIN MF059369_HBx_P-B of FT:mat_peptide MF059369_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A118). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059370_HBx_P-B Product feature CHAIN MF059370_HBx_P-B of FT:mat_peptide MF059370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A12). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059371_HBx_P-B Product feature CHAIN MF059371_HBx_P-B of FT:mat_peptide MF059371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A124). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059372_HBx_P-B Product feature CHAIN MF059372_HBx_P-B of FT:mat_peptide MF059372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A125). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059373_HBx_P-B Product feature CHAIN MF059373_HBx_P-B of FT:mat_peptide MF059373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A126). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059374_HBx_P-B Product feature CHAIN MF059374_HBx_P-B of FT:mat_peptide MF059374_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A127). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059375_HBx_P-B Product feature CHAIN MF059375_HBx_P-B of FT:mat_peptide MF059375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A129). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059376_HBx_P-B Product feature CHAIN MF059376_HBx_P-B of FT:mat_peptide MF059376_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A130). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059377_HBx_P-B Product feature CHAIN MF059377_HBx_P-B of FT:mat_peptide MF059377_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A131). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059378_HBx_P-B Product feature CHAIN MF059378_HBx_P-B of FT:mat_peptide MF059378_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A136). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059379_HBx_P-B Product feature CHAIN MF059379_HBx_P-B of FT:mat_peptide MF059379_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A137). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059380_HBx_P-B Product feature CHAIN MF059380_HBx_P-B of FT:mat_peptide MF059380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A139). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059381_HBx_P-B Product feature CHAIN MF059381_HBx_P-B of FT:mat_peptide MF059381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A141). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059382_HBx_P-B Product feature CHAIN MF059382_HBx_P-B of FT:mat_peptide MF059382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A142). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059383_HBx_P-B Product feature CHAIN MF059383_HBx_P-B of FT:mat_peptide MF059383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A144). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059384_HBx_P-B Product feature CHAIN MF059384_HBx_P-B of FT:mat_peptide MF059384_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A148). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059385_HBx_P-B Product feature CHAIN MF059385_HBx_P-B of FT:mat_peptide MF059385_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A149). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059386_HBx_P-B Product feature CHAIN MF059386_HBx_P-B of FT:mat_peptide MF059386_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A15). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059387_HBx_P-B Product feature CHAIN MF059387_HBx_P-B of FT:mat_peptide MF059387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A150). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059388_HBx_P-B Product feature CHAIN MF059388_HBx_P-B of FT:mat_peptide MF059388_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A152). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059389_HBx_P-B Product feature CHAIN MF059389_HBx_P-B of FT:mat_peptide MF059389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A156). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059390_HBx_P-B Product feature CHAIN MF059390_HBx_P-B of FT:mat_peptide MF059390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A157). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059391_HBx_P-B Product feature CHAIN MF059391_HBx_P-B of FT:mat_peptide MF059391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A158). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059392_HBx_P-B Product feature CHAIN MF059392_HBx_P-B of FT:mat_peptide MF059392_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A160). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059393_HBx_P-B Product feature CHAIN MF059393_HBx_P-B of FT:mat_peptide MF059393_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A162). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059394_HBx_P-B Product feature CHAIN MF059394_HBx_P-B of FT:mat_peptide MF059394_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A163). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059395_HBx_P-B Product feature CHAIN MF059395_HBx_P-B of FT:mat_peptide MF059395_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A164). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059396_HBx_P-B Product feature CHAIN MF059396_HBx_P-B of FT:mat_peptide MF059396_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A166). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059397_HBx_P-B Product feature CHAIN MF059397_HBx_P-B of FT:mat_peptide MF059397_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A167). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059398_HBx_P-B Product feature CHAIN MF059398_HBx_P-B of FT:mat_peptide MF059398_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A168). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059399_HBx_P-B Product feature CHAIN MF059399_HBx_P-B of FT:mat_peptide MF059399_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A169). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059400_HBx_P-B Product feature CHAIN MF059400_HBx_P-B of FT:mat_peptide MF059400_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A170). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059401_HBx_P-B Product feature CHAIN MF059401_HBx_P-B of FT:mat_peptide MF059401_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A171). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059402_HBx_P-B Product feature CHAIN MF059402_HBx_P-B of FT:mat_peptide MF059402_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A172). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059403_HBx_P-B Product feature CHAIN MF059403_HBx_P-B of FT:mat_peptide MF059403_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A173). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059404_HBx_P-B Product feature CHAIN MF059404_HBx_P-B of FT:mat_peptide MF059404_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A174). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059405_HBx_P-B Product feature CHAIN MF059405_HBx_P-B of FT:mat_peptide MF059405_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A175). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059406_HBx_P-B Product feature CHAIN MF059406_HBx_P-B of FT:mat_peptide MF059406_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A176). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059407_HBx_P-B Product feature CHAIN MF059407_HBx_P-B of FT:mat_peptide MF059407_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A177). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059408_HBx_P-B Product feature CHAIN MF059408_HBx_P-B of FT:mat_peptide MF059408_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A178). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059409_HBx_P-B Product feature CHAIN MF059409_HBx_P-B of FT:mat_peptide MF059409_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A179). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059410_HBx_P-B Product feature CHAIN MF059410_HBx_P-B of FT:mat_peptide MF059410_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A181). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059411_HBx_P-B Product feature CHAIN MF059411_HBx_P-B of FT:mat_peptide MF059411_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A182). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059412_HBx_P-B Product feature CHAIN MF059412_HBx_P-B of FT:mat_peptide MF059412_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A185). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059413_HBx_P-B Product feature CHAIN MF059413_HBx_P-B of FT:mat_peptide MF059413_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A186). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059414_HBx_P-B Product feature CHAIN MF059414_HBx_P-B of FT:mat_peptide MF059414_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A187). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059415_HBx_P-B Product feature CHAIN MF059415_HBx_P-B of FT:mat_peptide MF059415_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A188). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059416_HBx_P-B Product feature CHAIN MF059416_HBx_P-B of FT:mat_peptide MF059416_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A191). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059417_HBx_P-B Product feature CHAIN MF059417_HBx_P-B of FT:mat_peptide MF059417_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A192). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059418_HBx_P-B Product feature CHAIN MF059418_HBx_P-B of FT:mat_peptide MF059418_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A193). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059419_HBx_P-B Product feature CHAIN MF059419_HBx_P-B of FT:mat_peptide MF059419_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A194). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059420_HBx_P-B Product feature CHAIN MF059420_HBx_P-B of FT:mat_peptide MF059420_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A195). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059421_HBx_P-B Product feature CHAIN MF059421_HBx_P-B of FT:mat_peptide MF059421_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A198). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059422_HBx_P-B Product feature CHAIN MF059422_HBx_P-B of FT:mat_peptide MF059422_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A199). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059423_HBx_P-B Product feature CHAIN MF059423_HBx_P-B of FT:mat_peptide MF059423_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A20). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059424_HBx_P-B Product feature CHAIN MF059424_HBx_P-B of FT:mat_peptide MF059424_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A200). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059425_HBx_P-B Product feature CHAIN MF059425_HBx_P-B of FT:mat_peptide MF059425_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A201). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059426_HBx_P-B Product feature CHAIN MF059426_HBx_P-B of FT:mat_peptide MF059426_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A202). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059427_HBx_P-B Product feature CHAIN MF059427_HBx_P-B of FT:mat_peptide MF059427_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A204). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059428_HBx_P-B Product feature CHAIN MF059428_HBx_P-B of FT:mat_peptide MF059428_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A205). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059429_HBx_P-B Product feature CHAIN MF059429_HBx_P-B of FT:mat_peptide MF059429_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A206). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059430_HBx_P-B Product feature CHAIN MF059430_HBx_P-B of FT:mat_peptide MF059430_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A208). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059431_HBx_P-B Product feature CHAIN MF059431_HBx_P-B of FT:mat_peptide MF059431_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A209). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059432_HBx_P-B Product feature CHAIN MF059432_HBx_P-B of FT:mat_peptide MF059432_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A21). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059433_HBx_P-B Product feature CHAIN MF059433_HBx_P-B of FT:mat_peptide MF059433_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A210). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059434_HBx_P-B Product feature CHAIN MF059434_HBx_P-B of FT:mat_peptide MF059434_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A213). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059435_HBx_P-B Product feature CHAIN MF059435_HBx_P-B of FT:mat_peptide MF059435_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A215). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059436_HBx_P-B Product feature CHAIN MF059436_HBx_P-B of FT:mat_peptide MF059436_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A216). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059437_HBx_P-B Product feature CHAIN MF059437_HBx_P-B of FT:mat_peptide MF059437_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A217). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059438_HBx_P-B Product feature CHAIN MF059438_HBx_P-B of FT:mat_peptide MF059438_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A22). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059439_HBx_P-B Product feature CHAIN MF059439_HBx_P-B of FT:mat_peptide MF059439_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A220). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059440_HBx_P-B Product feature CHAIN MF059440_HBx_P-B of FT:mat_peptide MF059440_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A221). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059441_HBx_P-B Product feature CHAIN MF059441_HBx_P-B of FT:mat_peptide MF059441_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A223). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059442_HBx_P-B Product feature CHAIN MF059442_HBx_P-B of FT:mat_peptide MF059442_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A225). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059443_HBx_P-B Product feature CHAIN MF059443_HBx_P-B of FT:mat_peptide MF059443_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A228). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059444_HBx_P-B Product feature CHAIN MF059444_HBx_P-B of FT:mat_peptide MF059444_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A229). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059445_HBx_P-B Product feature CHAIN MF059445_HBx_P-B of FT:mat_peptide MF059445_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A23). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059446_HBx_P-B Product feature CHAIN MF059446_HBx_P-B of FT:mat_peptide MF059446_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A232). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059447_HBx_P-B Product feature CHAIN MF059447_HBx_P-B of FT:mat_peptide MF059447_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A233). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059448_HBx_P-B Product feature CHAIN MF059448_HBx_P-B of FT:mat_peptide MF059448_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A234). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059449_HBx_P-B Product feature CHAIN MF059449_HBx_P-B of FT:mat_peptide MF059449_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A235). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059450_HBx_P-B Product feature CHAIN MF059450_HBx_P-B of FT:mat_peptide MF059450_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A238). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059452_HBx_P-B Product feature CHAIN MF059452_HBx_P-B of FT:mat_peptide MF059452_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A240). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059453_HBx_P-B Product feature CHAIN MF059453_HBx_P-B of FT:mat_peptide MF059453_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A241). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059454_HBx_P-B Product feature CHAIN MF059454_HBx_P-B of FT:mat_peptide MF059454_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A242). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059455_HBx_P-B Product feature CHAIN MF059455_HBx_P-B of FT:mat_peptide MF059455_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A245). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059456_HBx_P-B Product feature CHAIN MF059456_HBx_P-B of FT:mat_peptide MF059456_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A247). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059457_HBx_P-B Product feature CHAIN MF059457_HBx_P-B of FT:mat_peptide MF059457_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A249). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059458_HBx_P-B Product feature CHAIN MF059458_HBx_P-B of FT:mat_peptide MF059458_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A255). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059459_HBx_P-B Product feature CHAIN MF059459_HBx_P-B of FT:mat_peptide MF059459_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A256). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059460_HBx_P-B Product feature CHAIN MF059460_HBx_P-B of FT:mat_peptide MF059460_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A260). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059461_HBx_P-B Product feature CHAIN MF059461_HBx_P-B of FT:mat_peptide MF059461_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A261). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059462_HBx_P-B Product feature CHAIN MF059462_HBx_P-B of FT:mat_peptide MF059462_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A262). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059463_HBx_P-B Product feature CHAIN MF059463_HBx_P-B of FT:mat_peptide MF059463_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A263). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059464_HBx_P-B Product feature CHAIN MF059464_HBx_P-B of FT:mat_peptide MF059464_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A264). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059465_HBx_P-B Product feature CHAIN MF059465_HBx_P-B of FT:mat_peptide MF059465_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A265). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059466_HBx_P-B Product feature CHAIN MF059466_HBx_P-B of FT:mat_peptide MF059466_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A266). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLRGCKHKLVCSPTPCNFFTSA
>gnl|hbvpro|MF059467_HBx_P-B Product feature CHAIN MF059467_HBx_P-B of FT:mat_peptide MF059467_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A267). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059468_HBx_P-B Product feature CHAIN MF059468_HBx_P-B of FT:mat_peptide MF059468_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A268). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059469_HBx_P-B Product feature CHAIN MF059469_HBx_P-B of FT:mat_peptide MF059469_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A269). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059470_HBx_P-B Product feature CHAIN MF059470_HBx_P-B of FT:mat_peptide MF059470_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A27). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059471_HBx_P-B Product feature CHAIN MF059471_HBx_P-B of FT:mat_peptide MF059471_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A270). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059472_HBx_P-B Product feature CHAIN MF059472_HBx_P-B of FT:mat_peptide MF059472_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A271). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059473_HBx_P-B Product feature CHAIN MF059473_HBx_P-B of FT:mat_peptide MF059473_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A273). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059476_HBx_P-B Product feature CHAIN MF059476_HBx_P-B of FT:mat_peptide MF059476_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A277). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059477_HBx_P-B Product feature CHAIN MF059477_HBx_P-B of FT:mat_peptide MF059477_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A278). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059478_HBx_P-B Product feature CHAIN MF059478_HBx_P-B of FT:mat_peptide MF059478_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A279). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059479_HBx_P-B Product feature CHAIN MF059479_HBx_P-B of FT:mat_peptide MF059479_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A280). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059480_HBx_P-B Product feature CHAIN MF059480_HBx_P-B of FT:mat_peptide MF059480_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A281). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059481_HBx_P-B Product feature CHAIN MF059481_HBx_P-B of FT:mat_peptide MF059481_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A282). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059482_HBx_P-B Product feature CHAIN MF059482_HBx_P-B of FT:mat_peptide MF059482_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A283). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059483_HBx_P-B Product feature CHAIN MF059483_HBx_P-B of FT:mat_peptide MF059483_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A284). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059484_HBx_P-B Product feature CHAIN MF059484_HBx_P-B of FT:mat_peptide MF059484_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A285). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059485_HBx_P-B Product feature CHAIN MF059485_HBx_P-B of FT:mat_peptide MF059485_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A286). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059486_HBx_P-B Product feature CHAIN MF059486_HBx_P-B of FT:mat_peptide MF059486_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A289). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059487_HBx_P-B Product feature CHAIN MF059487_HBx_P-B of FT:mat_peptide MF059487_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A29). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059488_HBx_P-B Product feature CHAIN MF059488_HBx_P-B of FT:mat_peptide MF059488_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A290). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059489_HBx_P-B Product feature CHAIN MF059489_HBx_P-B of FT:mat_peptide MF059489_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A291). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059490_HBx_P-B Product feature CHAIN MF059490_HBx_P-B of FT:mat_peptide MF059490_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A292). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059491_HBx_P-B Product feature CHAIN MF059491_HBx_P-B of FT:mat_peptide MF059491_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A293). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059492_HBx_P-B Product feature CHAIN MF059492_HBx_P-B of FT:mat_peptide MF059492_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A294). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059493_HBx_P-B Product feature CHAIN MF059493_HBx_P-B of FT:mat_peptide MF059493_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A295). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059494_HBx_P-B Product feature CHAIN MF059494_HBx_P-B of FT:mat_peptide MF059494_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A296). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059495_HBx_P-B Product feature CHAIN MF059495_HBx_P-B of FT:mat_peptide MF059495_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A297). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLRGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059496_HBx_P-B Product feature CHAIN MF059496_HBx_P-B of FT:mat_peptide MF059496_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A298). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059497_HBx_P-B Product feature CHAIN MF059497_HBx_P-B of FT:mat_peptide MF059497_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A299). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059498_HBx_P-B Product feature CHAIN MF059498_HBx_P-B of FT:mat_peptide MF059498_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A300). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059499_HBx_P-B Product feature CHAIN MF059499_HBx_P-B of FT:mat_peptide MF059499_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A301). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059500_HBx_P-B Product feature CHAIN MF059500_HBx_P-B of FT:mat_peptide MF059500_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A303). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059501_HBx_P-B Product feature CHAIN MF059501_HBx_P-B of FT:mat_peptide MF059501_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A305). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059502_HBx_P-B Product feature CHAIN MF059502_HBx_P-B of FT:mat_peptide MF059502_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A306). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059503_HBx_P-B Product feature CHAIN MF059503_HBx_P-B of FT:mat_peptide MF059503_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A308). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059504_HBx_P-B Product feature CHAIN MF059504_HBx_P-B of FT:mat_peptide MF059504_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A309). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059505_HBx_P-B Product feature CHAIN MF059505_HBx_P-B of FT:mat_peptide MF059505_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A31). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059506_HBx_P-B Product feature CHAIN MF059506_HBx_P-B of FT:mat_peptide MF059506_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A311). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059507_HBx_P-B Product feature CHAIN MF059507_HBx_P-B of FT:mat_peptide MF059507_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A312). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059508_HBx_P-B Product feature CHAIN MF059508_HBx_P-B of FT:mat_peptide MF059508_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A313). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059509_HBx_P-B Product feature CHAIN MF059509_HBx_P-B of FT:mat_peptide MF059509_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A314). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059510_HBx_P-B Product feature CHAIN MF059510_HBx_P-B of FT:mat_peptide MF059510_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A315). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059511_HBx_P-B Product feature CHAIN MF059511_HBx_P-B of FT:mat_peptide MF059511_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A317). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059512_HBx_P-B Product feature CHAIN MF059512_HBx_P-B of FT:mat_peptide MF059512_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A318). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059513_HBx_P-B Product feature CHAIN MF059513_HBx_P-B of FT:mat_peptide MF059513_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A319). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059514_HBx_P-B Product feature CHAIN MF059514_HBx_P-B of FT:mat_peptide MF059514_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A320). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059515_HBx_P-B Product feature CHAIN MF059515_HBx_P-B of FT:mat_peptide MF059515_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A321). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059516_HBx_P-B Product feature CHAIN MF059516_HBx_P-B of FT:mat_peptide MF059516_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A322). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059517_HBx_P-B Product feature CHAIN MF059517_HBx_P-B of FT:mat_peptide MF059517_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A323). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059518_HBx_P-B Product feature CHAIN MF059518_HBx_P-B of FT:mat_peptide MF059518_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A324). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059519_HBx_P-B Product feature CHAIN MF059519_HBx_P-B of FT:mat_peptide MF059519_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A325). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059520_HBx_P-B Product feature CHAIN MF059520_HBx_P-B of FT:mat_peptide MF059520_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A326). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059521_HBx_P-B Product feature CHAIN MF059521_HBx_P-B of FT:mat_peptide MF059521_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A327). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059522_HBx_P-B Product feature CHAIN MF059522_HBx_P-B of FT:mat_peptide MF059522_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A328). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059523_HBx_P-B Product feature CHAIN MF059523_HBx_P-B of FT:mat_peptide MF059523_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A329). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059524_HBx_P-B Product feature CHAIN MF059524_HBx_P-B of FT:mat_peptide MF059524_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A33). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059525_HBx_P-B Product feature CHAIN MF059525_HBx_P-B of FT:mat_peptide MF059525_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A330). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059526_HBx_P-B Product feature CHAIN MF059526_HBx_P-B of FT:mat_peptide MF059526_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A332). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059527_HBx_P-B Product feature CHAIN MF059527_HBx_P-B of FT:mat_peptide MF059527_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A333). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059528_HBx_P-B Product feature CHAIN MF059528_HBx_P-B of FT:mat_peptide MF059528_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A334). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059529_HBx_P-B Product feature CHAIN MF059529_HBx_P-B of FT:mat_peptide MF059529_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A335). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059530_HBx_P-B Product feature CHAIN MF059530_HBx_P-B of FT:mat_peptide MF059530_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A336). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059531_HBx_P-B Product feature CHAIN MF059531_HBx_P-B of FT:mat_peptide MF059531_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A337). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059532_HBx_P-B Product feature CHAIN MF059532_HBx_P-B of FT:mat_peptide MF059532_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A338). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059533_HBx_P-B Product feature CHAIN MF059533_HBx_P-B of FT:mat_peptide MF059533_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A339). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059534_HBx_P-B Product feature CHAIN MF059534_HBx_P-B of FT:mat_peptide MF059534_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A34). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059535_HBx_P-B Product feature CHAIN MF059535_HBx_P-B of FT:mat_peptide MF059535_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A340). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059536_HBx_P-B Product feature CHAIN MF059536_HBx_P-B of FT:mat_peptide MF059536_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A341). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059537_HBx_P-B Product feature CHAIN MF059537_HBx_P-B of FT:mat_peptide MF059537_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A343). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059538_HBx_P-B Product feature CHAIN MF059538_HBx_P-B of FT:mat_peptide MF059538_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A345). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059539_HBx_P-B Product feature CHAIN MF059539_HBx_P-B of FT:mat_peptide MF059539_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A346). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059540_HBx_P-B Product feature CHAIN MF059540_HBx_P-B of FT:mat_peptide MF059540_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A347). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059541_HBx_P-B Product feature CHAIN MF059541_HBx_P-B of FT:mat_peptide MF059541_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A348). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059542_HBx_P-B Product feature CHAIN MF059542_HBx_P-B of FT:mat_peptide MF059542_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A349). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059543_HBx_P-B Product feature CHAIN MF059543_HBx_P-B of FT:mat_peptide MF059543_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A352). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059544_HBx_P-B Product feature CHAIN MF059544_HBx_P-B of FT:mat_peptide MF059544_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A353). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059545_HBx_P-B Product feature CHAIN MF059545_HBx_P-B of FT:mat_peptide MF059545_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A354). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059546_HBx_P-B Product feature CHAIN MF059546_HBx_P-B of FT:mat_peptide MF059546_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A356). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059547_HBx_P-B Product feature CHAIN MF059547_HBx_P-B of FT:mat_peptide MF059547_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A359). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059548_HBx_P-B Product feature CHAIN MF059548_HBx_P-B of FT:mat_peptide MF059548_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A361). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059549_HBx_P-B Product feature CHAIN MF059549_HBx_P-B of FT:mat_peptide MF059549_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A362). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059550_HBx_P-B Product feature CHAIN MF059550_HBx_P-B of FT:mat_peptide MF059550_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A363). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059551_HBx_P-B Product feature CHAIN MF059551_HBx_P-B of FT:mat_peptide MF059551_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A365). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059552_HBx_P-B Product feature CHAIN MF059552_HBx_P-B of FT:mat_peptide MF059552_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A367). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059553_HBx_P-B Product feature CHAIN MF059553_HBx_P-B of FT:mat_peptide MF059553_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A368). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059554_HBx_P-B Product feature CHAIN MF059554_HBx_P-B of FT:mat_peptide MF059554_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A369). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|MF059555_HBx_P-B Product feature CHAIN MF059555_HBx_P-B of FT:mat_peptide MF059555_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A370). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059556_HBx_P-B Product feature CHAIN MF059556_HBx_P-B of FT:mat_peptide MF059556_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A371). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059557_HBx_P-B Product feature CHAIN MF059557_HBx_P-B of FT:mat_peptide MF059557_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A372). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059558_HBx_P-B Product feature CHAIN MF059558_HBx_P-B of FT:mat_peptide MF059558_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A373). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059559_HBx_P-B Product feature CHAIN MF059559_HBx_P-B of FT:mat_peptide MF059559_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A375). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059560_HBx_P-B Product feature CHAIN MF059560_HBx_P-B of FT:mat_peptide MF059560_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A376). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059561_HBx_P-B Product feature CHAIN MF059561_HBx_P-B of FT:mat_peptide MF059561_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A377). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059562_HBx_P-B Product feature CHAIN MF059562_HBx_P-B of FT:mat_peptide MF059562_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A378). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059564_HBx_P-B Product feature CHAIN MF059564_HBx_P-B of FT:mat_peptide MF059564_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A381). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059565_HBx_P-B Product feature CHAIN MF059565_HBx_P-B of FT:mat_peptide MF059565_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A382). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059566_HBx_P-B Product feature CHAIN MF059566_HBx_P-B of FT:mat_peptide MF059566_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A383). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059567_HBx_P-B Product feature CHAIN MF059567_HBx_P-B of FT:mat_peptide MF059567_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A384). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059568_HBx_P-B Product feature CHAIN MF059568_HBx_P-B of FT:mat_peptide MF059568_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A385). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059569_HBx_P-B Product feature CHAIN MF059569_HBx_P-B of FT:mat_peptide MF059569_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A386). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059570_HBx_P-B Product feature CHAIN MF059570_HBx_P-B of FT:mat_peptide MF059570_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A388). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059571_HBx_P-B Product feature CHAIN MF059571_HBx_P-B of FT:mat_peptide MF059571_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A389). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059572_HBx_P-B Product feature CHAIN MF059572_HBx_P-B of FT:mat_peptide MF059572_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A391). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059573_HBx_P-B Product feature CHAIN MF059573_HBx_P-B of FT:mat_peptide MF059573_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A392). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059575_HBx_P-B Product feature CHAIN MF059575_HBx_P-B of FT:mat_peptide MF059575_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A395). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059576_HBx_P-B Product feature CHAIN MF059576_HBx_P-B of FT:mat_peptide MF059576_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A396). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059577_HBx_P-B Product feature CHAIN MF059577_HBx_P-B of FT:mat_peptide MF059577_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A397). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059578_HBx_P-B Product feature CHAIN MF059578_HBx_P-B of FT:mat_peptide MF059578_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A398). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059579_HBx_P-B Product feature CHAIN MF059579_HBx_P-B of FT:mat_peptide MF059579_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A399). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059580_HBx_P-B Product feature CHAIN MF059580_HBx_P-B of FT:mat_peptide MF059580_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A4). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059581_HBx_P-B Product feature CHAIN MF059581_HBx_P-B of FT:mat_peptide MF059581_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A400). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059582_HBx_P-B Product feature CHAIN MF059582_HBx_P-B of FT:mat_peptide MF059582_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A401). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059583_HBx_P-B Product feature CHAIN MF059583_HBx_P-B of FT:mat_peptide MF059583_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A402). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059584_HBx_P-B Product feature CHAIN MF059584_HBx_P-B of FT:mat_peptide MF059584_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A403). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059585_HBx_P-B Product feature CHAIN MF059585_HBx_P-B of FT:mat_peptide MF059585_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A404). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059586_HBx_P-B Product feature CHAIN MF059586_HBx_P-B of FT:mat_peptide MF059586_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A405). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059587_HBx_P-B Product feature CHAIN MF059587_HBx_P-B of FT:mat_peptide MF059587_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A406). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059588_HBx_P-B Product feature CHAIN MF059588_HBx_P-B of FT:mat_peptide MF059588_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A408). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059589_HBx_P-B Product feature CHAIN MF059589_HBx_P-B of FT:mat_peptide MF059589_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A409). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059590_HBx_P-B Product feature CHAIN MF059590_HBx_P-B of FT:mat_peptide MF059590_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A41). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF059591_HBx_P-B Product feature CHAIN MF059591_HBx_P-B of FT:mat_peptide MF059591_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Hep-A410). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHR