HBVdb

Dataset for protein LHBs of genotype B

[Download (right click)] [Alignment] [Repertoires]

2581 sequence(s)

>gnl|hbvpro|AB010289_LHBs_P-B Product feature CHAIN AB010289_LHBs_P-B of FT:mat_peptide AB010289_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB010290_LHBs_P-B Product feature CHAIN AB010290_LHBs_P-B of FT:mat_peptide AB010290_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|AB010291_LHBs_P-B Product feature CHAIN AB010291_LHBs_P-B of FT:mat_peptide AB010291_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|AB010292_LHBs_P-B Product feature CHAIN AB010292_LHBs_P-B of FT:mat_peptide AB010292_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKGNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNATTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB014366_LHBs_P-B Product feature CHAIN AB014366_LHBs_P-B of FT:mat_peptide AB014366_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 07D07HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQIMQWNSTTFHQTLQDPRVRALYLPAGGSSSGIVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB031267_LHBs_P-B Product feature CHAIN AB031267_LHBs_P-B of FT:mat_peptide AB031267_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSATFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTASP
ISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMFPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB033554_LHBs_P-B Product feature CHAIN AB033554_LHBs_P-B of FT:mat_peptide AB033554_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB033555_LHBs_P-B Product feature CHAIN AB033555_LHBs_P-B of FT:mat_peptide AB033555_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073821_LHBs_P-B Product feature CHAIN AB073821_LHBs_P-B of FT:mat_peptide AB073821_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073822_LHBs_P-B Product feature CHAIN AB073822_LHBs_P-B of FT:mat_peptide AB073822_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073823_LHBs_P-B Product feature CHAIN AB073823_LHBs_P-B of FT:mat_peptide AB073823_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAWKVGVGAFGPGFTPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMESIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNLQSPISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073824_LHBs_P-B Product feature CHAIN AB073824_LHBs_P-B of FT:mat_peptide AB073824_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNTLKPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073825_LHBs_P-B Product feature CHAIN AB073825_LHBs_P-B of FT:mat_peptide AB073825_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRXSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073826_LHBs_P-B Product feature CHAIN AB073826_LHBs_P-B of FT:mat_peptide AB073826_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073827_LHBs_P-B Product feature CHAIN AB073827_LHBs_P-B of FT:mat_peptide AB073827_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPEANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073828_LHBs_P-B Product feature CHAIN AB073828_LHBs_P-B of FT:mat_peptide AB073828_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073829_LHBs_P-B Product feature CHAIN AB073829_LHBs_P-B of FT:mat_peptide AB073829_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073830_LHBs_P-B Product feature CHAIN AB073830_LHBs_P-B of FT:mat_peptide AB073830_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073831_LHBs_P-B Product feature CHAIN AB073831_LHBs_P-B of FT:mat_peptide AB073831_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGIHTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073832_LHBs_P-B Product feature CHAIN AB073832_LHBs_P-B of FT:mat_peptide AB073832_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073833_LHBs_P-B Product feature CHAIN AB073833_LHBs_P-B of FT:mat_peptide AB073833_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFXSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073834_LHBs_P-B Product feature CHAIN AB073834_LHBs_P-B of FT:mat_peptide AB073834_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073835_LHBs_P-B Product feature CHAIN AB073835_LHBs_P-B of FT:mat_peptide AB073835_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073836_LHBs_P-B Product feature CHAIN AB073836_LHBs_P-B of FT:mat_peptide AB073836_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDYWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073837_LHBs_P-B Product feature CHAIN AB073837_LHBs_P-B of FT:mat_peptide AB073837_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIHWKPPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073838_LHBs_P-B Product feature CHAIN AB073838_LHBs_P-B of FT:mat_peptide AB073838_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEYPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073839_LHBs_P-B Product feature CHAIN AB073839_LHBs_P-B of FT:mat_peptide AB073839_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKIGDPVPNMETISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDPLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073840_LHBs_P-B Product feature CHAIN AB073840_LHBs_P-B of FT:mat_peptide AB073840_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISXILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWXTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073841_LHBs_P-B Product feature CHAIN AB073841_LHBs_P-B of FT:mat_peptide AB073841_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGVSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073842_LHBs_P-B Product feature CHAIN AB073842_LHBs_P-B of FT:mat_peptide AB073842_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTIFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073843_LHBs_P-B Product feature CHAIN AB073843_LHBs_P-B of FT:mat_peptide AB073843_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073844_LHBs_P-B Product feature CHAIN AB073844_LHBs_P-B of FT:mat_peptide AB073844_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073845_LHBs_P-B Product feature CHAIN AB073845_LHBs_P-B of FT:mat_peptide AB073845_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073846_LHBs_P-B Product feature CHAIN AB073846_LHBs_P-B of FT:mat_peptide AB073846_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073847_LHBs_P-B Product feature CHAIN AB073847_LHBs_P-B of FT:mat_peptide AB073847_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGMVGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCPGRNSQSQISSHSPISCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073848_LHBs_P-B Product feature CHAIN AB073848_LHBs_P-B of FT:mat_peptide AB073848_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073849_LHBs_P-B Product feature CHAIN AB073849_LHBs_P-B of FT:mat_peptide AB073849_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQCQISSHSPTFCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073850_LHBs_P-B Product feature CHAIN AB073850_LHBs_P-B of FT:mat_peptide AB073850_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073851_LHBs_P-B Product feature CHAIN AB073851_LHBs_P-B of FT:mat_peptide AB073851_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVLNPLGFFPDHQLDPAFKANSENPDWNLNLHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCP
PICPGYRLMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGNFTFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFFWLSLLVPFVQWFVGLSPTVWLLVTWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073852_LHBs_P-B Product feature CHAIN AB073852_LHBs_P-B of FT:mat_peptide AB073852_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDARKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
TSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGPPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073853_LHBs_P-B Product feature CHAIN AB073853_LHBs_P-B of FT:mat_peptide AB073853_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIFSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDLWWTSLSFLGEPPVCHGQNSQCQICSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB073854_LHBs_P-B Product feature CHAIN AB073854_LHBs_P-B of FT:mat_peptide AB073854_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCP
PICPGYRWMYLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073855_LHBs_P-B Product feature CHAIN AB073855_LHBs_P-B of FT:mat_peptide AB073855_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MVGWSYKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073856_LHBs_P-B Product feature CHAIN AB073856_LHBs_P-B of FT:mat_peptide AB073856_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry46). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGIVSPAQNTVSA
ISSILSTTGDPVLNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073857_LHBs_P-B Product feature CHAIN AB073857_LHBs_P-B of FT:mat_peptide AB073857_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTNFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQARFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073858_LHBs_P-B Product feature CHAIN AB073858_LHBs_P-B of FT:mat_peptide AB073858_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPKMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB100695_LHBs_P-B Product feature CHAIN AB100695_LHBs_P-B of FT:mat_peptide AB100695_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB106884_LHBs_P-B Product feature CHAIN AB106884_LHBs_P-B of FT:mat_peptide AB106884_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGIVSPAQNTVST
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB115551_LHBs_P-B Product feature CHAIN AB115551_LHBs_P-B of FT:mat_peptide AB115551_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRTGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB117759_LHBs_P-B Product feature CHAIN AB117759_LHBs_P-B of FT:mat_peptide AB117759_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCPGQNSQSQIFSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARNPSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB195933_LHBs_P-B Product feature CHAIN AB195933_LHBs_P-B of FT:mat_peptide AB195933_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAVPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB195934_LHBs_P-B Product feature CHAIN AB195934_LHBs_P-B of FT:mat_peptide AB195934_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFAPPHGGLLGWSPQ
AQGLLTTVPAVPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB195935_LHBs_P-B Product feature CHAIN AB195935_LHBs_P-B of FT:mat_peptide AB195935_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFAPPHGGLLGWSPQ
AQGLLTTVPAVPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205119_LHBs_P-B Product feature CHAIN AB205119_LHBs_P-B of FT:mat_peptide AB205119_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKSRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTLPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLMPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205120_LHBs_P-B Product feature CHAIN AB205120_LHBs_P-B of FT:mat_peptide AB205120_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDADKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205121_LHBs_P-B Product feature CHAIN AB205121_LHBs_P-B of FT:mat_peptide AB205121_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205122_LHBs_P-B Product feature CHAIN AB205122_LHBs_P-B of FT:mat_peptide AB205122_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMFPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLLVYI
>gnl|hbvpro|AB212625_LHBs_P-B Product feature CHAIN AB212625_LHBs_P-B of FT:mat_peptide AB212625_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPHPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219426_LHBs_P-B Product feature CHAIN AB219426_LHBs_P-B of FT:mat_peptide AB219426_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDYWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPASPPPASTNRQVARPPTPLSPPLRDTHPQAMRWNSPTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|AB219427_LHBs_P-B Product feature CHAIN AB219427_LHBs_P-B of FT:mat_peptide AB219427_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDYWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVARPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTEGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219428_LHBs_C-B Product feature CHAIN AB219428_LHBs_C-B of FT:mat_peptide AB219428_LHBs_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVARPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219429_LHBs_P-B Product feature CHAIN AB219429_LHBs_P-B of FT:mat_peptide AB219429_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDYWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
SQGILTTVPAAPPPASTNRQVARPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDFQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219430_LHBs_P-B Product feature CHAIN AB219430_LHBs_P-B of FT:mat_peptide AB219430_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB231909_LHBs_P-B Product feature CHAIN AB231909_LHBs_P-B of FT:mat_peptide AB231909_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB241117_LHBs_P-B Product feature CHAIN AB241117_LHBs_P-B of FT:mat_peptide AB241117_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDYWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVARPPTPLSPPLRDTHPQATQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSTFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246339_LHBs_P-B Product feature CHAIN AB246339_LHBs_P-B of FT:mat_peptide AB246339_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246340_LHBs_P-B Product feature CHAIN AB246340_LHBs_P-B of FT:mat_peptide AB246340_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLMGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246341_LHBs_P-B Product feature CHAIN AB246341_LHBs_P-B of FT:mat_peptide AB246341_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246342_LHBs_P-B Product feature CHAIN AB246342_LHBs_P-B of FT:mat_peptide AB246342_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTIFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246343_LHBs_P-B Product feature CHAIN AB246343_LHBs_P-B of FT:mat_peptide AB246343_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTIFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWLTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287314_LHBs_P-B Product feature CHAIN AB287314_LHBs_P-B of FT:mat_peptide AB287314_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPTSTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGAVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287315_LHBs_P-B Product feature CHAIN AB287315_LHBs_P-B of FT:mat_peptide AB287315_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPTSTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGAVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287316_LHBs_P-B Product feature CHAIN AB287316_LHBs_P-B of FT:mat_peptide AB287316_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKDNWPDANKVGEGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPTSTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGAVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGPNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|AB287317_LHBs_P-B Product feature CHAIN AB287317_LHBs_P-B of FT:mat_peptide AB287317_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGAVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287318_LHBs_P-B Product feature CHAIN AB287318_LHBs_P-B of FT:mat_peptide AB287318_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAIQWNSPTFHQTLQHPRVRALYFPAGGSSSGAVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB287319_LHBs_P-B Product feature CHAIN AB287319_LHBs_P-B of FT:mat_peptide AB287319_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGAVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287320_LHBs_P-B Product feature CHAIN AB287320_LHBs_P-B of FT:mat_peptide AB287320_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRRPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSTTGDPVPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287321_LHBs_P-B Product feature CHAIN AB287321_LHBs_P-B of FT:mat_peptide AB287321_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRLPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB287322_LHBs_P-B Product feature CHAIN AB287322_LHBs_P-B of FT:mat_peptide AB287322_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRLPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287323_LHBs_P-B Product feature CHAIN AB287323_LHBs_P-B of FT:mat_peptide AB287323_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRLPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQSTASA
ISSTLSTTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEMPGCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILRPFTPLLPIFLCLWVYI
>gnl|hbvpro|AB287325_LHBs_P-B Product feature CHAIN AB287325_LHBs_P-B of FT:mat_peptide AB287325_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNQSDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRLPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLCTILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB287326_LHBs_P-B Product feature CHAIN AB287326_LHBs_P-B of FT:mat_peptide AB287326_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB287327_LHBs_P-B Product feature CHAIN AB287327_LHBs_P-B of FT:mat_peptide AB287327_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSNSSTTGGPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287328_LHBs_P-B Product feature CHAIN AB287328_LHBs_P-B of FT:mat_peptide AB287328_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287329_LHBs_P-B Product feature CHAIN AB287329_LHBs_P-B of FT:mat_peptide AB287329_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB300364_LHBs_P-B Product feature CHAIN AB300364_LHBs_P-B of FT:mat_peptide AB300364_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB300371_LHBs_P-B Product feature CHAIN AB300371_LHBs_P-B of FT:mat_peptide AB300371_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVST
TSSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302095_LHBs_P-B Product feature CHAIN AB302095_LHBs_P-B of FT:mat_peptide AB302095_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGRSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVKWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVTNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQTSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSSIPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB302942_LHBs_P-B Product feature CHAIN AB302942_LHBs_P-B of FT:mat_peptide AB302942_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302943_LHBs_P-B Product feature CHAIN AB302943_LHBs_P-B of FT:mat_peptide AB302943_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302944_LHBs_P-B Product feature CHAIN AB302944_LHBs_P-B of FT:mat_peptide AB302944_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302945_LHBs_P-B Product feature CHAIN AB302945_LHBs_P-B of FT:mat_peptide AB302945_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPVQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB362933_LHBs_P-B Product feature CHAIN AB362933_LHBs_P-B of FT:mat_peptide AB362933_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTECLGQNSQFQISNHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB365445_LHBs_P-B Product feature CHAIN AB365445_LHBs_P-B of FT:mat_peptide AB365445_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB368295_LHBs_P-B Product feature CHAIN AB368295_LHBs_P-B of FT:mat_peptide AB368295_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
TGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB471854_LHBs_P-B Product feature CHAIN AB471854_LHBs_P-B of FT:mat_peptide AB471854_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKDMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWNSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB471855_LHBs_P-B Product feature CHAIN AB471855_LHBs_P-B of FT:mat_peptide AB471855_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB493827_LHBs_P-B Product feature CHAIN AB493827_LHBs_P-B of FT:mat_peptide AB493827_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB493833_LHBs_P-B Product feature CHAIN AB493833_LHBs_P-B of FT:mat_peptide AB493833_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRHGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQTMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVFI
>gnl|hbvpro|AB493835_LHBs_P-B Product feature CHAIN AB493835_LHBs_P-B of FT:mat_peptide AB493835_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB555498_LHBs_P-B Product feature CHAIN AB555498_LHBs_P-B of FT:mat_peptide AB555498_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGQLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB555499_LHBs_P-B Product feature CHAIN AB555499_LHBs_P-B of FT:mat_peptide AB555499_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPASKANSENPDWDLNPHKDQWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLSSVSAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHHSPHGPRVRALYFPAGGSSSGTVSPAQITVSA
ISSILSKTGDPAPNMENIASGLPGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB642093_LHBs_P-B Product feature CHAIN AB642093_LHBs_P-B of FT:mat_peptide AB642093_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGXWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWXXXFWGPXLXNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|AB642094_LHBs_P-B Product feature CHAIN AB642094_LHBs_P-B of FT:mat_peptide AB642094_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB642101_LHBs_P-B Product feature CHAIN AB642101_LHBs_P-B of FT:mat_peptide AB642101_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT2009-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSYSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLVGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSITFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGEAPVCPGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDYHGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB675676_LHBs_P-B Product feature CHAIN AB675676_LHBs_P-B of FT:mat_peptide AB675676_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713527_LHBs_P-B Product feature CHAIN AB713527_LHBs_P-B of FT:mat_peptide AB713527_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713528_LHBs_P-B Product feature CHAIN AB713528_LHBs_P-B of FT:mat_peptide AB713528_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGAGAFGPGFTPPHGGLLGWSPQ
SQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSPKFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713529_LHBs_P-B Product feature CHAIN AB713529_LHBs_P-B of FT:mat_peptide AB713529_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv68). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPAFHNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQNLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713531_LHBs_P-B Product feature CHAIN AB713531_LHBs_P-B of FT:mat_peptide AB713531_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWRDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMEDIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLAPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB828708_LHBs_P-B Product feature CHAIN AB828708_LHBs_P-B of FT:mat_peptide AB828708_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HB12-0626). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIITSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
TSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900095_LHBs_P-B Product feature CHAIN AB900095_LHBs_P-B of FT:mat_peptide AB900095_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQICSHLPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB900096_LHBs_P-B Product feature CHAIN AB900096_LHBs_P-B of FT:mat_peptide AB900096_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGITTSLPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQTTVSA
ISSISSKTGDPVTNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB900097_LHBs_P-B Product feature CHAIN AB900097_LHBs_P-B of FT:mat_peptide AB900097_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
XQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB900098_LHBs_P-B Product feature CHAIN AB900098_LHBs_P-B of FT:mat_peptide AB900098_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILAHVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVST
ISSISSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB900102_LHBs_P-B Product feature CHAIN AB900102_LHBs_P-B of FT:mat_peptide AB900102_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900103_LHBs_P-B Product feature CHAIN AB900103_LHBs_P-B of FT:mat_peptide AB900103_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQICSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900104_LHBs_P-B Product feature CHAIN AB900104_LHBs_P-B of FT:mat_peptide AB900104_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQTSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900105_LHBs_P-B Product feature CHAIN AB900105_LHBs_P-B of FT:mat_peptide AB900105_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGIGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQCQISSHSPTCCP
PTCPGYXWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900106_LHBs_P-B Product feature CHAIN AB900106_LHBs_P-B of FT:mat_peptide AB900106_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900107_LHBs_P-B Product feature CHAIN AB900107_LHBs_P-B of FT:mat_peptide AB900107_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAQKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFVLWVYI
>gnl|hbvpro|AB900108_LHBs_P-B Product feature CHAIN AB900108_LHBs_P-B of FT:mat_peptide AB900108_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWNPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900110_LHBs_P-B Product feature CHAIN AB900110_LHBs_P-B of FT:mat_peptide AB900110_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWQDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSRRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB900111_LHBs_P-B Product feature CHAIN AB900111_LHBs_P-B of FT:mat_peptide AB900111_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900112_LHBs_P-B Product feature CHAIN AB900112_LHBs_P-B of FT:mat_peptide AB900112_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
XSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLXLWVYI
>gnl|hbvpro|AB931168_LHBs_P-B Product feature CHAIN AB931168_LHBs_P-B of FT:mat_peptide AB931168_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGVPPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB931169_LHBs_P-B Product feature CHAIN AB931169_LHBs_P-B of FT:mat_peptide AB931169_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGVPPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLCNILSPFMPLLPIFCCLWVFI
>gnl|hbvpro|AB976562_LHBs_P-B Product feature CHAIN AB976562_LHBs_P-B of FT:mat_peptide AB976562_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPVLPIFFCLWVYI
>gnl|hbvpro|AF100308_LHBs_P-B Product feature CHAIN AF100308_LHBs_P-B of FT:mat_peptide AF100308_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSVNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF100309_LHBs_P-B Product feature CHAIN AF100309_LHBs_P-B of FT:mat_peptide AF100309_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPTAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPALNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121243_LHBs_P-B Product feature CHAIN AF121243_LHBs_P-B of FT:mat_peptide AF121243_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121244_LHBs_P-B Product feature CHAIN AF121244_LHBs_P-B of FT:mat_peptide AF121244_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF121245_LHBs_P-B Product feature CHAIN AF121245_LHBs_P-B of FT:mat_peptide AF121245_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121246_LHBs_P-B Product feature CHAIN AF121246_LHBs_P-B of FT:mat_peptide AF121246_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121247_LHBs_P-B Product feature CHAIN AF121247_LHBs_P-B of FT:mat_peptide AF121247_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPNANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121248_LHBs_P-B Product feature CHAIN AF121248_LHBs_P-B of FT:mat_peptide AF121248_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121249_LHBs_P-B Product feature CHAIN AF121249_LHBs_P-B of FT:mat_peptide AF121249_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121250_LHBs_P-B Product feature CHAIN AF121250_LHBs_P-B of FT:mat_peptide AF121250_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121251_LHBs_P-B Product feature CHAIN AF121251_LHBs_P-B of FT:mat_peptide AF121251_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTSRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGQTPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLCNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF279464_LHBs_P-B Product feature CHAIN AF279464_LHBs_P-B of FT:mat_peptide AF279464_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSETPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF282917_LHBs_P-B Product feature CHAIN AF282917_LHBs_P-B of FT:mat_peptide AF282917_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
SQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AF282918_LHBs_P-B Product feature CHAIN AF282918_LHBs_P-B of FT:mat_peptide AF282918_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVYA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF479684_LHBs_P-B Product feature CHAIN AF479684_LHBs_P-B of FT:mat_peptide AF479684_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPSHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AJ627225_LHBs_P-B Product feature CHAIN AJ627225_LHBs_P-B of FT:mat_peptide AJ627225_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011084_LHBs_P-B Product feature CHAIN AP011084_LHBs_P-B of FT:mat_peptide AP011084_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSRTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWSVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011085_LHBs_P-B Product feature CHAIN AP011085_LHBs_P-B of FT:mat_peptide AP011085_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011086_LHBs_P-B Product feature CHAIN AP011086_LHBs_P-B of FT:mat_peptide AP011086_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011087_LHBs_P-B Product feature CHAIN AP011087_LHBs_P-B of FT:mat_peptide AP011087_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011088_LHBs_P-B Product feature CHAIN AP011088_LHBs_P-B of FT:mat_peptide AP011088_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNLHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011089_LHBs_P-B Product feature CHAIN AP011089_LHBs_P-B of FT:mat_peptide AP011089_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AP011090_LHBs_P-B Product feature CHAIN AP011090_LHBs_P-B of FT:mat_peptide AP011090_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011091_LHBs_P-B Product feature CHAIN AP011091_LHBs_P-B of FT:mat_peptide AP011091_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011092_LHBs_P-B Product feature CHAIN AP011092_LHBs_P-B of FT:mat_peptide AP011092_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011093_LHBs_P-B Product feature CHAIN AP011093_LHBs_P-B of FT:mat_peptide AP011093_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKTRKGMGKNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGMLTTVPTAPPPASTNRQSGRKPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFIQWFVGLSPTVWLSVLWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011094_LHBs_P-B Product feature CHAIN AP011094_LHBs_P-B of FT:mat_peptide AP011094_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDSWPDSNKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPTAPPPASTNRQLGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011095_LHBs_P-B Product feature CHAIN AP011095_LHBs_P-B of FT:mat_peptide AP011095_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDSWPDSNKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPTAPPPASANRQLGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011096_LHBs_P-B Product feature CHAIN AP011096_LHBs_P-B of FT:mat_peptide AP011096_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPTAPPPASTNRQLGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY033072_LHBs_P-B Product feature CHAIN AY033072_LHBs_P-B of FT:mat_peptide AY033072_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY033073_LHBs_P-B Product feature CHAIN AY033073_LHBs_P-B of FT:mat_peptide AY033073_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIVMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY163869_LHBs_P-B Product feature CHAIN AY163869_LHBs_P-B of FT:mat_peptide AY163869_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY163870_LHBs_P-B Product feature CHAIN AY163870_LHBs_P-B of FT:mat_peptide AY163870_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167089_LHBs_P-B Product feature CHAIN AY167089_LHBs_P-B of FT:mat_peptide AY167089_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167093_LHBs_P-B Product feature CHAIN AY167093_LHBs_P-B of FT:mat_peptide AY167093_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWTDANKVGVGAFGPGVTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILTPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167094_LHBs_P-B Product feature CHAIN AY167094_LHBs_P-B of FT:mat_peptide AY167094_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKDNWPDANKVGAGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167097_LHBs_P-B Product feature CHAIN AY167097_LHBs_P-B of FT:mat_peptide AY167097_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167098_LHBs_P-B Product feature CHAIN AY167098_LHBs_P-B of FT:mat_peptide AY167098_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|AY167100_LHBs_P-B Product feature CHAIN AY167100_LHBs_P-B of FT:mat_peptide AY167100_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMHWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSA
ISSILSKTGDPVPNMENIVSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167101_LHBs_P-B Product feature CHAIN AY167101_LHBs_P-B of FT:mat_peptide AY167101_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167102_LHBs_P-B Product feature CHAIN AY167102_LHBs_P-B of FT:mat_peptide AY167102_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKXNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGIPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPLSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY206373_LHBs_P-B Product feature CHAIN AY206373_LHBs_P-B of FT:mat_peptide AY206373_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLFTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSP
ISSILSKTGDPVPNMENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLVDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSLFMPLLPIFFCLWVYI
>gnl|hbvpro|AY206375_LHBs_P-B Product feature CHAIN AY206375_LHBs_P-B of FT:mat_peptide AY206375_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
RTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY206383_LHBs_P-B Product feature CHAIN AY206383_LHBs_P-B of FT:mat_peptide AY206383_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVRVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHHTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY206390_LHBs_P-B Product feature CHAIN AY206390_LHBs_P-B of FT:mat_peptide AY206390_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANQVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYV
>gnl|hbvpro|AY206391_LHBs_P-B Product feature CHAIN AY206391_LHBs_P-B of FT:mat_peptide AY206391_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWPSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYPPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217355_LHBs_P-B Product feature CHAIN AY217355_LHBs_P-B of FT:mat_peptide AY217355_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A6-2). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWNPQ
AQGLFTTVPAAPPPATTNRQSGRQPTPLSPPLRDTHPQVMQWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217356_LHBs_P-B Product feature CHAIN AY217356_LHBs_P-B of FT:mat_peptide AY217356_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWNPQ
AQGLFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217357_LHBs_P-B Product feature CHAIN AY217357_LHBs_P-B of FT:mat_peptide AY217357_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217358_LHBs_P-B Product feature CHAIN AY217358_LHBs_P-B of FT:mat_peptide AY217358_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217359_LHBs_P-B Product feature CHAIN AY217359_LHBs_P-B of FT:mat_peptide AY217359_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVGALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPVQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217360_LHBs_P-B Product feature CHAIN AY217360_LHBs_P-B of FT:mat_peptide AY217360_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217362_LHBs_P-B Product feature CHAIN AY217362_LHBs_P-B of FT:mat_peptide AY217362_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYVPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY220697_LHBs_P-B Product feature CHAIN AY220697_LHBs_P-B of FT:mat_peptide AY220697_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQLGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY220698_LHBs_P-B Product feature CHAIN AY220698_LHBs_P-B of FT:mat_peptide AY220698_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQLGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY220703_LHBs_P-B Product feature CHAIN AY220703_LHBs_P-B of FT:mat_peptide AY220703_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPEANKVGVGTFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMKWNSTTFHQTLQDPRVRALYLPAGGSSSEIVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AY220704_LHBs_P-B Product feature CHAIN AY220704_LHBs_P-B of FT:mat_peptide AY220704_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYLPAGGSSSEIVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY293309_LHBs_P-B Product feature CHAIN AY293309_LHBs_P-B of FT:mat_peptide AY293309_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLRWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY518556_LHBs_P-B Product feature CHAIN AY518556_LHBs_P-B of FT:mat_peptide AY518556_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596102_LHBs_P-B Product feature CHAIN AY596102_LHBs_P-B of FT:mat_peptide AY596102_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596103_LHBs_P-B Product feature CHAIN AY596103_LHBs_P-B of FT:mat_peptide AY596103_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596104_LHBs_P-B Product feature CHAIN AY596104_LHBs_P-B of FT:mat_peptide AY596104_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKDNWPDANKVGAGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY596105_LHBs_P-B Product feature CHAIN AY596105_LHBs_P-B of FT:mat_peptide AY596105_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFRPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596106_LHBs_P-B Product feature CHAIN AY596106_LHBs_P-B of FT:mat_peptide AY596106_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMVTNLSVRNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596109_LHBs_P-B Product feature CHAIN AY596109_LHBs_P-B of FT:mat_peptide AY596109_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596110_LHBs_P-B Product feature CHAIN AY596110_LHBs_P-B of FT:mat_peptide AY596110_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDSNKVGIGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596112_LHBs_P-B Product feature CHAIN AY596112_LHBs_P-B of FT:mat_peptide AY596112_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWTDANKVGVGAFGPGVTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY766463_LHBs_P-B Product feature CHAIN AY766463_LHBs_P-B of FT:mat_peptide AY766463_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPQKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSPWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800389_LHBs_P-B Product feature CHAIN AY800389_LHBs_P-B of FT:mat_peptide AY800389_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800391_LHBs_P-B Product feature CHAIN AY800391_LHBs_P-B of FT:mat_peptide AY800391_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASS
KSSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800392_LHBs_P-B Product feature CHAIN AY800392_LHBs_P-B of FT:mat_peptide AY800392_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASS
KSSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|D00329_LHBs_P-B Product feature CHAIN D00329_LHBs_P-B of FT:mat_peptide D00329_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D00330_LHBs_P-B Product feature CHAIN D00330_LHBs_P-B of FT:mat_peptide D00330_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPGVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D00331_LHBs_C-B Product feature CHAIN D00331_LHBs_C-B of FT:mat_peptide D00331_LHBs_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPLSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D23678_LHBs_P-B Product feature CHAIN D23678_LHBs_P-B of FT:mat_peptide D23678_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVTNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D23679_LHBs_P-B Product feature CHAIN D23679_LHBs_P-B of FT:mat_peptide D23679_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSATFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D50521_LHBs_P-B Product feature CHAIN D50521_LHBs_P-B of FT:mat_peptide D50521_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGPCKTCTTPARNTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWAYI
>gnl|hbvpro|D50522_LHBs_P-B Product feature CHAIN D50522_LHBs_P-B of FT:mat_peptide D50522_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ377158_LHBs_P-B Product feature CHAIN DQ377158_LHBs_P-B of FT:mat_peptide DQ377158_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448619_LHBs_P-B Product feature CHAIN DQ448619_LHBs_P-B of FT:mat_peptide DQ448619_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448620_LHBs_P-B Product feature CHAIN DQ448620_LHBs_P-B of FT:mat_peptide DQ448620_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448621_LHBs_P-B Product feature CHAIN DQ448621_LHBs_P-B of FT:mat_peptide DQ448621_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448622_LHBs_P-B Product feature CHAIN DQ448622_LHBs_P-B of FT:mat_peptide DQ448622_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDSVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448623_LHBs_P-B Product feature CHAIN DQ448623_LHBs_P-B of FT:mat_peptide DQ448623_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448624_LHBs_P-B Product feature CHAIN DQ448624_LHBs_P-B of FT:mat_peptide DQ448624_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448625_LHBs_P-B Product feature CHAIN DQ448625_LHBs_P-B of FT:mat_peptide DQ448625_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGVWPSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNFTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448626_LHBs_P-B Product feature CHAIN DQ448626_LHBs_P-B of FT:mat_peptide DQ448626_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTNVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448627_LHBs_P-B Product feature CHAIN DQ448627_LHBs_P-B of FT:mat_peptide DQ448627_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448628_LHBs_P-B Product feature CHAIN DQ448628_LHBs_P-B of FT:mat_peptide DQ448628_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463787_LHBs_P-B Product feature CHAIN DQ463787_LHBs_P-B of FT:mat_peptide DQ463787_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQFQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ463788_LHBs_P-B Product feature CHAIN DQ463788_LHBs_P-B of FT:mat_peptide DQ463788_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463789_LHBs_P-B Product feature CHAIN DQ463789_LHBs_P-B of FT:mat_peptide DQ463789_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463790_LHBs_P-B Product feature CHAIN DQ463790_LHBs_P-B of FT:mat_peptide DQ463790_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRKVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLILLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463791_LHBs_P-B Product feature CHAIN DQ463791_LHBs_P-B of FT:mat_peptide DQ463791_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCPGQNSQSQICSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWSWGPNLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463792_LHBs_P-B Product feature CHAIN DQ463792_LHBs_P-B of FT:mat_peptide DQ463792_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463793_LHBs_P-B Product feature CHAIN DQ463793_LHBs_P-B of FT:mat_peptide DQ463793_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASANRQVGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASP
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463794_LHBs_P-B Product feature CHAIN DQ463794_LHBs_P-B of FT:mat_peptide DQ463794_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEPPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463795_LHBs_P-B Product feature CHAIN DQ463795_LHBs_P-B of FT:mat_peptide DQ463795_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGGTPECLGQNSQFQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCNTLSRFVPLFPIFFCLWVYI
>gnl|hbvpro|DQ463796_LHBs_P-B Product feature CHAIN DQ463796_LHBs_P-B of FT:mat_peptide DQ463796_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPATPPPASTNRQVGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYHWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463797_LHBs_P-B Product feature CHAIN DQ463797_LHBs_P-B of FT:mat_peptide DQ463797_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLYLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLRNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463798_LHBs_P-B Product feature CHAIN DQ463798_LHBs_P-B of FT:mat_peptide DQ463798_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHNDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463799_LHBs_P-B Product feature CHAIN DQ463799_LHBs_P-B of FT:mat_peptide DQ463799_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463800_LHBs_P-B Product feature CHAIN DQ463800_LHBs_P-B of FT:mat_peptide DQ463800_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463801_LHBs_P-B Product feature CHAIN DQ463801_LHBs_P-B of FT:mat_peptide DQ463801_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASANRQVGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASP
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463802_LHBs_P-B Product feature CHAIN DQ463802_LHBs_P-B of FT:mat_peptide DQ463802_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDSTVRTLNLPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCHIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ904357_LHBs_P-B Product feature CHAIN DQ904357_LHBs_P-B of FT:mat_peptide DQ904357_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLRFFPDHQLDPAFKANSENPDWDLNPHKDSWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993680_LHBs_P-B Product feature CHAIN DQ993680_LHBs_P-B of FT:mat_peptide DQ993680_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993681_LHBs_P-B Product feature CHAIN DQ993681_LHBs_P-B of FT:mat_peptide DQ993681_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|DQ993682_LHBs_P-B Product feature CHAIN DQ993682_LHBs_P-B of FT:mat_peptide DQ993682_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 479). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993683_LHBs_P-B Product feature CHAIN DQ993683_LHBs_P-B of FT:mat_peptide DQ993683_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993684_LHBs_P-B Product feature CHAIN DQ993684_LHBs_P-B of FT:mat_peptide DQ993684_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPLASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLQGPLLVLQAGFFLLTKSLTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PDCPGYPRMCLRGFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993685_LHBs_P-B Product feature CHAIN DQ993685_LHBs_P-B of FT:mat_peptide DQ993685_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993686_LHBs_P-B Product feature CHAIN DQ993686_LHBs_P-B of FT:mat_peptide DQ993686_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCPGQNSQSQIFSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARNPSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993687_LHBs_P-B Product feature CHAIN DQ993687_LHBs_P-B of FT:mat_peptide DQ993687_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAXXTASA
ISXTFXKTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQXLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIRIPSSWAFAKYLWEWASVRFSWLSLLLPFVQWFVRLSPTVWFSVIWMMWNWGPSLYKIGSPFMPLLPIFFCXXXFI
>gnl|hbvpro|DQ993696_LHBs_P-B Product feature CHAIN DQ993696_LHBs_P-B of FT:mat_peptide DQ993696_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLNFLVGAPVCLDQNSQSPISSHSPTCCP
PICPDYPWMCLRRFIIFLCILLLCLIFLMVLLDYQGMLPVCPLIPGSSTTSTGPWNTCTAPAQGTSMFPSCCCTKPTDGN
CACIPVPSSWAFPKYLWEWASVRFSWLGLLVPFVQWFVRLSPLVWLSVIWMMWYWGPSLYNILSPFMPLLPXFFCLWVYI
>gnl|hbvpro|DQ993697_LHBs_P-B Product feature CHAIN DQ993697_LHBs_P-B of FT:mat_peptide DQ993697_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993698_LHBs_P-B Product feature CHAIN DQ993698_LHBs_P-B of FT:mat_peptide DQ993698_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRSCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993699_LHBs_P-B Product feature CHAIN DQ993699_LHBs_P-B of FT:mat_peptide DQ993699_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRSCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993700_LHBs_P-B Product feature CHAIN DQ993700_LHBs_P-B of FT:mat_peptide DQ993700_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVQFVQWFVGLSPTVWLSVMWKMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993701_LHBs_P-B Product feature CHAIN DQ993701_LHBs_P-B of FT:mat_peptide DQ993701_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ993702_LHBs_P-B Product feature CHAIN DQ993702_LHBs_P-B of FT:mat_peptide DQ993702_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMEWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRSFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSTTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFLCLWVYL
>gnl|hbvpro|DQ993703_LHBs_P-B Product feature CHAIN DQ993703_LHBs_P-B of FT:mat_peptide DQ993703_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993704_LHBs_P-B Product feature CHAIN DQ993704_LHBs_P-B of FT:mat_peptide DQ993704_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993705_LHBs_P-B Product feature CHAIN DQ993705_LHBs_P-B of FT:mat_peptide DQ993705_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSHISSHSPTCCP
PICPGYRWMCLPRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993706_LHBs_P-B Product feature CHAIN DQ993706_LHBs_P-B of FT:mat_peptide DQ993706_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993707_LHBs_P-B Product feature CHAIN DQ993707_LHBs_P-B of FT:mat_peptide DQ993707_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993708_LHBs_P-B Product feature CHAIN DQ993708_LHBs_P-B of FT:mat_peptide DQ993708_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=400 residues).
MKGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLSPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWNPQ
AQGLLPTVPAAPPPASTNRQSERQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993709_LHBs_P-B Product feature CHAIN DQ993709_LHBs_P-B of FT:mat_peptide DQ993709_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVKALYFPAGGSSSGTVSPAQNTVSP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993710_LHBs_P-B Product feature CHAIN DQ993710_LHBs_P-B of FT:mat_peptide DQ993710_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ995801_LHBs_P-B Product feature CHAIN DQ995801_LHBs_P-B of FT:mat_peptide DQ995801_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMSLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCAKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995802_LHBs_P-B Product feature CHAIN DQ995802_LHBs_P-B of FT:mat_peptide DQ995802_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNTHKDNWPEANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLRAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLGQNSQSPISSHSPTCCP
PICPGYRRMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGISMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995804_LHBs_P-B Product feature CHAIN DQ995804_LHBs_P-B of FT:mat_peptide DQ995804_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGGSPQ
AQGIFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQATQWNSTKFHQTLQDPRVRALYIPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLGFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLLILFCLWVYI
>gnl|hbvpro|EF134945_LHBs_P-B Product feature CHAIN EF134945_LHBs_P-B of FT:mat_peptide EF134945_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQRTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF134946_LHBs_P-B Product feature CHAIN EF134946_LHBs_P-B of FT:mat_peptide EF134946_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQRTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473971_LHBs_P-B Product feature CHAIN EF473971_LHBs_P-B of FT:mat_peptide EF473971_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473972_LHBs_P-B Product feature CHAIN EF473972_LHBs_P-B of FT:mat_peptide EF473972_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVNPVQNTVSS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473973_LHBs_P-B Product feature CHAIN EF473973_LHBs_P-B of FT:mat_peptide EF473973_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473974_LHBs_P-B Product feature CHAIN EF473974_LHBs_P-B of FT:mat_peptide EF473974_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQVILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPEGLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473975_LHBs_P-B Product feature CHAIN EF473975_LHBs_P-B of FT:mat_peptide EF473975_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVIPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473976_LHBs_P-B Product feature CHAIN EF473976_LHBs_P-B of FT:mat_peptide EF473976_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRPGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLKDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIESGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRSFIIFLCILLLCLMFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473977_LHBs_P-B Product feature CHAIN EF473977_LHBs_P-B of FT:mat_peptide EF473977_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRPGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494380_LHBs_P-B Product feature CHAIN EF494380_LHBs_P-B of FT:mat_peptide EF494380_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWSSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CACIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494381_LHBs_P-B Product feature CHAIN EF494381_LHBs_P-B of FT:mat_peptide EF494381_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKDTWPDANEVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPVSPPLRETHPQVIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLICLLGLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494382_LHBs_P-B Product feature CHAIN EF494382_LHBs_P-B of FT:mat_peptide EF494382_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=395 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKDNWPDANKVGAGAFGPGFVPPHGGLLGWSPQ
AQGILTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTL
SKTGDPVPNMENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPG
YRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTGTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIP
IPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU139543_LHBs_P-B Product feature CHAIN EU139543_LHBs_P-B of FT:mat_peptide EU139543_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU158262_LHBs_P-B Product feature CHAIN EU158262_LHBs_P-B of FT:mat_peptide EU158262_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G116). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU158263_LHBs_P-B Product feature CHAIN EU158263_LHBs_P-B of FT:mat_peptide EU158263_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPEANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU305547_LHBs_P-B Product feature CHAIN EU305547_LHBs_P-B of FT:mat_peptide EU305547_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKDNWPDANKVGVGEFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSGSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCAKPTNGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFRLWVYI
>gnl|hbvpro|EU305548_LHBs_P-B Product feature CHAIN EU305548_LHBs_P-B of FT:mat_peptide EU305548_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSIGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306678_LHBs_P-B Product feature CHAIN EU306678_LHBs_P-B of FT:mat_peptide EU306678_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306679_LHBs_P-B Product feature CHAIN EU306679_LHBs_P-B of FT:mat_peptide EU306679_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYV
>gnl|hbvpro|EU306680_LHBs_P-B Product feature CHAIN EU306680_LHBs_P-B of FT:mat_peptide EU306680_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYV
>gnl|hbvpro|EU306681_LHBs_P-B Product feature CHAIN EU306681_LHBs_P-B of FT:mat_peptide EU306681_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306695_LHBs_P-B Product feature CHAIN EU306695_LHBs_P-B of FT:mat_peptide EU306695_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306696_LHBs_P-B Product feature CHAIN EU306696_LHBs_P-B of FT:mat_peptide EU306696_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWERASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306697_LHBs_P-B Product feature CHAIN EU306697_LHBs_P-B of FT:mat_peptide EU306697_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306698_LHBs_P-B Product feature CHAIN EU306698_LHBs_P-B of FT:mat_peptide EU306698_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306699_LHBs_P-B Product feature CHAIN EU306699_LHBs_P-B of FT:mat_peptide EU306699_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTSTTLAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLGLLVPFVQWFVGLSPTVWLPVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306700_LHBs_P-B Product feature CHAIN EU306700_LHBs_P-B of FT:mat_peptide EU306700_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306701_LHBs_P-B Product feature CHAIN EU306701_LHBs_P-B of FT:mat_peptide EU306701_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306702_LHBs_P-B Product feature CHAIN EU306702_LHBs_P-B of FT:mat_peptide EU306702_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306703_LHBs_P-B Product feature CHAIN EU306703_LHBs_P-B of FT:mat_peptide EU306703_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWLCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306704_LHBs_P-B Product feature CHAIN EU306704_LHBs_P-B of FT:mat_peptide EU306704_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTSLSVPNPLGFFPDHQLDPAFEANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTAPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKCLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306705_LHBs_P-B Product feature CHAIN EU306705_LHBs_P-B of FT:mat_peptide EU306705_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPAVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306706_LHBs_P-B Product feature CHAIN EU306706_LHBs_P-B of FT:mat_peptide EU306706_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306707_LHBs_P-B Product feature CHAIN EU306707_LHBs_P-B of FT:mat_peptide EU306707_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKCLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306708_LHBs_P-B Product feature CHAIN EU306708_LHBs_P-B of FT:mat_peptide EU306708_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306709_LHBs_P-B Product feature CHAIN EU306709_LHBs_P-B of FT:mat_peptide EU306709_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306710_LHBs_P-B Product feature CHAIN EU306710_LHBs_P-B of FT:mat_peptide EU306710_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSNSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306711_LHBs_P-B Product feature CHAIN EU306711_LHBs_P-B of FT:mat_peptide EU306711_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDPNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSITFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHLPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306712_LHBs_P-B Product feature CHAIN EU306712_LHBs_P-B of FT:mat_peptide EU306712_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU330989_LHBs_P-B Product feature CHAIN EU330989_LHBs_P-B of FT:mat_peptide EU330989_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPTAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSATSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKHLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330990_LHBs_P-B Product feature CHAIN EU330990_LHBs_P-B of FT:mat_peptide EU330990_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPTAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSATSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKHLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330994_LHBs_P-B Product feature CHAIN EU330994_LHBs_P-B of FT:mat_peptide EU330994_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAVPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISGHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVRLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330995_LHBs_P-B Product feature CHAIN EU330995_LHBs_P-B of FT:mat_peptide EU330995_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|EU330996_LHBs_P-B Product feature CHAIN EU330996_LHBs_P-B of FT:mat_peptide EU330996_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330997_LHBs_P-B Product feature CHAIN EU330997_LHBs_P-B of FT:mat_peptide EU330997_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330998_LHBs_P-B Product feature CHAIN EU330998_LHBs_P-B of FT:mat_peptide EU330998_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGCRWMCLRLFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330999_LHBs_P-B Product feature CHAIN EU330999_LHBs_P-B of FT:mat_peptide EU330999_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGCRWMCLRLFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU331000_LHBs_P-B Product feature CHAIN EU331000_LHBs_P-B of FT:mat_peptide EU331000_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGCRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU331001_LHBs_P-B Product feature CHAIN EU331001_LHBs_P-B of FT:mat_peptide EU331001_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGCRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU350409_LHBs_P-B Product feature CHAIN EU350409_LHBs_P-B of FT:mat_peptide EU350409_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDCDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439018_LHBs_P-B Product feature CHAIN EU439018_LHBs_P-B of FT:mat_peptide EU439018_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439020_LHBs_P-B Product feature CHAIN EU439020_LHBs_P-B of FT:mat_peptide EU439020_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVEVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTAPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439022_LHBs_P-B Product feature CHAIN EU439022_LHBs_P-B of FT:mat_peptide EU439022_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
RTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439023_LHBs_P-B Product feature CHAIN EU439023_LHBs_P-B of FT:mat_peptide EU439023_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLEFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTPQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGPSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU487256_LHBs_P-B Product feature CHAIN EU487256_LHBs_P-B of FT:mat_peptide EU487256_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGVTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIQLLPIFFCLWVYI
>gnl|hbvpro|EU487257_LHBs_P-B Product feature CHAIN EU487257_LHBs_P-B of FT:mat_peptide EU487257_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU522067_LHBs_P-B Product feature CHAIN EU522067_LHBs_P-B of FT:mat_peptide EU522067_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU522072_LHBs_P-B Product feature CHAIN EU522072_LHBs_P-B of FT:mat_peptide EU522072_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQVDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRNTHPQIMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|EU522074_LHBs_P-B Product feature CHAIN EU522074_LHBs_P-B of FT:mat_peptide EU522074_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQVDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU547563_LHBs_P-B Product feature CHAIN EU547563_LHBs_P-B of FT:mat_peptide EU547563_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNATTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564822_LHBs_P-B Product feature CHAIN EU564822_LHBs_P-B of FT:mat_peptide EU564822_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPSAPPPASTNRQSGRQPTPLTPPLRETHPQAMQWNATTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564823_LHBs_P-B Product feature CHAIN EU564823_LHBs_P-B of FT:mat_peptide EU564823_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPSAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564824_LHBs_P-B Product feature CHAIN EU564824_LHBs_P-B of FT:mat_peptide EU564824_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPSAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMLLLPIFFCLWVYI
>gnl|hbvpro|EU564826_LHBs_P-B Product feature CHAIN EU564826_LHBs_P-B of FT:mat_peptide EU564826_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGRSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALNFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570070_LHBs_P-B Product feature CHAIN EU570070_LHBs_P-B of FT:mat_peptide EU570070_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570071_LHBs_P-B Product feature CHAIN EU570071_LHBs_P-B of FT:mat_peptide EU570071_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570075_LHBs_P-B Product feature CHAIN EU570075_LHBs_P-B of FT:mat_peptide EU570075_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPREGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKDNWPDANKAGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPACLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU579441_LHBs_P-B Product feature CHAIN EU579441_LHBs_P-B of FT:mat_peptide EU579441_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPREGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSPNFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|EU589335_LHBs_P-B Product feature CHAIN EU589335_LHBs_P-B of FT:mat_peptide EU589335_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|EU595031_LHBs_P-B Product feature CHAIN EU595031_LHBs_P-B of FT:mat_peptide EU595031_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVILMMWFWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|EU796066_LHBs_P-B Product feature CHAIN EU796066_LHBs_P-B of FT:mat_peptide EU796066_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU796067_LHBs_P-B Product feature CHAIN EU796067_LHBs_P-B of FT:mat_peptide EU796067_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILLETGDPVPNMENIASGLLGPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU796068_LHBs_P-B Product feature CHAIN EU796068_LHBs_P-B of FT:mat_peptide EU796068_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQSDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMVNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU881997_LHBs_P-B Product feature CHAIN EU881997_LHBs_P-B of FT:mat_peptide EU881997_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPAATNRQSGRQPTPLSPPLRDTHPQAMQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCRGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU881998_LHBs_P-B Product feature CHAIN EU881998_LHBs_P-B of FT:mat_peptide EU881998_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPAATNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU882002_LHBs_P-B Product feature CHAIN EU882002_LHBs_P-B of FT:mat_peptide EU882002_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU882003_LHBs_P-B Product feature CHAIN EU882003_LHBs_P-B of FT:mat_peptide EU882003_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Non-functional genomic sequence. [Hepadnaviridae] (length=397 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDPWPDAWKVGRGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGNSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTC
IPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPSLYNILSPFMPLLPIFYCLWVYI
>gnl|hbvpro|EU882004_LHBs_P-B Product feature CHAIN EU882004_LHBs_P-B of FT:mat_peptide EU882004_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDPWPDAWKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFAQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|EU919171_LHBs_P-B Product feature CHAIN EU919171_LHBs_P-B of FT:mat_peptide EU919171_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRRPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919172_LHBs_P-B Product feature CHAIN EU919172_LHBs_P-B of FT:mat_peptide EU919172_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSPTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAQFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919173_LHBs_P-B Product feature CHAIN EU919173_LHBs_P-B of FT:mat_peptide EU919173_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919175_LHBs_P-B Product feature CHAIN EU919175_LHBs_P-B of FT:mat_peptide EU919175_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPIRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919176_LHBs_P-B Product feature CHAIN EU919176_LHBs_P-B of FT:mat_peptide EU919176_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939559_LHBs_P-B Product feature CHAIN EU939559_LHBs_P-B of FT:mat_peptide EU939559_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939633_LHBs_P-B Product feature CHAIN EU939633_LHBs_P-B of FT:mat_peptide EU939633_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGGSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVKWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFGLWVYM
>gnl|hbvpro|EU939634_LHBs_P-B Product feature CHAIN EU939634_LHBs_P-B of FT:mat_peptide EU939634_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGGSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVKWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFXLWVYM
>gnl|hbvpro|EU939635_LHBs_P-B Product feature CHAIN EU939635_LHBs_P-B of FT:mat_peptide EU939635_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B125). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=400 residues).
MGGRSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLVTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGYFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPKLYSILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939636_LHBs_P-B Product feature CHAIN EU939636_LHBs_P-B of FT:mat_peptide EU939636_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939637_LHBs_P-B Product feature CHAIN EU939637_LHBs_P-B of FT:mat_peptide EU939637_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKVCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYDILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939638_LHBs_P-B Product feature CHAIN EU939638_LHBs_P-B of FT:mat_peptide EU939638_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939639_LHBs_P-B Product feature CHAIN EU939639_LHBs_P-B of FT:mat_peptide EU939639_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939661_LHBs_P-B Product feature CHAIN EU939661_LHBs_P-B of FT:mat_peptide EU939661_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWTDSNKVGVGAFGPGFTPPHGGLLGWSPQ
ALGILTAVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939663_LHBs_P-B Product feature CHAIN EU939663_LHBs_P-B of FT:mat_peptide EU939663_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGSFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939664_LHBs_P-B Product feature CHAIN EU939664_LHBs_P-B of FT:mat_peptide EU939664_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENITSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939665_LHBs_P-B Product feature CHAIN EU939665_LHBs_P-B of FT:mat_peptide EU939665_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQPGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSX
ISSILXKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939666_LHBs_P-B Product feature CHAIN EU939666_LHBs_P-B of FT:mat_peptide EU939666_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDLRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939667_LHBs_P-B Product feature CHAIN EU939667_LHBs_P-B of FT:mat_peptide EU939667_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQSTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939669_LHBs_P-B Product feature CHAIN EU939669_LHBs_P-B of FT:mat_peptide EU939669_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939670_LHBs_P-B Product feature CHAIN EU939670_LHBs_P-B of FT:mat_peptide EU939670_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYIPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939671_LHBs_P-B Product feature CHAIN EU939671_LHBs_P-B of FT:mat_peptide EU939671_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C201). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSTTFLQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLTPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939672_LHBs_P-B Product feature CHAIN EU939672_LHBs_P-B of FT:mat_peptide EU939672_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939673_LHBs_P-B Product feature CHAIN EU939673_LHBs_P-B of FT:mat_peptide EU939673_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939674_LHBs_P-B Product feature CHAIN EU939674_LHBs_P-B of FT:mat_peptide EU939674_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|EU939675_LHBs_P-B Product feature CHAIN EU939675_LHBs_P-B of FT:mat_peptide EU939675_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939676_LHBs_P-B Product feature CHAIN EU939676_LHBs_P-B of FT:mat_peptide EU939676_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939677_LHBs_P-B Product feature CHAIN EU939677_LHBs_P-B of FT:mat_peptide EU939677_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939678_LHBs_P-B Product feature CHAIN EU939678_LHBs_P-B of FT:mat_peptide EU939678_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSIFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFLCLWAYI
>gnl|hbvpro|FJ023631_LHBs_P-B Product feature CHAIN FJ023631_LHBs_P-B of FT:mat_peptide FJ023631_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRETHPQAMQWNSTTFHRALQTPKVRALYFPAGGSSSGTVSPAQNTVSP
ISSNSSTTGVPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPFIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLFPIFLCLWVYI
>gnl|hbvpro|FJ023632_LHBs_P-B Product feature CHAIN FJ023632_LHBs_P-B of FT:mat_peptide FJ023632_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPL
AQGILTTVPAAPPPASTNRQSGRQPTPFSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023633_LHBs_P-B Product feature CHAIN FJ023633_LHBs_P-B of FT:mat_peptide FJ023633_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023634_LHBs_P-B Product feature CHAIN FJ023634_LHBs_P-B of FT:mat_peptide FJ023634_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023635_LHBs_P-B Product feature CHAIN FJ023635_LHBs_P-B of FT:mat_peptide FJ023635_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFLKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023636_LHBs_P-B Product feature CHAIN FJ023636_LHBs_P-B of FT:mat_peptide FJ023636_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPL
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023637_LHBs_P-B Product feature CHAIN FJ023637_LHBs_P-B of FT:mat_peptide FJ023637_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTXPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTLNPVQNTASS
ISSILSKTGDPAPNMENIXSXLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023638_LHBs_P-B Product feature CHAIN FJ023638_LHBs_P-B of FT:mat_peptide FJ023638_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ032342_LHBs_P-B Product feature CHAIN FJ032342_LHBs_P-B of FT:mat_peptide FJ032342_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDRNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQSIFTTVPAAPPPASTNRQLGRQPTPVTPPLRDTHPQATQWNSTTFHQTLQDPRVRALYFPAGGSSSGTLSPAQNTVST
TSSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSSLPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|FJ032344_LHBs_P-B Product feature CHAIN FJ032344_LHBs_P-B of FT:mat_peptide FJ032344_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPREGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKDNWPDANKAGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSSLPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|FJ032349_LHBs_P-B Product feature CHAIN FJ032349_LHBs_P-B of FT:mat_peptide FJ032349_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSSTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSRCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032352_LHBs_P-B Product feature CHAIN FJ032352_LHBs_P-B of FT:mat_peptide FJ032352_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032353_LHBs_P-B Product feature CHAIN FJ032353_LHBs_P-B of FT:mat_peptide FJ032353_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTLPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032354_LHBs_P-B Product feature CHAIN FJ032354_LHBs_P-B of FT:mat_peptide FJ032354_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032357_LHBs_P-B Product feature CHAIN FJ032357_LHBs_P-B of FT:mat_peptide FJ032357_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|FJ032358_LHBs_P-B Product feature CHAIN FJ032358_LHBs_P-B of FT:mat_peptide FJ032358_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLAKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMWPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|FJ349236_LHBs_P-B Product feature CHAIN FJ349236_LHBs_P-B of FT:mat_peptide FJ349236_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPL
AQGILTTVPAAPPSASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386582_LHBs_P-B Product feature CHAIN FJ386582_LHBs_P-B of FT:mat_peptide FJ386582_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386583_LHBs_P-B Product feature CHAIN FJ386583_LHBs_P-B of FT:mat_peptide FJ386583_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386584_LHBs_P-B Product feature CHAIN FJ386584_LHBs_P-B of FT:mat_peptide FJ386584_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386600_LHBs_P-B Product feature CHAIN FJ386600_LHBs_P-B of FT:mat_peptide FJ386600_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386608_LHBs_P-B Product feature CHAIN FJ386608_LHBs_P-B of FT:mat_peptide FJ386608_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPFSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVILMMWFWGPSLYNIVRPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ386610_LHBs_P-B Product feature CHAIN FJ386610_LHBs_P-B of FT:mat_peptide FJ386610_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDSWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRKSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386615_LHBs_P-B Product feature CHAIN FJ386615_LHBs_P-B of FT:mat_peptide FJ386615_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGMLGWSPQ
AQGLLTTVPAAPPPASTNRQAGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386634_LHBs_P-B Product feature CHAIN FJ386634_LHBs_P-B of FT:mat_peptide FJ386634_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQNPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386636_LHBs_P-B Product feature CHAIN FJ386636_LHBs_P-B of FT:mat_peptide FJ386636_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSANFHQTLQDPRVRALYFPAGGSSLGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386642_LHBs_P-B Product feature CHAIN FJ386642_LHBs_P-B of FT:mat_peptide FJ386642_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386648_LHBs_P-B Product feature CHAIN FJ386648_LHBs_P-B of FT:mat_peptide FJ386648_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFARYLWEWASIRFSSLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386654_LHBs_P-B Product feature CHAIN FJ386654_LHBs_P-B of FT:mat_peptide FJ386654_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386655_LHBs_P-B Product feature CHAIN FJ386655_LHBs_P-B of FT:mat_peptide FJ386655_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386656_LHBs_P-B Product feature CHAIN FJ386656_LHBs_P-B of FT:mat_peptide FJ386656_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|FJ386658_LHBs_P-B Product feature CHAIN FJ386658_LHBs_P-B of FT:mat_peptide FJ386658_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386660_LHBs_P-B Product feature CHAIN FJ386660_LHBs_P-B of FT:mat_peptide FJ386660_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386666_LHBs_P-B Product feature CHAIN FJ386666_LHBs_P-B of FT:mat_peptide FJ386666_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386668_LHBs_P-B Product feature CHAIN FJ386668_LHBs_P-B of FT:mat_peptide FJ386668_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386669_LHBs_P-B Product feature CHAIN FJ386669_LHBs_P-B of FT:mat_peptide FJ386669_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPFSPPLRDTHPQAMTRNSTTFHQTLQDPRVRALYFPVGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386675_LHBs_P-B Product feature CHAIN FJ386675_LHBs_P-B of FT:mat_peptide FJ386675_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGXGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKIGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386676_LHBs_P-B Product feature CHAIN FJ386676_LHBs_P-B of FT:mat_peptide FJ386676_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMFPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386680_LHBs_P-B Product feature CHAIN FJ386680_LHBs_P-B of FT:mat_peptide FJ386680_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1244). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386681_LHBs_P-B Product feature CHAIN FJ386681_LHBs_P-B of FT:mat_peptide FJ386681_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGSFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386682_LHBs_P-B Product feature CHAIN FJ386682_LHBs_P-B of FT:mat_peptide FJ386682_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLAPPLSDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386683_LHBs_P-B Product feature CHAIN FJ386683_LHBs_P-B of FT:mat_peptide FJ386683_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWTSTTVHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386684_LHBs_P-B Product feature CHAIN FJ386684_LHBs_P-B of FT:mat_peptide FJ386684_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDSWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386688_LHBs_P-B Product feature CHAIN FJ386688_LHBs_P-B of FT:mat_peptide FJ386688_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGMLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPSPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ518812_LHBs_P-B Product feature CHAIN FJ518812_LHBs_P-B of FT:mat_peptide FJ518812_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSCLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562219_LHBs_P-B Product feature CHAIN FJ562219_LHBs_P-B of FT:mat_peptide FJ562219_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSSFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562222_LHBs_P-B Product feature CHAIN FJ562222_LHBs_P-B of FT:mat_peptide FJ562222_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562224_LHBs_P-B Product feature CHAIN FJ562224_LHBs_P-B of FT:mat_peptide FJ562224_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562231_LHBs_P-B Product feature CHAIN FJ562231_LHBs_P-B of FT:mat_peptide FJ562231_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASINRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDRN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562234_LHBs_P-B Product feature CHAIN FJ562234_LHBs_P-B of FT:mat_peptide FJ562234_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFSSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562236_LHBs_P-B Product feature CHAIN FJ562236_LHBs_P-B of FT:mat_peptide FJ562236_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ562237_LHBs_P-B Product feature CHAIN FJ562237_LHBs_P-B of FT:mat_peptide FJ562237_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562240_LHBs_P-B Product feature CHAIN FJ562240_LHBs_P-B of FT:mat_peptide FJ562240_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562246_LHBs_P-B Product feature CHAIN FJ562246_LHBs_P-B of FT:mat_peptide FJ562246_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562253_LHBs_P-B Product feature CHAIN FJ562253_LHBs_P-B of FT:mat_peptide FJ562253_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPATPPPASTNRKSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFSLLIKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562254_LHBs_P-B Product feature CHAIN FJ562254_LHBs_P-B of FT:mat_peptide FJ562254_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562257_LHBs_P-B Product feature CHAIN FJ562257_LHBs_P-B of FT:mat_peptide FJ562257_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSIGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562259_LHBs_P-B Product feature CHAIN FJ562259_LHBs_P-B of FT:mat_peptide FJ562259_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHLTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562260_LHBs_P-B Product feature CHAIN FJ562260_LHBs_P-B of FT:mat_peptide FJ562260_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLVGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSP
XSSTLSTTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562289_LHBs_P-B Product feature CHAIN FJ562289_LHBs_P-B of FT:mat_peptide FJ562289_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562296_LHBs_P-B Product feature CHAIN FJ562296_LHBs_P-B of FT:mat_peptide FJ562296_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPKLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562303_LHBs_P-B Product feature CHAIN FJ562303_LHBs_P-B of FT:mat_peptide FJ562303_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASPNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562311_LHBs_P-B Product feature CHAIN FJ562311_LHBs_P-B of FT:mat_peptide FJ562311_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFXQTLQBPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562312_LHBs_P-B Product feature CHAIN FJ562312_LHBs_P-B of FT:mat_peptide FJ562312_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562316_LHBs_P-B Product feature CHAIN FJ562316_LHBs_P-B of FT:mat_peptide FJ562316_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRTGMGTNLSVPNPLGFFPDHHLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGMLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQSLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562321_LHBs_P-B Product feature CHAIN FJ562321_LHBs_P-B of FT:mat_peptide FJ562321_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I214). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562322_LHBs_P-B Product feature CHAIN FJ562322_LHBs_P-B of FT:mat_peptide FJ562322_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787444_LHBs_P-B Product feature CHAIN FJ787444_LHBs_P-B of FT:mat_peptide FJ787444_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANPENPDWDLNPHKDNWPDANKVGGGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787475_LHBs_P-B Product feature CHAIN FJ787475_LHBs_P-B of FT:mat_peptide FJ787475_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWVWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPYMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787477_LHBs_P-B Product feature CHAIN FJ787477_LHBs_P-B of FT:mat_peptide FJ787477_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDPWPDAWKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
QICPGYRLMCLRRFIILLCILLLCLIFLLVLLDYQGMLLVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ899779_LHBs_P-B Product feature CHAIN FJ899779_LHBs_P-B of FT:mat_peptide FJ899779_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRLIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ899784_LHBs_P-B Product feature CHAIN FJ899784_LHBs_P-B of FT:mat_peptide FJ899784_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899785_LHBs_P-B Product feature CHAIN FJ899785_LHBs_P-B of FT:mat_peptide FJ899785_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899786_LHBs_P-B Product feature CHAIN FJ899786_LHBs_P-B of FT:mat_peptide FJ899786_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899787_LHBs_P-B Product feature CHAIN FJ899787_LHBs_P-B of FT:mat_peptide FJ899787_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDPNPHKDTWPDANKVGVGAFGLGFTPSHGGLLGWSPQ
AQGLLTTVPAAPPPASTNQQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899790_LHBs_P-B Product feature CHAIN FJ899790_LHBs_P-B of FT:mat_peptide FJ899790_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ899791_LHBs_P-B Product feature CHAIN FJ899791_LHBs_P-B of FT:mat_peptide FJ899791_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|GQ358136_LHBs_P-B Product feature CHAIN GQ358136_LHBs_P-B of FT:mat_peptide GQ358136_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358137_LHBs_P-B Product feature CHAIN GQ358137_LHBs_P-B of FT:mat_peptide GQ358137_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISTILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358138_LHBs_P-B Product feature CHAIN GQ358138_LHBs_P-B of FT:mat_peptide GQ358138_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358139_LHBs_P-B Product feature CHAIN GQ358139_LHBs_P-B of FT:mat_peptide GQ358139_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT032). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGMLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLKDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358140_LHBs_P-B Product feature CHAIN GQ358140_LHBs_P-B of FT:mat_peptide GQ358140_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358141_LHBs_P-B Product feature CHAIN GQ358141_LHBs_P-B of FT:mat_peptide GQ358141_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358142_LHBs_P-B Product feature CHAIN GQ358142_LHBs_P-B of FT:mat_peptide GQ358142_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDHPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358143_LHBs_P-B Product feature CHAIN GQ358143_LHBs_P-B of FT:mat_peptide GQ358143_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358144_LHBs_P-B Product feature CHAIN GQ358144_LHBs_P-B of FT:mat_peptide GQ358144_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPNSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSRSGTVNPVQNTASS
ISSTLSKTGDPVPNMENIASRLPRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLRGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLREWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358145_LHBs_P-B Product feature CHAIN GQ358145_LHBs_P-B of FT:mat_peptide GQ358145_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTMPAAPPSASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358146_LHBs_P-B Product feature CHAIN GQ358146_LHBs_P-B of FT:mat_peptide GQ358146_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTMPAAPPSASTNRQLGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSGSGTVNPVQNTASS
ISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358147_LHBs_P-B Product feature CHAIN GQ358147_LHBs_P-B of FT:mat_peptide GQ358147_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTMPAAPPSASTNRQLGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNIASS
ISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358148_LHBs_P-B Product feature CHAIN GQ358148_LHBs_P-B of FT:mat_peptide GQ358148_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGINLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPYKDNWPDSNKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQLGRHPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358149_LHBs_P-B Product feature CHAIN GQ358149_LHBs_P-B of FT:mat_peptide GQ358149_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQLGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358150_LHBs_P-B Product feature CHAIN GQ358150_LHBs_P-B of FT:mat_peptide GQ358150_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQLGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ358151_LHBs_P-B Product feature CHAIN GQ358151_LHBs_P-B of FT:mat_peptide GQ358151_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQLGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358152_LHBs_P-B Product feature CHAIN GQ358152_LHBs_P-B of FT:mat_peptide GQ358152_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGTGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQLGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377519_LHBs_P-B Product feature CHAIN GQ377519_LHBs_P-B of FT:mat_peptide GQ377519_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWIPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSSTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377525_LHBs_P-B Product feature CHAIN GQ377525_LHBs_P-B of FT:mat_peptide GQ377525_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377537_LHBs_P-B Product feature CHAIN GQ377537_LHBs_P-B of FT:mat_peptide GQ377537_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSGLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377542_LHBs_P-B Product feature CHAIN GQ377542_LHBs_P-B of FT:mat_peptide GQ377542_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWNPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377547_LHBs_P-B Product feature CHAIN GQ377547_LHBs_P-B of FT:mat_peptide GQ377547_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377558_LHBs_P-B Product feature CHAIN GQ377558_LHBs_P-B of FT:mat_peptide GQ377558_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377561_LHBs_P-B Product feature CHAIN GQ377561_LHBs_P-B of FT:mat_peptide GQ377561_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377566_LHBs_P-B Product feature CHAIN GQ377566_LHBs_P-B of FT:mat_peptide GQ377566_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377567_LHBs_P-B Product feature CHAIN GQ377567_LHBs_P-B of FT:mat_peptide GQ377567_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTTTGPCKTCTVPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377568_LHBs_P-B Product feature CHAIN GQ377568_LHBs_P-B of FT:mat_peptide GQ377568_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377569_LHBs_P-B Product feature CHAIN GQ377569_LHBs_P-B of FT:mat_peptide GQ377569_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377582_LHBs_P-B Product feature CHAIN GQ377582_LHBs_P-B of FT:mat_peptide GQ377582_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377587_LHBs_P-B Product feature CHAIN GQ377587_LHBs_P-B of FT:mat_peptide GQ377587_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEYPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377588_LHBs_P-B Product feature CHAIN GQ377588_LHBs_P-B of FT:mat_peptide GQ377588_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDIWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377606_LHBs_P-B Product feature CHAIN GQ377606_LHBs_P-B of FT:mat_peptide GQ377606_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIFTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAIQRNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377610_LHBs_P-B Product feature CHAIN GQ377610_LHBs_P-B of FT:mat_peptide GQ377610_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ377612_LHBs_P-B Product feature CHAIN GQ377612_LHBs_P-B of FT:mat_peptide GQ377612_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377622_LHBs_P-B Product feature CHAIN GQ377622_LHBs_P-B of FT:mat_peptide GQ377622_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=400 residues).
MEGWSSEPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTNVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377625_LHBs_P-B Product feature CHAIN GQ377625_LHBs_P-B of FT:mat_peptide GQ377625_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377629_LHBs_P-B Product feature CHAIN GQ377629_LHBs_P-B of FT:mat_peptide GQ377629_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377638_LHBs_P-B Product feature CHAIN GQ377638_LHBs_P-B of FT:mat_peptide GQ377638_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377639_LHBs_P-B Product feature CHAIN GQ377639_LHBs_P-B of FT:mat_peptide GQ377639_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377641_LHBs_P-B Product feature CHAIN GQ377641_LHBs_P-B of FT:mat_peptide GQ377641_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377643_LHBs_P-B Product feature CHAIN GQ377643_LHBs_P-B of FT:mat_peptide GQ377643_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPLHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377644_LHBs_P-B Product feature CHAIN GQ377644_LHBs_P-B of FT:mat_peptide GQ377644_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWELASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWAYT
>gnl|hbvpro|GQ475340_LHBs_P-B Product feature CHAIN GQ475340_LHBs_P-B of FT:mat_peptide GQ475340_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924603_LHBs_P-B Product feature CHAIN GQ924603_LHBs_P-B of FT:mat_peptide GQ924603_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924605_LHBs_P-B Product feature CHAIN GQ924605_LHBs_P-B of FT:mat_peptide GQ924605_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924606_LHBs_P-B Product feature CHAIN GQ924606_LHBs_P-B of FT:mat_peptide GQ924606_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGXLSTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924607_LHBs_P-B Product feature CHAIN GQ924607_LHBs_P-B of FT:mat_peptide GQ924607_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNVSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLIGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924608_LHBs_P-B Product feature CHAIN GQ924608_LHBs_P-B of FT:mat_peptide GQ924608_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924610_LHBs_P-B Product feature CHAIN GQ924610_LHBs_P-B of FT:mat_peptide GQ924610_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ924611_LHBs_P-B Product feature CHAIN GQ924611_LHBs_P-B of FT:mat_peptide GQ924611_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924617_LHBs_P-B Product feature CHAIN GQ924617_LHBs_P-B of FT:mat_peptide GQ924617_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPTFKANSDNPDWDLNPHKDNWPNSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDSHPQAMQWNSAKFHQTLQDTRVRALYFPAGGSSSGIVNPVQNTASP
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ924621_LHBs_P-B Product feature CHAIN GQ924621_LHBs_P-B of FT:mat_peptide GQ924621_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVHWFGGLSPTVWLSLIWMIWFWGPSLYNILSPFIPLFPIFFCLWVYI
>gnl|hbvpro|GQ924624_LHBs_P-B Product feature CHAIN GQ924624_LHBs_P-B of FT:mat_peptide GQ924624_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVARPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924625_LHBs_P-B Product feature CHAIN GQ924625_LHBs_P-B of FT:mat_peptide GQ924625_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924626_LHBs_P-B Product feature CHAIN GQ924626_LHBs_P-B of FT:mat_peptide GQ924626_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKDNWPEANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIXTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924627_LHBs_P-B Product feature CHAIN GQ924627_LHBs_P-B of FT:mat_peptide GQ924627_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924628_LHBs_P-B Product feature CHAIN GQ924628_LHBs_P-B of FT:mat_peptide GQ924628_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924630_LHBs_P-B Product feature CHAIN GQ924630_LHBs_P-B of FT:mat_peptide GQ924630_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSTTFHQTLQDPRVRHLYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLKPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILNPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924631_LHBs_P-B Product feature CHAIN GQ924631_LHBs_P-B of FT:mat_peptide GQ924631_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924632_LHBs_P-B Product feature CHAIN GQ924632_LHBs_P-B of FT:mat_peptide GQ924632_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924634_LHBs_P-B Product feature CHAIN GQ924634_LHBs_P-B of FT:mat_peptide GQ924634_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFIPPHGGLLGWNPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924637_LHBs_P-B Product feature CHAIN GQ924637_LHBs_P-B of FT:mat_peptide GQ924637_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQVGRKPTPLTPPLRDTHPLAMQWNSTKFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924638_LHBs_P-B Product feature CHAIN GQ924638_LHBs_P-B of FT:mat_peptide GQ924638_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFLLTLQDHRVRDLYFPAGGSSSGTVNPVQNTVSS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFFWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924639_LHBs_P-B Product feature CHAIN GQ924639_LHBs_P-B of FT:mat_peptide GQ924639_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFFWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924640_LHBs_P-B Product feature CHAIN GQ924640_LHBs_P-B of FT:mat_peptide GQ924640_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924641_LHBs_P-B Product feature CHAIN GQ924641_LHBs_P-B of FT:mat_peptide GQ924641_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M76). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDSPDWDLNPHKDNWPDSNKVGVGAFGPGLTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPISPPLRDTHPQAVKWNSPTFHQTLQDPRVRALYLPAGGSSSGTVIPVQSTVSP
ISSILSKTGDPVPNMENIASGLLGPLLVLQVGFSLLTKILTIPQSLDSWWTSLSFLGGTPACLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924644_LHBs_P-B Product feature CHAIN GQ924644_LHBs_P-B of FT:mat_peptide GQ924644_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M79). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWQDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924645_LHBs_P-B Product feature CHAIN GQ924645_LHBs_P-B of FT:mat_peptide GQ924645_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVARQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
TSSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFREGTPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924646_LHBs_P-B Product feature CHAIN GQ924646_LHBs_P-B of FT:mat_peptide GQ924646_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSTLSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924647_LHBs_P-B Product feature CHAIN GQ924647_LHBs_P-B of FT:mat_peptide GQ924647_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVVLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924648_LHBs_P-B Product feature CHAIN GQ924648_LHBs_P-B of FT:mat_peptide GQ924648_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTLPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924651_LHBs_P-B Product feature CHAIN GQ924651_LHBs_P-B of FT:mat_peptide GQ924651_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPYKDNWPDSNKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924653_LHBs_P-B Product feature CHAIN GQ924653_LHBs_P-B of FT:mat_peptide GQ924653_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924654_LHBs_P-B Product feature CHAIN GQ924654_LHBs_P-B of FT:mat_peptide GQ924654_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPYKDNWPDSNKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924656_LHBs_P-B Product feature CHAIN GQ924656_LHBs_P-B of FT:mat_peptide GQ924656_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDFNPHKDNWPDSNKVGVGAFGPGLTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTANPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU332695_LHBs_P-B Product feature CHAIN GU332695_LHBs_P-B of FT:mat_peptide GU332695_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMD74). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU357842_LHBs_P-B Product feature CHAIN GU357842_LHBs_P-B of FT:mat_peptide GU357842_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMRTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWNPQ
AQGILTTVPAAPPPASTNRQSGGQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSTFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYS
>gnl|hbvpro|GU434372_LHBs_P-B Product feature CHAIN GU434372_LHBs_P-B of FT:mat_peptide GU434372_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNIWSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU434373_LHBs_P-B Product feature CHAIN GU434373_LHBs_P-B of FT:mat_peptide GU434373_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU451682_LHBs_P-B Product feature CHAIN GU451682_LHBs_P-B of FT:mat_peptide GU451682_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815548_LHBs_P-B Product feature CHAIN GU815548_LHBs_P-B of FT:mat_peptide GU815548_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815549_LHBs_P-B Product feature CHAIN GU815549_LHBs_P-B of FT:mat_peptide GU815549_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLPVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815550_LHBs_P-B Product feature CHAIN GU815550_LHBs_P-B of FT:mat_peptide GU815550_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815551_LHBs_P-B Product feature CHAIN GU815551_LHBs_P-B of FT:mat_peptide GU815551_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815552_LHBs_P-B Product feature CHAIN GU815552_LHBs_P-B of FT:mat_peptide GU815552_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815553_LHBs_P-B Product feature CHAIN GU815553_LHBs_P-B of FT:mat_peptide GU815553_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815554_LHBs_P-B Product feature CHAIN GU815554_LHBs_P-B of FT:mat_peptide GU815554_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAYKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVRPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815555_LHBs_P-B Product feature CHAIN GU815555_LHBs_P-B of FT:mat_peptide GU815555_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815556_LHBs_P-B Product feature CHAIN GU815556_LHBs_P-B of FT:mat_peptide GU815556_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815557_LHBs_P-B Product feature CHAIN GU815557_LHBs_P-B of FT:mat_peptide GU815557_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815558_LHBs_P-B Product feature CHAIN GU815558_LHBs_P-B of FT:mat_peptide GU815558_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRRPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815559_LHBs_P-B Product feature CHAIN GU815559_LHBs_P-B of FT:mat_peptide GU815559_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815560_LHBs_P-B Product feature CHAIN GU815560_LHBs_P-B of FT:mat_peptide GU815560_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815561_LHBs_P-B Product feature CHAIN GU815561_LHBs_P-B of FT:mat_peptide GU815561_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815562_LHBs_P-B Product feature CHAIN GU815562_LHBs_P-B of FT:mat_peptide GU815562_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815563_LHBs_P-B Product feature CHAIN GU815563_LHBs_P-B of FT:mat_peptide GU815563_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815564_LHBs_P-B Product feature CHAIN GU815564_LHBs_P-B of FT:mat_peptide GU815564_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815565_LHBs_P-B Product feature CHAIN GU815565_LHBs_P-B of FT:mat_peptide GU815565_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815566_LHBs_P-B Product feature CHAIN GU815566_LHBs_P-B of FT:mat_peptide GU815566_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815567_LHBs_P-B Product feature CHAIN GU815567_LHBs_P-B of FT:mat_peptide GU815567_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815568_LHBs_P-B Product feature CHAIN GU815568_LHBs_P-B of FT:mat_peptide GU815568_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815569_LHBs_P-B Product feature CHAIN GU815569_LHBs_P-B of FT:mat_peptide GU815569_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815570_LHBs_P-B Product feature CHAIN GU815570_LHBs_P-B of FT:mat_peptide GU815570_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815571_LHBs_P-B Product feature CHAIN GU815571_LHBs_P-B of FT:mat_peptide GU815571_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815572_LHBs_P-B Product feature CHAIN GU815572_LHBs_P-B of FT:mat_peptide GU815572_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVAAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815574_LHBs_P-B Product feature CHAIN GU815574_LHBs_P-B of FT:mat_peptide GU815574_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815575_LHBs_P-B Product feature CHAIN GU815575_LHBs_P-B of FT:mat_peptide GU815575_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815576_LHBs_P-B Product feature CHAIN GU815576_LHBs_P-B of FT:mat_peptide GU815576_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815577_LHBs_P-B Product feature CHAIN GU815577_LHBs_P-B of FT:mat_peptide GU815577_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815578_LHBs_P-B Product feature CHAIN GU815578_LHBs_P-B of FT:mat_peptide GU815578_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815579_LHBs_P-B Product feature CHAIN GU815579_LHBs_P-B of FT:mat_peptide GU815579_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815581_LHBs_P-B Product feature CHAIN GU815581_LHBs_P-B of FT:mat_peptide GU815581_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDSRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815583_LHBs_P-B Product feature CHAIN GU815583_LHBs_P-B of FT:mat_peptide GU815583_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815584_LHBs_P-B Product feature CHAIN GU815584_LHBs_P-B of FT:mat_peptide GU815584_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|GU815585_LHBs_P-B Product feature CHAIN GU815585_LHBs_P-B of FT:mat_peptide GU815585_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815586_LHBs_P-B Product feature CHAIN GU815586_LHBs_P-B of FT:mat_peptide GU815586_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815587_LHBs_P-B Product feature CHAIN GU815587_LHBs_P-B of FT:mat_peptide GU815587_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815588_LHBs_P-B Product feature CHAIN GU815588_LHBs_P-B of FT:mat_peptide GU815588_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815589_LHBs_P-B Product feature CHAIN GU815589_LHBs_P-B of FT:mat_peptide GU815589_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815590_LHBs_P-B Product feature CHAIN GU815590_LHBs_P-B of FT:mat_peptide GU815590_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815591_LHBs_P-B Product feature CHAIN GU815591_LHBs_P-B of FT:mat_peptide GU815591_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815593_LHBs_P-B Product feature CHAIN GU815593_LHBs_P-B of FT:mat_peptide GU815593_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815594_LHBs_P-B Product feature CHAIN GU815594_LHBs_P-B of FT:mat_peptide GU815594_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815595_LHBs_P-B Product feature CHAIN GU815595_LHBs_P-B of FT:mat_peptide GU815595_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815596_LHBs_P-B Product feature CHAIN GU815596_LHBs_P-B of FT:mat_peptide GU815596_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815597_LHBs_P-B Product feature CHAIN GU815597_LHBs_P-B of FT:mat_peptide GU815597_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815598_LHBs_P-B Product feature CHAIN GU815598_LHBs_P-B of FT:mat_peptide GU815598_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815599_LHBs_P-B Product feature CHAIN GU815599_LHBs_P-B of FT:mat_peptide GU815599_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815600_LHBs_P-B Product feature CHAIN GU815600_LHBs_P-B of FT:mat_peptide GU815600_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815601_LHBs_P-B Product feature CHAIN GU815601_LHBs_P-B of FT:mat_peptide GU815601_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815602_LHBs_P-B Product feature CHAIN GU815602_LHBs_P-B of FT:mat_peptide GU815602_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815603_LHBs_P-B Product feature CHAIN GU815603_LHBs_P-B of FT:mat_peptide GU815603_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815604_LHBs_P-B Product feature CHAIN GU815604_LHBs_P-B of FT:mat_peptide GU815604_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815605_LHBs_P-B Product feature CHAIN GU815605_LHBs_P-B of FT:mat_peptide GU815605_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815606_LHBs_P-B Product feature CHAIN GU815606_LHBs_P-B of FT:mat_peptide GU815606_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815607_LHBs_P-B Product feature CHAIN GU815607_LHBs_P-B of FT:mat_peptide GU815607_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKHLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815608_LHBs_P-B Product feature CHAIN GU815608_LHBs_P-B of FT:mat_peptide GU815608_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQVGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815609_LHBs_P-B Product feature CHAIN GU815609_LHBs_P-B of FT:mat_peptide GU815609_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815610_LHBs_P-B Product feature CHAIN GU815610_LHBs_P-B of FT:mat_peptide GU815610_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRGTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815612_LHBs_P-B Product feature CHAIN GU815612_LHBs_P-B of FT:mat_peptide GU815612_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815613_LHBs_P-B Product feature CHAIN GU815613_LHBs_P-B of FT:mat_peptide GU815613_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815614_LHBs_P-B Product feature CHAIN GU815614_LHBs_P-B of FT:mat_peptide GU815614_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815617_LHBs_P-B Product feature CHAIN GU815617_LHBs_P-B of FT:mat_peptide GU815617_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSPYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815618_LHBs_P-B Product feature CHAIN GU815618_LHBs_P-B of FT:mat_peptide GU815618_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPMCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815619_LHBs_P-B Product feature CHAIN GU815619_LHBs_P-B of FT:mat_peptide GU815619_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815620_LHBs_P-B Product feature CHAIN GU815620_LHBs_P-B of FT:mat_peptide GU815620_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815621_LHBs_P-B Product feature CHAIN GU815621_LHBs_P-B of FT:mat_peptide GU815621_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815622_LHBs_P-B Product feature CHAIN GU815622_LHBs_P-B of FT:mat_peptide GU815622_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSPYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815623_LHBs_P-B Product feature CHAIN GU815623_LHBs_P-B of FT:mat_peptide GU815623_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815625_LHBs_P-B Product feature CHAIN GU815625_LHBs_P-B of FT:mat_peptide GU815625_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVSFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815626_LHBs_P-B Product feature CHAIN GU815626_LHBs_P-B of FT:mat_peptide GU815626_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVFA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815627_LHBs_P-B Product feature CHAIN GU815627_LHBs_P-B of FT:mat_peptide GU815627_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815628_LHBs_P-B Product feature CHAIN GU815628_LHBs_P-B of FT:mat_peptide GU815628_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815629_LHBs_P-B Product feature CHAIN GU815629_LHBs_P-B of FT:mat_peptide GU815629_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815630_LHBs_P-B Product feature CHAIN GU815630_LHBs_P-B of FT:mat_peptide GU815630_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815631_LHBs_P-B Product feature CHAIN GU815631_LHBs_P-B of FT:mat_peptide GU815631_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815632_LHBs_P-B Product feature CHAIN GU815632_LHBs_P-B of FT:mat_peptide GU815632_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815633_LHBs_P-B Product feature CHAIN GU815633_LHBs_P-B of FT:mat_peptide GU815633_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPCMPLLPIFFCLWVYI
>gnl|hbvpro|GU815635_LHBs_P-B Product feature CHAIN GU815635_LHBs_P-B of FT:mat_peptide GU815635_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815636_LHBs_P-B Product feature CHAIN GU815636_LHBs_P-B of FT:mat_peptide GU815636_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815637_LHBs_P-B Product feature CHAIN GU815637_LHBs_P-B of FT:mat_peptide GU815637_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815638_LHBs_P-B Product feature CHAIN GU815638_LHBs_P-B of FT:mat_peptide GU815638_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815639_LHBs_P-B Product feature CHAIN GU815639_LHBs_P-B of FT:mat_peptide GU815639_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSRPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLEPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815640_LHBs_P-B Product feature CHAIN GU815640_LHBs_P-B of FT:mat_peptide GU815640_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDKWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815641_LHBs_P-B Product feature CHAIN GU815641_LHBs_P-B of FT:mat_peptide GU815641_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815642_LHBs_P-B Product feature CHAIN GU815642_LHBs_P-B of FT:mat_peptide GU815642_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDDWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPTLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815643_LHBs_P-B Product feature CHAIN GU815643_LHBs_P-B of FT:mat_peptide GU815643_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815644_LHBs_P-B Product feature CHAIN GU815644_LHBs_P-B of FT:mat_peptide GU815644_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815645_LHBs_P-B Product feature CHAIN GU815645_LHBs_P-B of FT:mat_peptide GU815645_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815646_LHBs_P-B Product feature CHAIN GU815646_LHBs_P-B of FT:mat_peptide GU815646_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=400 residues).
TGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815647_LHBs_P-B Product feature CHAIN GU815647_LHBs_P-B of FT:mat_peptide GU815647_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815648_LHBs_P-B Product feature CHAIN GU815648_LHBs_P-B of FT:mat_peptide GU815648_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815649_LHBs_P-B Product feature CHAIN GU815649_LHBs_P-B of FT:mat_peptide GU815649_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815650_LHBs_P-B Product feature CHAIN GU815650_LHBs_P-B of FT:mat_peptide GU815650_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815651_LHBs_P-B Product feature CHAIN GU815651_LHBs_P-B of FT:mat_peptide GU815651_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDAHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGSFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815652_LHBs_P-B Product feature CHAIN GU815652_LHBs_P-B of FT:mat_peptide GU815652_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815653_LHBs_P-B Product feature CHAIN GU815653_LHBs_P-B of FT:mat_peptide GU815653_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815654_LHBs_P-B Product feature CHAIN GU815654_LHBs_P-B of FT:mat_peptide GU815654_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815656_LHBs_P-B Product feature CHAIN GU815656_LHBs_P-B of FT:mat_peptide GU815656_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQRFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815657_LHBs_P-B Product feature CHAIN GU815657_LHBs_P-B of FT:mat_peptide GU815657_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPRAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIILLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGPSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815658_LHBs_P-B Product feature CHAIN GU815658_LHBs_P-B of FT:mat_peptide GU815658_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFPWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815659_LHBs_P-B Product feature CHAIN GU815659_LHBs_P-B of FT:mat_peptide GU815659_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815660_LHBs_P-B Product feature CHAIN GU815660_LHBs_P-B of FT:mat_peptide GU815660_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815661_LHBs_P-B Product feature CHAIN GU815661_LHBs_P-B of FT:mat_peptide GU815661_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815662_LHBs_P-B Product feature CHAIN GU815662_LHBs_P-B of FT:mat_peptide GU815662_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815663_LHBs_P-B Product feature CHAIN GU815663_LHBs_P-B of FT:mat_peptide GU815663_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815664_LHBs_P-B Product feature CHAIN GU815664_LHBs_P-B of FT:mat_peptide GU815664_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815665_LHBs_P-B Product feature CHAIN GU815665_LHBs_P-B of FT:mat_peptide GU815665_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815666_LHBs_P-B Product feature CHAIN GU815666_LHBs_P-B of FT:mat_peptide GU815666_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815667_LHBs_P-B Product feature CHAIN GU815667_LHBs_P-B of FT:mat_peptide GU815667_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815668_LHBs_P-B Product feature CHAIN GU815668_LHBs_P-B of FT:mat_peptide GU815668_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815669_LHBs_P-B Product feature CHAIN GU815669_LHBs_P-B of FT:mat_peptide GU815669_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815670_LHBs_P-B Product feature CHAIN GU815670_LHBs_P-B of FT:mat_peptide GU815670_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLILLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815672_LHBs_P-B Product feature CHAIN GU815672_LHBs_P-B of FT:mat_peptide GU815672_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815673_LHBs_P-B Product feature CHAIN GU815673_LHBs_P-B of FT:mat_peptide GU815673_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815674_LHBs_P-B Product feature CHAIN GU815674_LHBs_P-B of FT:mat_peptide GU815674_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815675_LHBs_P-B Product feature CHAIN GU815675_LHBs_P-B of FT:mat_peptide GU815675_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815676_LHBs_P-B Product feature CHAIN GU815676_LHBs_P-B of FT:mat_peptide GU815676_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815677_LHBs_P-B Product feature CHAIN GU815677_LHBs_P-B of FT:mat_peptide GU815677_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815678_LHBs_P-B Product feature CHAIN GU815678_LHBs_P-B of FT:mat_peptide GU815678_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWPSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815679_LHBs_P-B Product feature CHAIN GU815679_LHBs_P-B of FT:mat_peptide GU815679_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815680_LHBs_P-B Product feature CHAIN GU815680_LHBs_P-B of FT:mat_peptide GU815680_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815681_LHBs_P-B Product feature CHAIN GU815681_LHBs_P-B of FT:mat_peptide GU815681_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|GU815683_LHBs_P-B Product feature CHAIN GU815683_LHBs_P-B of FT:mat_peptide GU815683_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815684_LHBs_P-B Product feature CHAIN GU815684_LHBs_P-B of FT:mat_peptide GU815684_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKLRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815685_LHBs_P-B Product feature CHAIN GU815685_LHBs_P-B of FT:mat_peptide GU815685_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815686_LHBs_P-B Product feature CHAIN GU815686_LHBs_P-B of FT:mat_peptide GU815686_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815687_LHBs_P-B Product feature CHAIN GU815687_LHBs_P-B of FT:mat_peptide GU815687_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815688_LHBs_P-B Product feature CHAIN GU815688_LHBs_P-B of FT:mat_peptide GU815688_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815689_LHBs_P-B Product feature CHAIN GU815689_LHBs_P-B of FT:mat_peptide GU815689_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815691_LHBs_P-B Product feature CHAIN GU815691_LHBs_P-B of FT:mat_peptide GU815691_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815692_LHBs_P-B Product feature CHAIN GU815692_LHBs_P-B of FT:mat_peptide GU815692_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815693_LHBs_P-B Product feature CHAIN GU815693_LHBs_P-B of FT:mat_peptide GU815693_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815694_LHBs_P-B Product feature CHAIN GU815694_LHBs_P-B of FT:mat_peptide GU815694_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815695_LHBs_P-B Product feature CHAIN GU815695_LHBs_P-B of FT:mat_peptide GU815695_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815696_LHBs_P-B Product feature CHAIN GU815696_LHBs_P-B of FT:mat_peptide GU815696_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815697_LHBs_P-B Product feature CHAIN GU815697_LHBs_P-B of FT:mat_peptide GU815697_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815698_LHBs_P-B Product feature CHAIN GU815698_LHBs_P-B of FT:mat_peptide GU815698_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815699_LHBs_P-B Product feature CHAIN GU815699_LHBs_P-B of FT:mat_peptide GU815699_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815700_LHBs_P-B Product feature CHAIN GU815700_LHBs_P-B of FT:mat_peptide GU815700_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815701_LHBs_P-B Product feature CHAIN GU815701_LHBs_P-B of FT:mat_peptide GU815701_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815702_LHBs_P-B Product feature CHAIN GU815702_LHBs_P-B of FT:mat_peptide GU815702_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815703_LHBs_P-B Product feature CHAIN GU815703_LHBs_P-B of FT:mat_peptide GU815703_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815704_LHBs_P-B Product feature CHAIN GU815704_LHBs_P-B of FT:mat_peptide GU815704_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815705_LHBs_P-B Product feature CHAIN GU815705_LHBs_P-B of FT:mat_peptide GU815705_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815706_LHBs_P-B Product feature CHAIN GU815706_LHBs_P-B of FT:mat_peptide GU815706_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815707_LHBs_P-B Product feature CHAIN GU815707_LHBs_P-B of FT:mat_peptide GU815707_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKDNWPEANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815708_LHBs_P-B Product feature CHAIN GU815708_LHBs_P-B of FT:mat_peptide GU815708_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815709_LHBs_P-B Product feature CHAIN GU815709_LHBs_P-B of FT:mat_peptide GU815709_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGISMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815710_LHBs_P-B Product feature CHAIN GU815710_LHBs_P-B of FT:mat_peptide GU815710_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815711_LHBs_P-B Product feature CHAIN GU815711_LHBs_P-B of FT:mat_peptide GU815711_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMSLLPIFFCLWVYI
>gnl|hbvpro|GU815712_LHBs_P-B Product feature CHAIN GU815712_LHBs_P-B of FT:mat_peptide GU815712_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815713_LHBs_P-B Product feature CHAIN GU815713_LHBs_P-B of FT:mat_peptide GU815713_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVLFVQWFVGLSPTVRLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815715_LHBs_P-B Product feature CHAIN GU815715_LHBs_P-B of FT:mat_peptide GU815715_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815716_LHBs_P-B Product feature CHAIN GU815716_LHBs_P-B of FT:mat_peptide GU815716_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815717_LHBs_P-B Product feature CHAIN GU815717_LHBs_P-B of FT:mat_peptide GU815717_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815718_LHBs_P-B Product feature CHAIN GU815718_LHBs_P-B of FT:mat_peptide GU815718_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGPSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815719_LHBs_P-B Product feature CHAIN GU815719_LHBs_P-B of FT:mat_peptide GU815719_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815720_LHBs_P-B Product feature CHAIN GU815720_LHBs_P-B of FT:mat_peptide GU815720_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815721_LHBs_P-B Product feature CHAIN GU815721_LHBs_P-B of FT:mat_peptide GU815721_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815722_LHBs_P-B Product feature CHAIN GU815722_LHBs_P-B of FT:mat_peptide GU815722_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWLVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815723_LHBs_P-B Product feature CHAIN GU815723_LHBs_P-B of FT:mat_peptide GU815723_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPESSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815724_LHBs_P-B Product feature CHAIN GU815724_LHBs_P-B of FT:mat_peptide GU815724_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815725_LHBs_P-B Product feature CHAIN GU815725_LHBs_P-B of FT:mat_peptide GU815725_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815726_LHBs_P-B Product feature CHAIN GU815726_LHBs_P-B of FT:mat_peptide GU815726_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815727_LHBs_P-B Product feature CHAIN GU815727_LHBs_P-B of FT:mat_peptide GU815727_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815728_LHBs_P-B Product feature CHAIN GU815728_LHBs_P-B of FT:mat_peptide GU815728_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815729_LHBs_P-B Product feature CHAIN GU815729_LHBs_P-B of FT:mat_peptide GU815729_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815730_LHBs_P-B Product feature CHAIN GU815730_LHBs_P-B of FT:mat_peptide GU815730_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815731_LHBs_P-B Product feature CHAIN GU815731_LHBs_P-B of FT:mat_peptide GU815731_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWGLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815732_LHBs_P-B Product feature CHAIN GU815732_LHBs_P-B of FT:mat_peptide GU815732_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815733_LHBs_P-B Product feature CHAIN GU815733_LHBs_P-B of FT:mat_peptide GU815733_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLYPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815734_LHBs_P-B Product feature CHAIN GU815734_LHBs_P-B of FT:mat_peptide GU815734_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815735_LHBs_P-B Product feature CHAIN GU815735_LHBs_P-B of FT:mat_peptide GU815735_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSSFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815736_LHBs_P-B Product feature CHAIN GU815736_LHBs_P-B of FT:mat_peptide GU815736_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815737_LHBs_P-B Product feature CHAIN GU815737_LHBs_P-B of FT:mat_peptide GU815737_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815738_LHBs_P-B Product feature CHAIN GU815738_LHBs_P-B of FT:mat_peptide GU815738_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815739_LHBs_P-B Product feature CHAIN GU815739_LHBs_P-B of FT:mat_peptide GU815739_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815740_LHBs_P-B Product feature CHAIN GU815740_LHBs_P-B of FT:mat_peptide GU815740_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815742_LHBs_P-B Product feature CHAIN GU815742_LHBs_P-B of FT:mat_peptide GU815742_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815743_LHBs_P-B Product feature CHAIN GU815743_LHBs_P-B of FT:mat_peptide GU815743_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815744_LHBs_P-B Product feature CHAIN GU815744_LHBs_P-B of FT:mat_peptide GU815744_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815745_LHBs_P-B Product feature CHAIN GU815745_LHBs_P-B of FT:mat_peptide GU815745_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815746_LHBs_P-B Product feature CHAIN GU815746_LHBs_P-B of FT:mat_peptide GU815746_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815747_LHBs_P-B Product feature CHAIN GU815747_LHBs_P-B of FT:mat_peptide GU815747_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815748_LHBs_P-B Product feature CHAIN GU815748_LHBs_P-B of FT:mat_peptide GU815748_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815749_LHBs_P-B Product feature CHAIN GU815749_LHBs_P-B of FT:mat_peptide GU815749_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGANLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815750_LHBs_P-B Product feature CHAIN GU815750_LHBs_P-B of FT:mat_peptide GU815750_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815751_LHBs_P-B Product feature CHAIN GU815751_LHBs_P-B of FT:mat_peptide GU815751_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815752_LHBs_P-B Product feature CHAIN GU815752_LHBs_P-B of FT:mat_peptide GU815752_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSVFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815753_LHBs_P-B Product feature CHAIN GU815753_LHBs_P-B of FT:mat_peptide GU815753_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815754_LHBs_P-B Product feature CHAIN GU815754_LHBs_P-B of FT:mat_peptide GU815754_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815755_LHBs_P-B Product feature CHAIN GU815755_LHBs_P-B of FT:mat_peptide GU815755_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815756_LHBs_P-B Product feature CHAIN GU815756_LHBs_P-B of FT:mat_peptide GU815756_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815757_LHBs_P-B Product feature CHAIN GU815757_LHBs_P-B of FT:mat_peptide GU815757_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815759_LHBs_P-B Product feature CHAIN GU815759_LHBs_P-B of FT:mat_peptide GU815759_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815760_LHBs_P-B Product feature CHAIN GU815760_LHBs_P-B of FT:mat_peptide GU815760_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815761_LHBs_P-B Product feature CHAIN GU815761_LHBs_P-B of FT:mat_peptide GU815761_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815762_LHBs_P-B Product feature CHAIN GU815762_LHBs_P-B of FT:mat_peptide GU815762_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815764_LHBs_P-B Product feature CHAIN GU815764_LHBs_P-B of FT:mat_peptide GU815764_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815765_LHBs_P-B Product feature CHAIN GU815765_LHBs_P-B of FT:mat_peptide GU815765_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815766_LHBs_P-B Product feature CHAIN GU815766_LHBs_P-B of FT:mat_peptide GU815766_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815767_LHBs_P-B Product feature CHAIN GU815767_LHBs_P-B of FT:mat_peptide GU815767_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815768_LHBs_P-B Product feature CHAIN GU815768_LHBs_P-B of FT:mat_peptide GU815768_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815769_LHBs_P-B Product feature CHAIN GU815769_LHBs_P-B of FT:mat_peptide GU815769_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815770_LHBs_P-B Product feature CHAIN GU815770_LHBs_P-B of FT:mat_peptide GU815770_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRAPYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815771_LHBs_P-B Product feature CHAIN GU815771_LHBs_P-B of FT:mat_peptide GU815771_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815772_LHBs_P-B Product feature CHAIN GU815772_LHBs_P-B of FT:mat_peptide GU815772_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815773_LHBs_P-B Product feature CHAIN GU815773_LHBs_P-B of FT:mat_peptide GU815773_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|GU815774_LHBs_P-B Product feature CHAIN GU815774_LHBs_P-B of FT:mat_peptide GU815774_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGISMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815775_LHBs_P-B Product feature CHAIN GU815775_LHBs_P-B of FT:mat_peptide GU815775_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815776_LHBs_P-B Product feature CHAIN GU815776_LHBs_P-B of FT:mat_peptide GU815776_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|GU815777_LHBs_P-B Product feature CHAIN GU815777_LHBs_P-B of FT:mat_peptide GU815777_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815778_LHBs_P-B Product feature CHAIN GU815778_LHBs_P-B of FT:mat_peptide GU815778_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815779_LHBs_P-B Product feature CHAIN GU815779_LHBs_P-B of FT:mat_peptide GU815779_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVSAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFRLWVYI
>gnl|hbvpro|GU815780_LHBs_P-B Product feature CHAIN GU815780_LHBs_P-B of FT:mat_peptide GU815780_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815781_LHBs_P-B Product feature CHAIN GU815781_LHBs_P-B of FT:mat_peptide GU815781_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815782_LHBs_P-B Product feature CHAIN GU815782_LHBs_P-B of FT:mat_peptide GU815782_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815783_LHBs_P-B Product feature CHAIN GU815783_LHBs_P-B of FT:mat_peptide GU815783_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011466_LHBs_P-B Product feature CHAIN HM011466_LHBs_P-B of FT:mat_peptide HM011466_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSA
XSSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEKLVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWLWGPNLYNXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011467_LHBs_P-B Product feature CHAIN HM011467_LHBs_P-B of FT:mat_peptide HM011467_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASXNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWXFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLFPIFFCLWXYI
>gnl|hbvpro|HM011469_LHBs_P-B Product feature CHAIN HM011469_LHBs_P-B of FT:mat_peptide HM011469_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXXPVCXGQNSQSQXSSHSPTCCP
PTCPGYRWMXLRXFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLCNIXXPFXPLFPIFXCLWVYI
>gnl|hbvpro|HM011470_LHBs_P-B Product feature CHAIN HM011470_LHBs_P-B of FT:mat_peptide HM011470_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGVTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALHVPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011471_LHBs_P-B Product feature CHAIN HM011471_LHBs_P-B of FT:mat_peptide HM011471_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQXMKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLCNILSPFMPLLXIFFCLWAYI
>gnl|hbvpro|HM011473_LHBs_P-B Product feature CHAIN HM011473_LHBs_P-B of FT:mat_peptide HM011473_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGETPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011474_LHBs_P-B Product feature CHAIN HM011474_LHBs_P-B of FT:mat_peptide HM011474_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPTHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCRGQNSQSQTSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011475_LHBs_P-B Product feature CHAIN HM011475_LHBs_P-B of FT:mat_peptide HM011475_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFXANSENPDWNLNPHKDNWPDANKVGEGAFGPGXTPPHGGLLGWSPQ
AQGLXTTXPAAPPPASTNRQSGRXPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM011476_LHBs_P-B Product feature CHAIN HM011476_LHBs_P-B of FT:mat_peptide HM011476_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEXPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTYRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTIQDPRVRALYFPAGGSSSGTVSPAQSTVSP
TSSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM011477_LHBs_P-B Product feature CHAIN HM011477_LHBs_P-B of FT:mat_peptide HM011477_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKDNWPDANKXGVGAFGPGFXPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSRRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|HM011478_LHBs_P-B Product feature CHAIN HM011478_LHBs_P-B of FT:mat_peptide HM011478_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
XGXXXSXPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGXXPXCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011480_LHBs_P-B Product feature CHAIN HM011480_LHBs_P-B of FT:mat_peptide HM011480_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPXKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQTMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQXLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIXLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011482_LHBs_P-B Product feature CHAIN HM011482_LHBs_P-B of FT:mat_peptide HM011482_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWFWGPXLYXXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011483_LHBs_P-B Product feature CHAIN HM011483_LHBs_P-B of FT:mat_peptide HM011483_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPBANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQXMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011484_LHBs_P-B Product feature CHAIN HM011484_LHBs_P-B of FT:mat_peptide HM011484_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVLNMENIASGLLGPLLVLQAGFFLLTKXLTIPQXLDXWWTSLSFLGVPPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011487_LHBs_P-B Product feature CHAIN HM011487_LHBs_P-B of FT:mat_peptide HM011487_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKDNWPDSNKVGVGAFGSGLTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSTSSKTGDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAXGNSTFPSCCCTKPTDAN
CTCIPIPXSWAFAKFLWEWASVRFSWLSLLXPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011490_LHBs_P-B Product feature CHAIN HM011490_LHBs_P-B of FT:mat_peptide HM011490_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGXLGWSPQ
AQGILTTVPTAPPPASTNRQLGRXPTPLSPPLRDSHPQAXQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011492_LHBs_P-B Product feature CHAIN HM011492_LHBs_P-B of FT:mat_peptide HM011492_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVSNMENITSGLLRPLLGLQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011494_LHBs_P-B Product feature CHAIN HM011494_LHBs_P-B of FT:mat_peptide HM011494_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFXXLXKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011496_LHBs_P-B Product feature CHAIN HM011496_LHBs_P-B of FT:mat_peptide HM011496_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQVGRPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTANPVQNTASS
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011499_LHBs_P-B Product feature CHAIN HM011499_LHBs_P-B of FT:mat_peptide HM011499_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRHGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNSHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRXXGRKPTPLSPPLRDTHPQAXXWNSXTFHHTLQDPRVRALYLPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVLXMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLCSILSPXMXLFPIFFCLWVYI
>gnl|hbvpro|HM011503_LHBs_P-B Product feature CHAIN HM011503_LHBs_P-B of FT:mat_peptide HM011503_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPDADKVGVGAFGPGXTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMXWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYXILXPFIPLLPIFXCLWVYI
>gnl|hbvpro|HM011504_LHBs_P-B Product feature CHAIN HM011504_LHBs_P-B of FT:mat_peptide HM011504_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFXPPHGGLLGWSPQ
TQGILTTVPAAPPPVSTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM153811_LHBs_P-B Product feature CHAIN HM153811_LHBs_P-B of FT:mat_peptide HM153811_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 712005001256). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
SQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HQ700546_LHBs_P-B Product feature CHAIN HQ700546_LHBs_P-B of FT:mat_peptide HQ700546_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HQ700548_LHBs_P-B Product feature CHAIN HQ700548_LHBs_P-B of FT:mat_peptide HQ700548_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPNSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTXFHQTLQDSRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HQ700549_LHBs_P-B Product feature CHAIN HQ700549_LHBs_P-B of FT:mat_peptide HQ700549_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIITTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASS
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JF412801_LHBs_P-B Product feature CHAIN JF412801_LHBs_P-B of FT:mat_peptide JF412801_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JF436921_LHBs_P-B Product feature CHAIN JF436921_LHBs_P-B of FT:mat_peptide JF436921_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGIGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPAFTNRQSGRQPTPLSPPLRDTHPQAIQWNYTTFHQTLQDPKVRALYFPAGGSSSGTVSPAPNTVSA
ISSILSTTGDPVPNMATNLSELLKLLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILPLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMQLLLIFFCLWVSI
>gnl|hbvpro|JF899335_LHBs_P-B Product feature CHAIN JF899335_LHBs_P-B of FT:mat_peptide JF899335_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN406371_LHBs_P-B Product feature CHAIN JN406371_LHBs_P-B of FT:mat_peptide JN406371_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWNPQ
AQGLFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604119_LHBs_P-B Product feature CHAIN JN604119_LHBs_P-B of FT:mat_peptide JN604119_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-6420-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604122_LHBs_P-B Product feature CHAIN JN604122_LHBs_P-B of FT:mat_peptide JN604122_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-8130-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604123_LHBs_P-B Product feature CHAIN JN604123_LHBs_P-B of FT:mat_peptide JN604123_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-8616-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNTVHNTASS
ISSILSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMLPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604124_LHBs_P-B Product feature CHAIN JN604124_LHBs_P-B of FT:mat_peptide JN604124_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-8619-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604125_LHBs_P-B Product feature CHAIN JN604125_LHBs_P-B of FT:mat_peptide JN604125_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-1766-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWNPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604127_LHBs_P-B Product feature CHAIN JN604127_LHBs_P-B of FT:mat_peptide JN604127_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-2999-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604130_LHBs_P-B Product feature CHAIN JN604130_LHBs_P-B of FT:mat_peptide JN604130_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-7793-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKSPDWDLNPHKDNWPEANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMADITSGLLXPLLALQAGFFSLTKILTIPQSLDSGWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCKTCTTPARSTSTFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYNTLSPLMPLLLLFFCLWVYT
>gnl|hbvpro|JN604132_LHBs_P-B Product feature CHAIN JN604132_LHBs_P-B of FT:mat_peptide JN604132_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-9698-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604134_LHBs_P-B Product feature CHAIN JN604134_LHBs_P-B of FT:mat_peptide JN604134_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-1993-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604138_LHBs_P-B Product feature CHAIN JN604138_LHBs_P-B of FT:mat_peptide JN604138_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-6805-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNGQDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKIPTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPDLHNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|JN604141_LHBs_P-B Product feature CHAIN JN604141_LHBs_P-B of FT:mat_peptide JN604141_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-9028-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDYWPDANKVGVGAFGPGFTPPHGGMLGWSPQ
AQGILTTVPAAPPPASTNRQVARPPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASARFSWLSLLVPSVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604143_LHBs_P-B Product feature CHAIN JN604143_LHBs_P-B of FT:mat_peptide JN604143_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-0606-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604146_LHBs_P-B Product feature CHAIN JN604146_LHBs_P-B of FT:mat_peptide JN604146_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-2316-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGINLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWTDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHHTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604149_LHBs_P-B Product feature CHAIN JN604149_LHBs_P-B of FT:mat_peptide JN604149_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-5331-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWNLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604154_LHBs_P-B Product feature CHAIN JN604154_LHBs_P-B of FT:mat_peptide JN604154_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 480-0167-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPL
AQGILTTVPAAPPSASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604187_LHBs_P-B Product feature CHAIN JN604187_LHBs_P-B of FT:mat_peptide JN604187_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-1713-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|JN604212_LHBs_P-B Product feature CHAIN JN604212_LHBs_P-B of FT:mat_peptide JN604212_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-7995-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604213_LHBs_P-B Product feature CHAIN JN604213_LHBs_P-B of FT:mat_peptide JN604213_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-9306-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGDTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604219_LHBs_P-B Product feature CHAIN JN604219_LHBs_P-B of FT:mat_peptide JN604219_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-2927-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGLIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQTTAFA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSSFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLXLLXPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|JN604221_LHBs_P-B Product feature CHAIN JN604221_LHBs_P-B of FT:mat_peptide JN604221_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-4136-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTXHQTLQDPXVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILXIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604223_LHBs_P-B Product feature CHAIN JN604223_LHBs_P-B of FT:mat_peptide JN604223_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-4979-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604224_LHBs_P-B Product feature CHAIN JN604224_LHBs_P-B of FT:mat_peptide JN604224_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-5048-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604234_LHBs_P-B Product feature CHAIN JN604234_LHBs_P-B of FT:mat_peptide JN604234_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-0688-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBXNPYKDNWPDXNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPAXTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNSASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFXGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFXLWVYX
>gnl|hbvpro|JN604244_LHBs_P-B Product feature CHAIN JN604244_LHBs_P-B of FT:mat_peptide JN604244_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-0396-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPXSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTASA
ISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604253_LHBs_P-B Product feature CHAIN JN604253_LHBs_P-B of FT:mat_peptide JN604253_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-5640-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604284_LHBs_P-B Product feature CHAIN JN604284_LHBs_P-B of FT:mat_peptide JN604284_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-8831-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPL
AQGILTTVPAAPPSASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604311_LHBs_P-B Product feature CHAIN JN604311_LHBs_P-B of FT:mat_peptide JN604311_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-5511-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792893_LHBs_P-B Product feature CHAIN JN792893_LHBs_P-B of FT:mat_peptide JN792893_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2004). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASANRQVGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASP
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792894_LHBs_P-B Product feature CHAIN JN792894_LHBs_P-B of FT:mat_peptide JN792894_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASANRQVGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYPWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792895_LHBs_P-B Product feature CHAIN JN792895_LHBs_P-B of FT:mat_peptide JN792895_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLYLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLRNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792896_LHBs_P-B Product feature CHAIN JN792896_LHBs_P-B of FT:mat_peptide JN792896_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFMPLLSIFLCLWVYI
>gnl|hbvpro|JN792897_LHBs_P-B Product feature CHAIN JN792897_LHBs_P-B of FT:mat_peptide JN792897_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792898_LHBs_P-B Product feature CHAIN JN792898_LHBs_P-B of FT:mat_peptide JN792898_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792899_LHBs_P-B Product feature CHAIN JN792899_LHBs_P-B of FT:mat_peptide JN792899_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHNDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792900_LHBs_P-B Product feature CHAIN JN792900_LHBs_P-B of FT:mat_peptide JN792900_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSLPAAPPPANTNRQVGRQPTPLSPPIRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASS
ISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792901_LHBs_P-B Product feature CHAIN JN792901_LHBs_P-B of FT:mat_peptide JN792901_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQNSSTFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792902_LHBs_P-B Product feature CHAIN JN792902_LHBs_P-B of FT:mat_peptide JN792902_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQVGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASS
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTXPCKTCTTPAQGNSTFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN827419_LHBs_P-B Product feature CHAIN JN827419_LHBs_P-B of FT:mat_peptide JN827419_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ027311_LHBs_P-B Product feature CHAIN JQ027311_LHBs_P-B of FT:mat_peptide JQ027311_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLXFLGGTXXCLGQNSQSQISSHXPTCCP
PICPGYRWMCLRRXIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILXPFMPLFPIFFCLWVYI
>gnl|hbvpro|JQ027312_LHBs_P-B Product feature CHAIN JQ027312_LHBs_P-B of FT:mat_peptide JQ027312_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDXNPHKDXWPDABKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTTFHQTLQDPRVRALYLPAGGSSSXTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWFWGPSLYXTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027315_LHBs_P-B Product feature CHAIN JQ027315_LHBs_P-B of FT:mat_peptide JQ027315_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQATQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSPISRHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027316_LHBs_P-B Product feature CHAIN JQ027316_LHBs_P-B of FT:mat_peptide JQ027316_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDFNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
SQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDRN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPKLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027325_LHBs_P-B Product feature CHAIN JQ027325_LHBs_P-B of FT:mat_peptide JQ027325_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAWKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHXTLQDPRVRALYLPAGGSSSGTVSPAQXTVSA
TSSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027330_LHBs_P-B Product feature CHAIN JQ027330_LHBs_P-B of FT:mat_peptide JQ027330_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGXIPPHGGLLGWSPQ
AQGIXTXVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTXHQTLQDPRVRAXNFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027331_LHBs_P-B Product feature CHAIN JQ027331_LHBs_P-B of FT:mat_peptide JQ027331_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGXIPPHGGLLGWSPQ
AQGIXTXVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTXHQTLQDPRVRAXNFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027334_LHBs_P-B Product feature CHAIN JQ027334_LHBs_P-B of FT:mat_peptide JQ027334_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDXWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRKPTPLSPPLRDTHPQAVXWNSTXFHQTLQDPRVRALYLPAGGSSSGTVNPVPNTASS
ISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQCQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040125_LHBs_P-B Product feature CHAIN JQ040125_LHBs_P-B of FT:mat_peptide JQ040125_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTBLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGIGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040128_LHBs_P-B Product feature CHAIN JQ040128_LHBs_P-B of FT:mat_peptide JQ040128_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGXGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ040138_LHBs_P-B Product feature CHAIN JQ040138_LHBs_P-B of FT:mat_peptide JQ040138_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVLNMENIASGLLRPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040147_LHBs_P-B Product feature CHAIN JQ040147_LHBs_P-B of FT:mat_peptide JQ040147_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ040157_LHBs_P-B Product feature CHAIN JQ040157_LHBs_P-B of FT:mat_peptide JQ040157_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PIXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGXSTTSTGPCKTCTIPAQGTSMFXSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040170_LHBs_P-B Product feature CHAIN JQ040170_LHBs_P-B of FT:mat_peptide JQ040170_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAXYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040171_LHBs_P-B Product feature CHAIN JQ040171_LHBs_P-B of FT:mat_peptide JQ040171_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKAXSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040173_LHBs_P-B Product feature CHAIN JQ040173_LHBs_P-B of FT:mat_peptide JQ040173_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341549_LHBs_P-B Product feature CHAIN JQ341549_LHBs_P-B of FT:mat_peptide JQ341549_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341550_LHBs_P-B Product feature CHAIN JQ341550_LHBs_P-B of FT:mat_peptide JQ341550_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXXAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341551_LHBs_P-B Product feature CHAIN JQ341551_LHBs_P-B of FT:mat_peptide JQ341551_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGXSXXPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341552_LHBs_P-B Product feature CHAIN JQ341552_LHBs_P-B of FT:mat_peptide JQ341552_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPALNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLXPIFFCLWVYI
>gnl|hbvpro|JQ341553_LHBs_P-B Product feature CHAIN JQ341553_LHBs_P-B of FT:mat_peptide JQ341553_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMXWNSSTFHQTLQBPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPXCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWXYX
>gnl|hbvpro|JQ341555_LHBs_P-B Product feature CHAIN JQ341555_LHBs_P-B of FT:mat_peptide JQ341555_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341556_LHBs_P-B Product feature CHAIN JQ341556_LHBs_P-B of FT:mat_peptide JQ341556_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341557_LHBs_P-B Product feature CHAIN JQ341557_LHBs_P-B of FT:mat_peptide JQ341557_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno09). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDXWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSXTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCTKPTDXN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341558_LHBs_P-B Product feature CHAIN JQ341558_LHBs_P-B of FT:mat_peptide JQ341558_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQXMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341559_LHBs_P-B Product feature CHAIN JQ341559_LHBs_P-B of FT:mat_peptide JQ341559_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFXANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCXKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341560_LHBs_P-B Product feature CHAIN JQ341560_LHBs_P-B of FT:mat_peptide JQ341560_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341561_LHBs_P-B Product feature CHAIN JQ341561_LHBs_P-B of FT:mat_peptide JQ341561_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno13). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANQVGXGAFGPGFTPPHGGMLGWSPQ
AQGLXTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGXLXPLLVLQAGFFXXTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAXXTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMXWFWGPSLYNXLRPLIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341562_LHBs_P-B Product feature CHAIN JQ341562_LHBs_P-B of FT:mat_peptide JQ341562_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWFWGXSLYXILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ341563_LHBs_P-B Product feature CHAIN JQ341563_LHBs_P-B of FT:mat_peptide JQ341563_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKXCTTPAQGTSMFPSCCCSKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341564_LHBs_P-B Product feature CHAIN JQ341564_LHBs_P-B of FT:mat_peptide JQ341564_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341565_LHBs_P-B Product feature CHAIN JQ341565_LHBs_P-B of FT:mat_peptide JQ341565_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
XXXXXXXXRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
XQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341566_LHBs_P-B Product feature CHAIN JQ341566_LHBs_P-B of FT:mat_peptide JQ341566_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSXWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341567_LHBs_P-B Product feature CHAIN JQ341567_LHBs_P-B of FT:mat_peptide JQ341567_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDXHPQAMXXNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|JQ341568_LHBs_P-B Product feature CHAIN JQ341568_LHBs_P-B of FT:mat_peptide JQ341568_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341569_LHBs_P-B Product feature CHAIN JQ341569_LHBs_P-B of FT:mat_peptide JQ341569_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341570_LHBs_P-B Product feature CHAIN JQ341570_LHBs_P-B of FT:mat_peptide JQ341570_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSNSGTVSPAQTTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341571_LHBs_P-B Product feature CHAIN JQ341571_LHBs_P-B of FT:mat_peptide JQ341571_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341572_LHBs_P-B Product feature CHAIN JQ341572_LHBs_P-B of FT:mat_peptide JQ341572_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKPNSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
TSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341573_LHBs_P-B Product feature CHAIN JQ341573_LHBs_P-B of FT:mat_peptide JQ341573_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341574_LHBs_P-B Product feature CHAIN JQ341574_LHBs_P-B of FT:mat_peptide JQ341574_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAIKVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341575_LHBs_P-B Product feature CHAIN JQ341575_LHBs_P-B of FT:mat_peptide JQ341575_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341576_LHBs_P-B Product feature CHAIN JQ341576_LHBs_P-B of FT:mat_peptide JQ341576_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPACLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLNNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341577_LHBs_P-B Product feature CHAIN JQ341577_LHBs_P-B of FT:mat_peptide JQ341577_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDSWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGXLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDXN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFXCLWVYX
>gnl|hbvpro|JQ341578_LHBs_P-B Product feature CHAIN JQ341578_LHBs_P-B of FT:mat_peptide JQ341578_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPSHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNSVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341579_LHBs_P-B Product feature CHAIN JQ341579_LHBs_P-B of FT:mat_peptide JQ341579_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341580_LHBs_P-B Product feature CHAIN JQ341580_LHBs_P-B of FT:mat_peptide JQ341580_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRXCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFXCLWVYX
>gnl|hbvpro|JQ341581_LHBs_P-B Product feature CHAIN JQ341581_LHBs_P-B of FT:mat_peptide JQ341581_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGXSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFXGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341582_LHBs_P-B Product feature CHAIN JQ341582_LHBs_P-B of FT:mat_peptide JQ341582_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGGGAFGPGFIPPHGGLLGWSPQ
AQGILTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMXWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAPNTVSA
ISSIXSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|JQ341583_LHBs_P-B Product feature CHAIN JQ341583_LHBs_P-B of FT:mat_peptide JQ341583_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWNSQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341584_LHBs_P-B Product feature CHAIN JQ341584_LHBs_P-B of FT:mat_peptide JQ341584_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341585_LHBs_P-B Product feature CHAIN JQ341585_LHBs_P-B of FT:mat_peptide JQ341585_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno37). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341586_LHBs_P-B Product feature CHAIN JQ341586_LHBs_P-B of FT:mat_peptide JQ341586_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLXPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFXLWVYI
>gnl|hbvpro|JQ341587_LHBs_P-B Product feature CHAIN JQ341587_LHBs_P-B of FT:mat_peptide JQ341587_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGVSSKPRKGMGTNLXVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPADPPPASTNRQSGRKPTPLSPPLRDTHPQAVQWNSTTFHQTLQBPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKIGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEPPVCPGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341588_LHBs_P-B Product feature CHAIN JQ341588_LHBs_P-B of FT:mat_peptide JQ341588_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDYWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341589_LHBs_P-B Product feature CHAIN JQ341589_LHBs_P-B of FT:mat_peptide JQ341589_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
ALGTLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341590_LHBs_P-B Product feature CHAIN JQ341590_LHBs_P-B of FT:mat_peptide JQ341590_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVPTTASS
ISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341591_LHBs_P-B Product feature CHAIN JQ341591_LHBs_P-B of FT:mat_peptide JQ341591_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341592_LHBs_P-B Product feature CHAIN JQ341592_LHBs_P-B of FT:mat_peptide JQ341592_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno44). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=401 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHXDXWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQXGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
X
>gnl|hbvpro|JQ341593_LHBs_P-B Product feature CHAIN JQ341593_LHBs_P-B of FT:mat_peptide JQ341593_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341594_LHBs_P-B Product feature CHAIN JQ341594_LHBs_P-B of FT:mat_peptide JQ341594_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341595_LHBs_P-B Product feature CHAIN JQ341595_LHBs_P-B of FT:mat_peptide JQ341595_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGXLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPXXNMENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLSFLGGTXVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFXLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCXWVYI
>gnl|hbvpro|JQ341596_LHBs_P-B Product feature CHAIN JQ341596_LHBs_P-B of FT:mat_peptide JQ341596_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFXPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGXIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFXKFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ341597_LHBs_P-B Product feature CHAIN JQ341597_LHBs_P-B of FT:mat_peptide JQ341597_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
XXGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMXWNSTXFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341598_LHBs_P-B Product feature CHAIN JQ341598_LHBs_P-B of FT:mat_peptide JQ341598_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ341599_LHBs_P-B Product feature CHAIN JQ341599_LHBs_P-B of FT:mat_peptide JQ341599_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
XXGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMXWNSTXFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341600_LHBs_P-B Product feature CHAIN JQ341600_LHBs_P-B of FT:mat_peptide JQ341600_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGPSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341601_LHBs_P-B Product feature CHAIN JQ341601_LHBs_P-B of FT:mat_peptide JQ341601_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCXKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341603_LHBs_P-B Product feature CHAIN JQ341603_LHBs_P-B of FT:mat_peptide JQ341603_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFXANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVXATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341604_LHBs_P-B Product feature CHAIN JQ341604_LHBs_P-B of FT:mat_peptide JQ341604_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXXWNXXTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341605_LHBs_P-B Product feature CHAIN JQ341605_LHBs_P-B of FT:mat_peptide JQ341605_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno57). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDSHPQAMQWNSXTFLQTLQDPRVRALYFPAGGSSSGTVSPAQITASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341606_LHBs_P-B Product feature CHAIN JQ341606_LHBs_P-B of FT:mat_peptide JQ341606_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno58). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTXVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341607_LHBs_P-B Product feature CHAIN JQ341607_LHBs_P-B of FT:mat_peptide JQ341607_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno59). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSS
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGPSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341608_LHBs_P-B Product feature CHAIN JQ341608_LHBs_P-B of FT:mat_peptide JQ341608_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPLFRANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPSAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDXN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341609_LHBs_P-B Product feature CHAIN JQ341609_LHBs_P-B of FT:mat_peptide JQ341609_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGIHTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ412090_LHBs_P-B Product feature CHAIN JQ412090_LHBs_P-B of FT:mat_peptide JQ412090_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MRGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ412092_LHBs_P-B Product feature CHAIN JQ412092_LHBs_P-B of FT:mat_peptide JQ412092_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRVLYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ429081_LHBs_P-B Product feature CHAIN JQ429081_LHBs_P-B of FT:mat_peptide JQ429081_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=401 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLKDTHPQAVQWNSTTFHQTLQIDPRVRALYLPAGGSSSGTVNPVQNTAS
SISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCC
PPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDG
NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFWVWAY
I
>gnl|hbvpro|JQ429082_LHBs_P-B Product feature CHAIN JQ429082_LHBs_P-B of FT:mat_peptide JQ429082_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.41.591). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTVSS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ688405_LHBs_P-B Product feature CHAIN JQ688405_LHBs_P-B of FT:mat_peptide JQ688405_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ707734_LHBs_P-B Product feature CHAIN JQ707734_LHBs_P-B of FT:mat_peptide JQ707734_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707735_LHBs_P-B Product feature CHAIN JQ707735_LHBs_P-B of FT:mat_peptide JQ707735_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPNLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707737_LHBs_P-B Product feature CHAIN JQ707737_LHBs_P-B of FT:mat_peptide JQ707737_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707738_LHBs_P-B Product feature CHAIN JQ707738_LHBs_P-B of FT:mat_peptide JQ707738_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707739_LHBs_P-B Product feature CHAIN JQ707739_LHBs_P-B of FT:mat_peptide JQ707739_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMISYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707740_LHBs_P-B Product feature CHAIN JQ707740_LHBs_P-B of FT:mat_peptide JQ707740_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_18). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPESSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707742_LHBs_P-B Product feature CHAIN JQ707742_LHBs_P-B of FT:mat_peptide JQ707742_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707743_LHBs_P-B Product feature CHAIN JQ707743_LHBs_P-B of FT:mat_peptide JQ707743_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707744_LHBs_P-B Product feature CHAIN JQ707744_LHBs_P-B of FT:mat_peptide JQ707744_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707745_LHBs_P-B Product feature CHAIN JQ707745_LHBs_P-B of FT:mat_peptide JQ707745_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_23). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707746_LHBs_P-B Product feature CHAIN JQ707746_LHBs_P-B of FT:mat_peptide JQ707746_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_24-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707747_LHBs_P-B Product feature CHAIN JQ707747_LHBs_P-B of FT:mat_peptide JQ707747_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTNTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGPSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707749_LHBs_P-B Product feature CHAIN JQ707749_LHBs_P-B of FT:mat_peptide JQ707749_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707750_LHBs_P-B Product feature CHAIN JQ707750_LHBs_P-B of FT:mat_peptide JQ707750_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707753_LHBs_P-B Product feature CHAIN JQ707753_LHBs_P-B of FT:mat_peptide JQ707753_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_32). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707755_LHBs_P-B Product feature CHAIN JQ707755_LHBs_P-B of FT:mat_peptide JQ707755_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707758_LHBs_P-B Product feature CHAIN JQ707758_LHBs_P-B of FT:mat_peptide JQ707758_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707759_LHBs_P-B Product feature CHAIN JQ707759_LHBs_P-B of FT:mat_peptide JQ707759_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707762_LHBs_P-B Product feature CHAIN JQ707762_LHBs_P-B of FT:mat_peptide JQ707762_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_46). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707763_LHBs_P-B Product feature CHAIN JQ707763_LHBs_P-B of FT:mat_peptide JQ707763_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707764_LHBs_P-B Product feature CHAIN JQ707764_LHBs_P-B of FT:mat_peptide JQ707764_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707765_LHBs_P-B Product feature CHAIN JQ707765_LHBs_P-B of FT:mat_peptide JQ707765_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707766_LHBs_P-B Product feature CHAIN JQ707766_LHBs_P-B of FT:mat_peptide JQ707766_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707767_LHBs_P-B Product feature CHAIN JQ707767_LHBs_P-B of FT:mat_peptide JQ707767_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASA
ISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ801471_LHBs_P-B Product feature CHAIN JQ801471_LHBs_P-B of FT:mat_peptide JQ801471_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801474_LHBs_P-B Product feature CHAIN JQ801474_LHBs_P-B of FT:mat_peptide JQ801474_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
TSSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801479_LHBs_P-B Product feature CHAIN JQ801479_LHBs_P-B of FT:mat_peptide JQ801479_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSKNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801485_LHBs_P-B Product feature CHAIN JQ801485_LHBs_P-B of FT:mat_peptide JQ801485_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS32). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWTDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ801494_LHBs_P-B Product feature CHAIN JQ801494_LHBs_P-B of FT:mat_peptide JQ801494_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTGPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSRTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEKTVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801506_LHBs_P-B Product feature CHAIN JQ801506_LHBs_P-B of FT:mat_peptide JQ801506_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAPNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801507_LHBs_P-B Product feature CHAIN JQ801507_LHBs_P-B of FT:mat_peptide JQ801507_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=395 residues).
IKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGLF
TTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIL
SKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPG
YRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIP
IPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801512_LHBs_P-B Product feature CHAIN JQ801512_LHBs_P-B of FT:mat_peptide JQ801512_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801514_LHBs_P-B Product feature CHAIN JQ801514_LHBs_P-B of FT:mat_peptide JQ801514_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801516_LHBs_P-B Product feature CHAIN JQ801516_LHBs_P-B of FT:mat_peptide JQ801516_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ801524_LHBs_P-B Product feature CHAIN JQ801524_LHBs_P-B of FT:mat_peptide JQ801524_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL32). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWYSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGAGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX026879_LHBs_P-B Product feature CHAIN JX026879_LHBs_P-B of FT:mat_peptide JX026879_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLPVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAASPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVSNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGH
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX026881_LHBs_P-B Product feature CHAIN JX026881_LHBs_P-B of FT:mat_peptide JX026881_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
SQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTQPTDRN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX026883_LHBs_P-B Product feature CHAIN JX026883_LHBs_P-B of FT:mat_peptide JX026883_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-50). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGLTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASANRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFLCLWVYM
>gnl|hbvpro|JX026886_LHBs_P-B Product feature CHAIN JX026886_LHBs_P-B of FT:mat_peptide JX026886_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-73). Complete genome. [Hepadnaviridae] (length=398 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
ALGMVTTVPAAPPPASTNRQSGRQPTPISPPLRDTQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAIS
SILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPPI
CPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCT
CIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JX429897_LHBs_P-B Product feature CHAIN JX429897_LHBs_P-B of FT:mat_peptide JX429897_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDADKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGETLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTRTTPAQRTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429899_LHBs_P-B Product feature CHAIN JX429899_LHBs_P-B of FT:mat_peptide JX429899_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLFPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429900_LHBs_P-B Product feature CHAIN JX429900_LHBs_P-B of FT:mat_peptide JX429900_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429901_LHBs_P-B Product feature CHAIN JX429901_LHBs_P-B of FT:mat_peptide JX429901_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDDWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFMPLLPIFFGLWVYI
>gnl|hbvpro|JX429902_LHBs_P-B Product feature CHAIN JX429902_LHBs_P-B of FT:mat_peptide JX429902_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429908_LHBs_P-B Product feature CHAIN JX429908_LHBs_P-B of FT:mat_peptide JX429908_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JX429910_LHBs_P-B Product feature CHAIN JX429910_LHBs_P-B of FT:mat_peptide JX429910_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-67). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWTCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429911_LHBs_P-B Product feature CHAIN JX429911_LHBs_P-B of FT:mat_peptide JX429911_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-45). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENSDWDLNSHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX504531_LHBs_P-B Product feature CHAIN JX504531_LHBs_P-B of FT:mat_peptide JX504531_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
SQVLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVKWNPTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX504532_LHBs_P-B Product feature CHAIN JX504532_LHBs_P-B of FT:mat_peptide JX504532_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPALNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPKLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX504533_LHBs_P-B Product feature CHAIN JX504533_LHBs_P-B of FT:mat_peptide JX504533_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQDIQWNSTTFHQTLQDPRVRALYIPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYS
>gnl|hbvpro|JX504538_LHBs_P-B Product feature CHAIN JX504538_LHBs_P-B of FT:mat_peptide JX504538_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-65). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTLPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLISLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|JX504543_LHBs_P-B Product feature CHAIN JX504543_LHBs_P-B of FT:mat_peptide JX504543_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NNJ-19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPHAMQGISITFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTRCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX507210_LHBs_P-B Product feature CHAIN JX507210_LHBs_P-B of FT:mat_peptide JX507210_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX507213_LHBs_P-B Product feature CHAIN JX507213_LHBs_P-B of FT:mat_peptide JX507213_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 82). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX507215_LHBs_P-B Product feature CHAIN JX507215_LHBs_P-B of FT:mat_peptide JX507215_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 310). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661470_LHBs_P-B Product feature CHAIN JX661470_LHBs_P-B of FT:mat_peptide JX661470_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1221-B12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661471_LHBs_P-B Product feature CHAIN JX661471_LHBs_P-B of FT:mat_peptide JX661471_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1202-B1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661472_LHBs_P-B Product feature CHAIN JX661472_LHBs_P-B of FT:mat_peptide JX661472_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1224-B13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPTAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661473_LHBs_P-B Product feature CHAIN JX661473_LHBs_P-B of FT:mat_peptide JX661473_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1220-B11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661474_LHBs_P-B Product feature CHAIN JX661474_LHBs_P-B of FT:mat_peptide JX661474_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1229-B15). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661475_LHBs_P-B Product feature CHAIN JX661475_LHBs_P-B of FT:mat_peptide JX661475_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1216-B9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661476_LHBs_P-B Product feature CHAIN JX661476_LHBs_P-B of FT:mat_peptide JX661476_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1227-B14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSETPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661477_LHBs_P-B Product feature CHAIN JX661477_LHBs_P-B of FT:mat_peptide JX661477_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1209-B5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661478_LHBs_P-B Product feature CHAIN JX661478_LHBs_P-B of FT:mat_peptide JX661478_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1211-B7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX661479_LHBs_P-B Product feature CHAIN JX661479_LHBs_P-B of FT:mat_peptide JX661479_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1219-B10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661480_LHBs_P-B Product feature CHAIN JX661480_LHBs_P-B of FT:mat_peptide JX661480_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1210-B6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661481_LHBs_P-B Product feature CHAIN JX661481_LHBs_P-B of FT:mat_peptide JX661481_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1214-B8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661482_LHBs_P-B Product feature CHAIN JX661482_LHBs_P-B of FT:mat_peptide JX661482_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1204-B2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX661483_LHBs_P-B Product feature CHAIN JX661483_LHBs_P-B of FT:mat_peptide JX661483_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1205-B3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661484_LHBs_P-B Product feature CHAIN JX661484_LHBs_P-B of FT:mat_peptide JX661484_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1206-B4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX869998_LHBs_P-B Product feature CHAIN JX869998_LHBs_P-B of FT:mat_peptide JX869998_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 317). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKIGDPVPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX869999_LHBs_P-B Product feature CHAIN JX869999_LHBs_P-B of FT:mat_peptide JX869999_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX870001_LHBs_P-B Product feature CHAIN JX870001_LHBs_P-B of FT:mat_peptide JX870001_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 90). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSXRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPVQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX978431_LHBs_P-B Product feature CHAIN JX978431_LHBs_P-B of FT:mat_peptide JX978431_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate X02). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC492739_LHBs_P-B Product feature CHAIN KC492739_LHBs_P-B of FT:mat_peptide KC492739_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MT). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510641_LHBs_P-B Product feature CHAIN KC510641_LHBs_P-B of FT:mat_peptide KC510641_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510642_LHBs_P-B Product feature CHAIN KC510642_LHBs_P-B of FT:mat_peptide KC510642_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASANRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510643_LHBs_P-B Product feature CHAIN KC510643_LHBs_P-B of FT:mat_peptide KC510643_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510644_LHBs_P-B Product feature CHAIN KC510644_LHBs_P-B of FT:mat_peptide KC510644_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510646_LHBs_P-B Product feature CHAIN KC510646_LHBs_P-B of FT:mat_peptide KC510646_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLHPAFKANSENPDWDLNPHKDNWPGANKVGVGAFGPRFTPPHGVLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDAN
CTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510647_LHBs_P-B Product feature CHAIN KC510647_LHBs_P-B of FT:mat_peptide KC510647_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510648_LHBs_P-B Product feature CHAIN KC510648_LHBs_P-B of FT:mat_peptide KC510648_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510649_LHBs_P-B Product feature CHAIN KC510649_LHBs_P-B of FT:mat_peptide KC510649_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASANRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510650_LHBs_P-B Product feature CHAIN KC510650_LHBs_P-B of FT:mat_peptide KC510650_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLHPAFKANSENPDWDLNPHKDNWPGANKVGVGAFGPRFTPPHGVLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510651_LHBs_P-B Product feature CHAIN KC510651_LHBs_P-B of FT:mat_peptide KC510651_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510652_LHBs_P-B Product feature CHAIN KC510652_LHBs_P-B of FT:mat_peptide KC510652_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510653_LHBs_P-B Product feature CHAIN KC510653_LHBs_P-B of FT:mat_peptide KC510653_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510654_LHBs_P-B Product feature CHAIN KC510654_LHBs_P-B of FT:mat_peptide KC510654_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASANRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510655_LHBs_P-B Product feature CHAIN KC510655_LHBs_P-B of FT:mat_peptide KC510655_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510656_LHBs_P-B Product feature CHAIN KC510656_LHBs_P-B of FT:mat_peptide KC510656_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASANRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510657_LHBs_P-B Product feature CHAIN KC510657_LHBs_P-B of FT:mat_peptide KC510657_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510658_LHBs_P-B Product feature CHAIN KC510658_LHBs_P-B of FT:mat_peptide KC510658_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510659_LHBs_P-B Product feature CHAIN KC510659_LHBs_P-B of FT:mat_peptide KC510659_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510660_LHBs_P-B Product feature CHAIN KC510660_LHBs_P-B of FT:mat_peptide KC510660_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPLMPLLPIFFCLWVYI
>gnl|hbvpro|KC774362_LHBs_P-B Product feature CHAIN KC774362_LHBs_P-B of FT:mat_peptide KC774362_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz1107). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|KC774363_LHBs_P-B Product feature CHAIN KC774363_LHBs_P-B of FT:mat_peptide KC774363_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2022). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774365_LHBs_P-B Product feature CHAIN KC774365_LHBs_P-B of FT:mat_peptide KC774365_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2113). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774366_LHBs_P-B Product feature CHAIN KC774366_LHBs_P-B of FT:mat_peptide KC774366_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2116). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774367_LHBs_P-B Product feature CHAIN KC774367_LHBs_P-B of FT:mat_peptide KC774367_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2147). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774368_LHBs_P-B Product feature CHAIN KC774368_LHBs_P-B of FT:mat_peptide KC774368_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1012). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774369_LHBs_P-B Product feature CHAIN KC774369_LHBs_P-B of FT:mat_peptide KC774369_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1013). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774370_LHBs_P-B Product feature CHAIN KC774370_LHBs_P-B of FT:mat_peptide KC774370_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1014). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774371_LHBs_P-B Product feature CHAIN KC774371_LHBs_P-B of FT:mat_peptide KC774371_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1036). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774372_LHBs_P-B Product feature CHAIN KC774372_LHBs_P-B of FT:mat_peptide KC774372_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1040). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774373_LHBs_P-B Product feature CHAIN KC774373_LHBs_P-B of FT:mat_peptide KC774373_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1044). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774374_LHBs_P-B Product feature CHAIN KC774374_LHBs_P-B of FT:mat_peptide KC774374_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1053). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774375_LHBs_P-B Product feature CHAIN KC774375_LHBs_P-B of FT:mat_peptide KC774375_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1055). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSV
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774376_LHBs_P-B Product feature CHAIN KC774376_LHBs_P-B of FT:mat_peptide KC774376_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1056). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAIKVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774377_LHBs_P-B Product feature CHAIN KC774377_LHBs_P-B of FT:mat_peptide KC774377_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1064). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWGPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPFSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774378_LHBs_P-B Product feature CHAIN KC774378_LHBs_P-B of FT:mat_peptide KC774378_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1015). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774379_LHBs_P-B Product feature CHAIN KC774379_LHBs_P-B of FT:mat_peptide KC774379_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1023). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774380_LHBs_P-B Product feature CHAIN KC774380_LHBs_P-B of FT:mat_peptide KC774380_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1033). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSP
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDAN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774381_LHBs_P-B Product feature CHAIN KC774381_LHBs_P-B of FT:mat_peptide KC774381_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1062). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774382_LHBs_P-B Product feature CHAIN KC774382_LHBs_P-B of FT:mat_peptide KC774382_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1063). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774383_LHBs_P-B Product feature CHAIN KC774383_LHBs_P-B of FT:mat_peptide KC774383_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1081). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774384_LHBs_P-B Product feature CHAIN KC774384_LHBs_P-B of FT:mat_peptide KC774384_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1091). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774385_LHBs_P-B Product feature CHAIN KC774385_LHBs_P-B of FT:mat_peptide KC774385_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1099). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774386_LHBs_P-B Product feature CHAIN KC774386_LHBs_P-B of FT:mat_peptide KC774386_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1101). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPAATNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774387_LHBs_P-B Product feature CHAIN KC774387_LHBs_P-B of FT:mat_peptide KC774387_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1104). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774388_LHBs_P-B Product feature CHAIN KC774388_LHBs_P-B of FT:mat_peptide KC774388_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1116). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774389_LHBs_P-B Product feature CHAIN KC774389_LHBs_P-B of FT:mat_peptide KC774389_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1121). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774390_LHBs_P-B Product feature CHAIN KC774390_LHBs_P-B of FT:mat_peptide KC774390_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2158). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774391_LHBs_P-B Product feature CHAIN KC774391_LHBs_P-B of FT:mat_peptide KC774391_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2163). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNGQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774392_LHBs_P-B Product feature CHAIN KC774392_LHBs_P-B of FT:mat_peptide KC774392_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2169). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774393_LHBs_P-B Product feature CHAIN KC774393_LHBs_P-B of FT:mat_peptide KC774393_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1068). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774394_LHBs_P-B Product feature CHAIN KC774394_LHBs_P-B of FT:mat_peptide KC774394_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1070). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774395_LHBs_P-B Product feature CHAIN KC774395_LHBs_P-B of FT:mat_peptide KC774395_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1073). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTNVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774396_LHBs_P-B Product feature CHAIN KC774396_LHBs_P-B of FT:mat_peptide KC774396_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1182). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774397_LHBs_P-B Product feature CHAIN KC774397_LHBs_P-B of FT:mat_peptide KC774397_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1185). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDSHPQAMKWNSPTFHQTLQDPRVRALYHPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLVNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774398_LHBs_P-B Product feature CHAIN KC774398_LHBs_P-B of FT:mat_peptide KC774398_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1202). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLFTTVPAAPPPAATNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774399_LHBs_P-B Product feature CHAIN KC774399_LHBs_P-B of FT:mat_peptide KC774399_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1556). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774400_LHBs_P-B Product feature CHAIN KC774400_LHBs_P-B of FT:mat_peptide KC774400_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1585). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774401_LHBs_P-B Product feature CHAIN KC774401_LHBs_P-B of FT:mat_peptide KC774401_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1663). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774402_LHBs_P-B Product feature CHAIN KC774402_LHBs_P-B of FT:mat_peptide KC774402_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1670). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774403_LHBs_P-B Product feature CHAIN KC774403_LHBs_P-B of FT:mat_peptide KC774403_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774404_LHBs_P-B Product feature CHAIN KC774404_LHBs_P-B of FT:mat_peptide KC774404_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774405_LHBs_P-B Product feature CHAIN KC774405_LHBs_P-B of FT:mat_peptide KC774405_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2005). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPARNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774406_LHBs_P-B Product feature CHAIN KC774406_LHBs_P-B of FT:mat_peptide KC774406_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774407_LHBs_P-B Product feature CHAIN KC774407_LHBs_P-B of FT:mat_peptide KC774407_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2011). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDSWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774408_LHBs_P-B Product feature CHAIN KC774408_LHBs_P-B of FT:mat_peptide KC774408_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2012). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774409_LHBs_P-B Product feature CHAIN KC774409_LHBs_P-B of FT:mat_peptide KC774409_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2013). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774410_LHBs_P-B Product feature CHAIN KC774410_LHBs_P-B of FT:mat_peptide KC774410_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2018). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQSIFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774411_LHBs_P-B Product feature CHAIN KC774411_LHBs_P-B of FT:mat_peptide KC774411_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2025). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPEANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774412_LHBs_P-B Product feature CHAIN KC774412_LHBs_P-B of FT:mat_peptide KC774412_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2034). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWVWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774413_LHBs_P-B Product feature CHAIN KC774413_LHBs_P-B of FT:mat_peptide KC774413_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2037). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774415_LHBs_P-B Product feature CHAIN KC774415_LHBs_P-B of FT:mat_peptide KC774415_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2064). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774416_LHBs_P-B Product feature CHAIN KC774416_LHBs_P-B of FT:mat_peptide KC774416_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1016). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774417_LHBs_P-B Product feature CHAIN KC774417_LHBs_P-B of FT:mat_peptide KC774417_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1028). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDIWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGLLTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774418_LHBs_P-B Product feature CHAIN KC774418_LHBs_P-B of FT:mat_peptide KC774418_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1055). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASS
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774419_LHBs_P-B Product feature CHAIN KC774419_LHBs_P-B of FT:mat_peptide KC774419_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1083). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792648_LHBs_P-B Product feature CHAIN KC792648_LHBs_P-B of FT:mat_peptide KC792648_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0001). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQSSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVFI
>gnl|hbvpro|KC792649_LHBs_P-B Product feature CHAIN KC792649_LHBs_P-B of FT:mat_peptide KC792649_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0002). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKXNSENPDWDLNPHKDNWXXANNXGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSXLGXTXVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792650_LHBs_P-B Product feature CHAIN KC792650_LHBs_P-B of FT:mat_peptide KC792650_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0003). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDFNXHKDNWPDANKVGXGAFGLGXTPPHGGLLGWSPQ
AQGLLTTVPXAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQBPXVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIXSGLLGPLLVLQAGFFSLIKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792651_LHBs_P-B Product feature CHAIN KC792651_LHBs_P-B of FT:mat_peptide KC792651_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0004). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWXSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGPVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792652_LHBs_P-B Product feature CHAIN KC792652_LHBs_P-B of FT:mat_peptide KC792652_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFKANSENPDWDLNXHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDXXGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSXLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|KC792654_LHBs_P-B Product feature CHAIN KC792654_LHBs_P-B of FT:mat_peptide KC792654_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0007). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSXPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTXHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLNXLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792657_LHBs_P-B Product feature CHAIN KC792657_LHBs_P-B of FT:mat_peptide KC792657_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0010). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLXPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFLCLWVYM
>gnl|hbvpro|KC792659_LHBs_P-B Product feature CHAIN KC792659_LHBs_P-B of FT:mat_peptide KC792659_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0012). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKDNWQDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSKTGDPVPNMENITSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPXCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLXLLDYQGMLXVCPLIPGSSTTSTGPCKTCTTPAQGTSMXPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYXILSPFXPLXPIFFCLWVYI
>gnl|hbvpro|KC792660_LHBs_P-B Product feature CHAIN KC792660_LHBs_P-B of FT:mat_peptide KC792660_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0013). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWQDNNKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNIWSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792661_LHBs_P-B Product feature CHAIN KC792661_LHBs_P-B of FT:mat_peptide KC792661_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0014). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAXPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPGCLGQNSQSQIXSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792662_LHBs_P-B Product feature CHAIN KC792662_LHBs_P-B of FT:mat_peptide KC792662_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0015). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXXPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAIKWNSXTFHQTLQDPKVRXLYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGXLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PXCPGYRWMYLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSXIWMMWYWGQSLXXILSPFIPLLXIFFCLWVYI
>gnl|hbvpro|KC792663_LHBs_P-B Product feature CHAIN KC792663_LHBs_P-B of FT:mat_peptide KC792663_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0016). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWXPQ
XQGXLTTXPAAPPPASTNRQSGRQPTPXSPPLRDTHPQAMXWNXTTXHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLFPIFFCLWVYI
>gnl|hbvpro|KC792664_LHBs_P-B Product feature CHAIN KC792664_LHBs_P-B of FT:mat_peptide KC792664_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIKWNSPTFHKTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792665_LHBs_P-B Product feature CHAIN KC792665_LHBs_P-B of FT:mat_peptide KC792665_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0018). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDXXPDANKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTXXCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792666_LHBs_P-B Product feature CHAIN KC792666_LHBs_P-B of FT:mat_peptide KC792666_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0019). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQTSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792667_LHBs_P-B Product feature CHAIN KC792667_LHBs_P-B of FT:mat_peptide KC792667_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0020). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDSNKVGVGAFGPGFIPPHGGXLGWSPQ
AQGILTXVPAAPPTASTNRQSGRQPTPISXPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792668_LHBs_P-B Product feature CHAIN KC792668_LHBs_P-B of FT:mat_peptide KC792668_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0021). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792671_LHBs_P-B Product feature CHAIN KC792671_LHBs_P-B of FT:mat_peptide KC792671_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0024). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFRANSENPDWDLNQHKDNWPDANKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
VSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEPPGCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFYWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792674_LHBs_P-B Product feature CHAIN KC792674_LHBs_P-B of FT:mat_peptide KC792674_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0027). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792675_LHBs_P-B Product feature CHAIN KC792675_LHBs_P-B of FT:mat_peptide KC792675_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0028). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSX
XXXXSSXTGDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAXAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILXPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792676_LHBs_P-B Product feature CHAIN KC792676_LHBs_P-B of FT:mat_peptide KC792676_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0029). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGILXTVPAAPPPASTNRQSGRXPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNXVSX
XSSXSXTTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLXVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPXFLCLWVYI
>gnl|hbvpro|KC792677_LHBs_P-B Product feature CHAIN KC792677_LHBs_P-B of FT:mat_peptide KC792677_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0030). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKBNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPFSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPXMENIASGLLGPLLVLQAGFFLLTKILTIPXSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTXAXGTSMFPSCCCTKPTDGN
CTCIPIPSSWXFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILXPFMPLLXIFFCLWVYI
>gnl|hbvpro|KC792678_LHBs_P-B Product feature CHAIN KC792678_LHBs_P-B of FT:mat_peptide KC792678_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0031). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQSSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVFI
>gnl|hbvpro|KC792681_LHBs_P-B Product feature CHAIN KC792681_LHBs_P-B of FT:mat_peptide KC792681_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792683_LHBs_P-B Product feature CHAIN KC792683_LHBs_P-B of FT:mat_peptide KC792683_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0036). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDXNKVGVGAFGPGFIPPHGGLLGWSPQ
AQGIXTTVPAAPPPASTNRQSGRQPTPFSPPLRDTHPQAVXWNSXTFLQTLQDPRVRALXXPAGGSSSGTVSPAQXTVST
ISSIXSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPXCLGQNSQSQISSHSPTCCP
PICPGYRLMCLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLXIFXCLWVYI
>gnl|hbvpro|KC792684_LHBs_P-B Product feature CHAIN KC792684_LHBs_P-B of FT:mat_peptide KC792684_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0037). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792685_LHBs_P-B Product feature CHAIN KC792685_LHBs_P-B of FT:mat_peptide KC792685_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0038). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792686_LHBs_P-B Product feature CHAIN KC792686_LHBs_P-B of FT:mat_peptide KC792686_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFXPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792687_LHBs_P-B Product feature CHAIN KC792687_LHBs_P-B of FT:mat_peptide KC792687_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0040). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPHAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792688_LHBs_P-B Product feature CHAIN KC792688_LHBs_P-B of FT:mat_peptide KC792688_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0041). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=401 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKDNWPBANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGIXTTVPAAPPPASTNRQSGRRQPTPXSPPLRDTXXQTMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVS
VXSSTLSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCC
PPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDG
NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVY
I
>gnl|hbvpro|KC792689_LHBs_P-B Product feature CHAIN KC792689_LHBs_P-B of FT:mat_peptide KC792689_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0042). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAXPPPASTNRQSGRQPTPLSPPLRDTHPQXMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792692_LHBs_P-B Product feature CHAIN KC792692_LHBs_P-B of FT:mat_peptide KC792692_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0045). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGXTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDXRVRALYLPAGGSNSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTYCP
PICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLFPIFFCLWVYI
>gnl|hbvpro|KC792693_LHBs_P-B Product feature CHAIN KC792693_LHBs_P-B of FT:mat_peptide KC792693_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0046). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=395 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDXWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGLLTTXPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTXXXTLQBPRVPAGGSSSETVSPAQNTVSAISSIL
STTGDPVPNMENITSGLLGPLLVLQXGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPG
YRWMYLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIP
IPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792694_LHBs_P-B Product feature CHAIN KC792694_LHBs_P-B of FT:mat_peptide KC792694_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0047). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPRCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSTKPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPXXPLLPIFFCLWXYI
>gnl|hbvpro|KC792696_LHBs_P-B Product feature CHAIN KC792696_LHBs_P-B of FT:mat_peptide KC792696_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0049). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQICSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNILSPFMPLFSIFFCLWVYI
>gnl|hbvpro|KC792697_LHBs_P-B Product feature CHAIN KC792697_LHBs_P-B of FT:mat_peptide KC792697_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0050). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVAVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792698_LHBs_P-B Product feature CHAIN KC792698_LHBs_P-B of FT:mat_peptide KC792698_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0051). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792699_LHBs_P-B Product feature CHAIN KC792699_LHBs_P-B of FT:mat_peptide KC792699_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0052). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGXWSSXPRXGMGTNLXVPNPLGFFPDHQLDPXFXANSENPDWDLNPHKDNWPDAXKVGVGAFGPGFXPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPLSPPLRXTHPQAXXWNSTTFQQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIAXGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISXHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPSDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792701_LHBs_P-B Product feature CHAIN KC792701_LHBs_P-B of FT:mat_peptide KC792701_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0054). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTXHQTLQDPRVRALXXPAGGSSSGTVSPAQNTVSA
ISSILXKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC792702_LHBs_P-B Product feature CHAIN KC792702_LHBs_P-B of FT:mat_peptide KC792702_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0055). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792703_LHBs_P-B Product feature CHAIN KC792703_LHBs_P-B of FT:mat_peptide KC792703_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0056). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGAGAFGPGFXPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASARFSWLSXLVPFVQWFVGLSPTVWLSVIWMILYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792705_LHBs_P-B Product feature CHAIN KC792705_LHBs_P-B of FT:mat_peptide KC792705_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0058). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGXSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGXGAFGPGXTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSXXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNXQSQISSHSPTCCP
PXCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792709_LHBs_P-B Product feature CHAIN KC792709_LHBs_P-B of FT:mat_peptide KC792709_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0062). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAKKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMLPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792711_LHBs_P-B Product feature CHAIN KC792711_LHBs_P-B of FT:mat_peptide KC792711_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGMLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792712_LHBs_P-B Product feature CHAIN KC792712_LHBs_P-B of FT:mat_peptide KC792712_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0065). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGVVPPHGGLLGWSPQ
AQGILTNVPAAPPPASTNRQSGRKPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQSSQSQISNHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792714_LHBs_P-B Product feature CHAIN KC792714_LHBs_P-B of FT:mat_peptide KC792714_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0067). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792715_LHBs_P-B Product feature CHAIN KC792715_LHBs_P-B of FT:mat_peptide KC792715_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0068). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPLFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCXGQNSQSQISSHLLTCCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792717_LHBs_P-B Product feature CHAIN KC792717_LHBs_P-B of FT:mat_peptide KC792717_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0070). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
TSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792718_LHBs_P-B Product feature CHAIN KC792718_LHBs_P-B of FT:mat_peptide KC792718_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0071). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVSA
ISSXXSTTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792719_LHBs_P-B Product feature CHAIN KC792719_LHBs_P-B of FT:mat_peptide KC792719_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0072). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792720_LHBs_P-B Product feature CHAIN KC792720_LHBs_P-B of FT:mat_peptide KC792720_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0073). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRKPTPLXPPLRDTHPQAMQWNSXTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792721_LHBs_P-B Product feature CHAIN KC792721_LHBs_P-B of FT:mat_peptide KC792721_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0074). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNXPBXXKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTLPAAPPPASTNRQSGRQPTPLSPPXRDTHPQAMXWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILXXTGDPVXNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPXXYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792722_LHBs_P-B Product feature CHAIN KC792722_LHBs_P-B of FT:mat_peptide KC792722_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0075). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGVSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPXKDYWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWISLNFLGGTPVCLGQNSQSQISSHSPTCCP
QTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792723_LHBs_P-B Product feature CHAIN KC792723_LHBs_P-B of FT:mat_peptide KC792723_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0076). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=401 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLSFLGXTPXCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRXIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEXASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFMPLLXIFFCLWVYI
X
>gnl|hbvpro|KC792724_LHBs_P-B Product feature CHAIN KC792724_LHBs_P-B of FT:mat_peptide KC792724_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0077). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAIQWNSTTFHXTLQDPRVRALYXPAGGSSSGTVXPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGPSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|KC792725_LHBs_P-B Product feature CHAIN KC792725_LHBs_P-B of FT:mat_peptide KC792725_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0078). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTTXHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792726_LHBs_P-B Product feature CHAIN KC792726_LHBs_P-B of FT:mat_peptide KC792726_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0079). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYXTLSPFMPLLPXFFCLWVYI
>gnl|hbvpro|KC792727_LHBs_P-B Product feature CHAIN KC792727_LHBs_P-B of FT:mat_peptide KC792727_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0080). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792728_LHBs_P-B Product feature CHAIN KC792728_LHBs_P-B of FT:mat_peptide KC792728_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0081). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPVANKVGVGAFGPGFTPPHGGLLGWSPQ
ALGLLTTAPAAPPPASTNRKSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSSLSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792729_LHBs_P-B Product feature CHAIN KC792729_LHBs_P-B of FT:mat_peptide KC792729_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0082). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGLFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792730_LHBs_P-B Product feature CHAIN KC792730_LHBs_P-B of FT:mat_peptide KC792730_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0083). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTXVCXGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792731_LHBs_P-B Product feature CHAIN KC792731_LHBs_P-B of FT:mat_peptide KC792731_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792733_LHBs_P-B Product feature CHAIN KC792733_LHBs_P-B of FT:mat_peptide KC792733_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0086). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSTLSTTGDLVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPQIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792735_LHBs_P-B Product feature CHAIN KC792735_LHBs_P-B of FT:mat_peptide KC792735_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENSDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792736_LHBs_P-B Product feature CHAIN KC792736_LHBs_P-B of FT:mat_peptide KC792736_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0089). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792737_LHBs_P-B Product feature CHAIN KC792737_LHBs_P-B of FT:mat_peptide KC792737_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0090). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSPISSHLPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792738_LHBs_P-B Product feature CHAIN KC792738_LHBs_P-B of FT:mat_peptide KC792738_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0091). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDXWPDANKVGVGAFGPGFIPPHGGLLGWNPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTXFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792741_LHBs_P-B Product feature CHAIN KC792741_LHBs_P-B of FT:mat_peptide KC792741_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0094). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGXSPQ
AQGILTTVPAAPPPASTNRKSGRQPTPLXPPLRDXHPQAXXWNTTTFHQTLQDXRVRALYFPAGGSSSXTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTXAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792742_LHBs_P-B Product feature CHAIN KC792742_LHBs_P-B of FT:mat_peptide KC792742_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0095). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792743_LHBs_P-B Product feature CHAIN KC792743_LHBs_P-B of FT:mat_peptide KC792743_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0096). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLPXCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792744_LHBs_P-B Product feature CHAIN KC792744_LHBs_P-B of FT:mat_peptide KC792744_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSXAQNTVSA
ISSXLSXTGDPVPNMENITSGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLXFLGXTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792745_LHBs_P-B Product feature CHAIN KC792745_LHBs_P-B of FT:mat_peptide KC792745_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKDNWPDANKVGVGAFGPGVTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVKWNSTTFHQTLQNPRVRALYXPAGGSSSXTVSPAQNTVSA
ISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792747_LHBs_P-B Product feature CHAIN KC792747_LHBs_P-B of FT:mat_peptide KC792747_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0100). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792748_LHBs_P-B Product feature CHAIN KC792748_LHBs_P-B of FT:mat_peptide KC792748_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0101). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLXGWSPQ
AQGXLTTVPAAPPPASTNRXSGRXPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSXXSXTGDPVXNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792749_LHBs_P-B Product feature CHAIN KC792749_LHBs_P-B of FT:mat_peptide KC792749_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXXAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792750_LHBs_P-B Product feature CHAIN KC792750_LHBs_P-B of FT:mat_peptide KC792750_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVQAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPGCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792752_LHBs_P-B Product feature CHAIN KC792752_LHBs_P-B of FT:mat_peptide KC792752_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0105). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLXVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILXTVQXAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGSSSGAVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISXHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPNLYNXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792754_LHBs_P-B Product feature CHAIN KC792754_LHBs_P-B of FT:mat_peptide KC792754_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKDNWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792755_LHBs_P-B Product feature CHAIN KC792755_LHBs_P-B of FT:mat_peptide KC792755_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0108). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPXPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792756_LHBs_P-B Product feature CHAIN KC792756_LHBs_P-B of FT:mat_peptide KC792756_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWXDANKVGAGAFGPGFTPPHGGLLGWNPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISXHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792758_LHBs_P-B Product feature CHAIN KC792758_LHBs_P-B of FT:mat_peptide KC792758_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0111). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPXGGSSSXTASPAQNTVSA
ISSXLSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792760_LHBs_P-B Product feature CHAIN KC792760_LHBs_P-B of FT:mat_peptide KC792760_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0113). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDTQPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSXTVSPAQNTVSA
ISSILSXIGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQXSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792761_LHBs_P-B Product feature CHAIN KC792761_LHBs_P-B of FT:mat_peptide KC792761_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0114). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTXRQSGRQPTPLSPPLRDTHPQAMQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFXGETPVCLGQNSQSQISSHSXTCCP
PICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792763_LHBs_P-B Product feature CHAIN KC792763_LHBs_P-B of FT:mat_peptide KC792763_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0116). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILXTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792764_LHBs_P-B Product feature CHAIN KC792764_LHBs_P-B of FT:mat_peptide KC792764_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0117). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPSAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSLAQNTVSA
ISSILSTTGDPVPNMDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLEGTXGCRGQNSQSQIXSHSPTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792765_LHBs_P-B Product feature CHAIN KC792765_LHBs_P-B of FT:mat_peptide KC792765_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0118). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDXNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQXNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSA
ISSILSKTGDPVXNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSTFPSCCCTKPTDGN
CTCIPIPSSLAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792766_LHBs_P-B Product feature CHAIN KC792766_LHBs_P-B of FT:mat_peptide KC792766_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHNDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792767_LHBs_P-B Product feature CHAIN KC792767_LHBs_P-B of FT:mat_peptide KC792767_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0120). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLICLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792768_LHBs_P-B Product feature CHAIN KC792768_LHBs_P-B of FT:mat_peptide KC792768_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792769_LHBs_P-B Product feature CHAIN KC792769_LHBs_P-B of FT:mat_peptide KC792769_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0122). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFXPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFLQTLXDPRVRALYLPAGGSXSGTVSPAQNTVSA
ISSXFSXTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGXNSQSQISSHSPTCCP
PICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792770_LHBs_P-B Product feature CHAIN KC792770_LHBs_P-B of FT:mat_peptide KC792770_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0123). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFXPXHQLDPAFKANSKNPDWDLNPHKDNWPBANKVGVGAFGPGFTPPHGGLLGWSXQ
AQGLLTTVPAAPPPASTNRQSXRXPTPLTPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYSPAGGSSSGTVSPAQNTVSX
XSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFGGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792772_LHBs_P-B Product feature CHAIN KC792772_LHBs_P-B of FT:mat_peptide KC792772_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0125). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENSDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDXAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792773_LHBs_P-B Product feature CHAIN KC792773_LHBs_P-B of FT:mat_peptide KC792773_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0126). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792774_LHBs_P-B Product feature CHAIN KC792774_LHBs_P-B of FT:mat_peptide KC792774_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0127). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAWKVGVGAFGPGFVPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGXTXVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792777_LHBs_P-B Product feature CHAIN KC792777_LHBs_P-B of FT:mat_peptide KC792777_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0130). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPEANKVGVGAFGPGFTPPHGGLLGWSPQ
ALGILTXVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNXTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSTTGDPVXNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWXSLNFRGGTPECLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792778_LHBs_P-B Product feature CHAIN KC792778_LHBs_P-B of FT:mat_peptide KC792778_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0131). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDXNKVGVGAFGPGXTPPHGGLMGWSPQ
AQGILTTVPAAPPPASTNRQSGRXPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792780_LHBs_P-B Product feature CHAIN KC792780_LHBs_P-B of FT:mat_peptide KC792780_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0133). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKDNWPDANKVGAGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSV
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792781_LHBs_P-B Product feature CHAIN KC792781_LHBs_P-B of FT:mat_peptide KC792781_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0134). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAWKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
TSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPXMPLLPIFFCLWVYI
>gnl|hbvpro|KC792782_LHBs_P-B Product feature CHAIN KC792782_LHBs_P-B of FT:mat_peptide KC792782_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0135). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
XQGILTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXXLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRXIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792783_LHBs_P-B Product feature CHAIN KC792783_LHBs_P-B of FT:mat_peptide KC792783_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKDNWPEANKVGVGAFGPGFTPPHGGXLGWSPQ
AXGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792784_LHBs_P-B Product feature CHAIN KC792784_LHBs_P-B of FT:mat_peptide KC792784_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0137). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792785_LHBs_P-B Product feature CHAIN KC792785_LHBs_P-B of FT:mat_peptide KC792785_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDXWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPXSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
LICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792786_LHBs_P-B Product feature CHAIN KC792786_LHBs_P-B of FT:mat_peptide KC792786_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0139). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQXLDXWWTSLXFLGGTXXCLGQNSQSQISSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792787_LHBs_P-B Product feature CHAIN KC792787_LHBs_P-B of FT:mat_peptide KC792787_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0140). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFKABSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAXNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792788_LHBs_P-B Product feature CHAIN KC792788_LHBs_P-B of FT:mat_peptide KC792788_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0141). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792789_LHBs_P-B Product feature CHAIN KC792789_LHBs_P-B of FT:mat_peptide KC792789_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPVSTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLICLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792791_LHBs_P-B Product feature CHAIN KC792791_LHBs_P-B of FT:mat_peptide KC792791_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0144). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBXNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRXFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792794_LHBs_P-B Product feature CHAIN KC792794_LHBs_P-B of FT:mat_peptide KC792794_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0147). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDASKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMIWFWGRSLCTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792795_LHBs_P-B Product feature CHAIN KC792795_LHBs_P-B of FT:mat_peptide KC792795_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0148). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792796_LHBs_P-B Product feature CHAIN KC792796_LHBs_P-B of FT:mat_peptide KC792796_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0149). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGXLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792797_LHBs_P-B Product feature CHAIN KC792797_LHBs_P-B of FT:mat_peptide KC792797_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0150). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792798_LHBs_P-B Product feature CHAIN KC792798_LHBs_P-B of FT:mat_peptide KC792798_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0151). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKABSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|KC792800_LHBs_P-B Product feature CHAIN KC792800_LHBs_P-B of FT:mat_peptide KC792800_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0153). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPFSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGXFLLTKILTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLXPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792802_LHBs_P-B Product feature CHAIN KC792802_LHBs_P-B of FT:mat_peptide KC792802_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0155). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQIXSHSPTCCP
PICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWFWGPXLYNXLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792804_LHBs_P-B Product feature CHAIN KC792804_LHBs_P-B of FT:mat_peptide KC792804_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0157). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDXQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGXTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKXGDLVXNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQXSNHSPTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVXWMMWFWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792805_LHBs_P-B Product feature CHAIN KC792805_LHBs_P-B of FT:mat_peptide KC792805_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0158). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGVXGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTXFHQTLQDPRVRALYFXAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHXPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792807_LHBs_P-B Product feature CHAIN KC792807_LHBs_P-B of FT:mat_peptide KC792807_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0160). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC792808_LHBs_P-B Product feature CHAIN KC792808_LHBs_P-B of FT:mat_peptide KC792808_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0161). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKAXSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AXGILTTVPAAPPPASTNRQSGRQPTPLXPPLRDXHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSXTVXPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILXIPQSLDXWWTSLXFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792809_LHBs_P-B Product feature CHAIN KC792809_LHBs_P-B of FT:mat_peptide KC792809_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0162). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792810_LHBs_P-B Product feature CHAIN KC792810_LHBs_P-B of FT:mat_peptide KC792810_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0163). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEXPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIRWXNPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWFWGPRLCTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792811_LHBs_P-B Product feature CHAIN KC792811_LHBs_P-B of FT:mat_peptide KC792811_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSXPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAVPPPASTNRXSGRQPTPLSPPLRDTHPQAMXWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|KC792812_LHBs_P-B Product feature CHAIN KC792812_LHBs_P-B of FT:mat_peptide KC792812_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0165). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGXLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTXFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGETPVCLGQNSQSXISXHXPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792813_LHBs_P-B Product feature CHAIN KC792813_LHBs_P-B of FT:mat_peptide KC792813_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0166). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGQTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRRSGRQPTPLSPPLRDTHPQAMQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792814_LHBs_P-B Product feature CHAIN KC792814_LHBs_P-B of FT:mat_peptide KC792814_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0167). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSXLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792815_LHBs_P-B Product feature CHAIN KC792815_LHBs_P-B of FT:mat_peptide KC792815_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGVSSKPRKGMGTNLXVPNPLGFFXDHQLDPXFRANSXNPDWDLNPHKDNWPDAXKVGVGAFGPGFXPPHGGLLGWSPQ
AQGILTTVPAAPPPAXTNRQTGRXPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792819_LHBs_P-B Product feature CHAIN KC792819_LHBs_P-B of FT:mat_peptide KC792819_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0172). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSRTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792820_LHBs_P-B Product feature CHAIN KC792820_LHBs_P-B of FT:mat_peptide KC792820_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPYKDNWPDANKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRKSGRQPTPLTPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVSPAQNTVST
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792821_LHBs_P-B Product feature CHAIN KC792821_LHBs_P-B of FT:mat_peptide KC792821_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0174). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPBAKKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYVPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLCSILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792822_LHBs_P-B Product feature CHAIN KC792822_LHBs_P-B of FT:mat_peptide KC792822_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0175). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGGPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792823_LHBs_P-B Product feature CHAIN KC792823_LHBs_P-B of FT:mat_peptide KC792823_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0176). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFXPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRXSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792824_LHBs_P-B Product feature CHAIN KC792824_LHBs_P-B of FT:mat_peptide KC792824_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0177). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792825_LHBs_P-B Product feature CHAIN KC792825_LHBs_P-B of FT:mat_peptide KC792825_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0178). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDFKPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRHSRRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
NSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMFLRRFIIFLCILLLCLIFLXVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWFWGPSLFSILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792827_LHBs_P-B Product feature CHAIN KC792827_LHBs_P-B of FT:mat_peptide KC792827_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0180). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKADTKNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMSLLPIFFCLWVYI
>gnl|hbvpro|KC792828_LHBs_P-B Product feature CHAIN KC792828_LHBs_P-B of FT:mat_peptide KC792828_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0181). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792829_LHBs_P-B Product feature CHAIN KC792829_LHBs_P-B of FT:mat_peptide KC792829_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0182). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRTLYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792832_LHBs_P-B Product feature CHAIN KC792832_LHBs_P-B of FT:mat_peptide KC792832_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPIGFFPDHQLDPAFRANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGWSPQ
XQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDXHPQAMQWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMXPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792835_LHBs_P-B Product feature CHAIN KC792835_LHBs_P-B of FT:mat_peptide KC792835_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0188). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHXDNWXDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSXLSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792836_LHBs_P-B Product feature CHAIN KC792836_LHBs_P-B of FT:mat_peptide KC792836_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0189). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNXPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792837_LHBs_P-B Product feature CHAIN KC792837_LHBs_P-B of FT:mat_peptide KC792837_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0190). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSTTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCPGQNSQSQISSHSPTCCP
PICPGYRXMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILRPFMPLLPIFCCLWAYI
>gnl|hbvpro|KC792838_LHBs_P-B Product feature CHAIN KC792838_LHBs_P-B of FT:mat_peptide KC792838_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0191). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792839_LHBs_P-B Product feature CHAIN KC792839_LHBs_P-B of FT:mat_peptide KC792839_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0192). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPEANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
QXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792840_LHBs_P-B Product feature CHAIN KC792840_LHBs_P-B of FT:mat_peptide KC792840_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0193). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDABKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSXTVSPAQNTVSA
ISSILSXXGDPVPNMENIASGLLGPLLVLQAGFFXLTKXLXIPQSLDSWWTSLNFXGGTPVCLGQNSQSQXSSHSPTCCP
PICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|KC792841_LHBs_P-B Product feature CHAIN KC792841_LHBs_P-B of FT:mat_peptide KC792841_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0194). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792842_LHBs_P-B Product feature CHAIN KC792842_LHBs_P-B of FT:mat_peptide KC792842_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0195). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDTKVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792843_LHBs_P-B Product feature CHAIN KC792843_LHBs_P-B of FT:mat_peptide KC792843_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0196). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGXGFTPPHGGLLGWSPQ
AQGILTTVPAAPPLASTNRQSGRQPTPVSPPLRDTHPQAMQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLXGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMXWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792844_LHBs_P-B Product feature CHAIN KC792844_LHBs_P-B of FT:mat_peptide KC792844_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0197). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWTSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKADSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGMLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDTHPQAXQWNSTTFHQTLQDSRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNTLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792845_LHBs_P-B Product feature CHAIN KC792845_LHBs_P-B of FT:mat_peptide KC792845_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0198). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDRNPHKDPWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTIRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
XSSXXSXTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYM
>gnl|hbvpro|KC792846_LHBs_P-B Product feature CHAIN KC792846_LHBs_P-B of FT:mat_peptide KC792846_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0199). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPXXPPLRDTHPQAVXWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQXTVSA
ISSILSXXGDXVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCRGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792847_LHBs_P-B Product feature CHAIN KC792847_LHBs_P-B of FT:mat_peptide KC792847_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0200). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWLDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRRPTPLTPPLRDTHPQTMQWNSTPFHQTRQETPVRASHLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDXQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792848_LHBs_P-B Product feature CHAIN KC792848_LHBs_P-B of FT:mat_peptide KC792848_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0201). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPXXXKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSXRQPTPLSPPLRDTHPQAVXWNSTTFHQTLQDPRVKALYLPAGGSSXGTVSPAQNTVSX
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792849_LHBs_P-B Product feature CHAIN KC792849_LHBs_P-B of FT:mat_peptide KC792849_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0202). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQDLQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792850_LHBs_P-B Product feature CHAIN KC792850_LHBs_P-B of FT:mat_peptide KC792850_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0203). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGETPVCPGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGXSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILSXFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792851_LHBs_P-B Product feature CHAIN KC792851_LHBs_P-B of FT:mat_peptide KC792851_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHKTLQDPRVRALYIPAGGSSSGTLSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792852_LHBs_P-B Product feature CHAIN KC792852_LHBs_P-B of FT:mat_peptide KC792852_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0205). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKXNWPDXNKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILKPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792854_LHBs_P-B Product feature CHAIN KC792854_LHBs_P-B of FT:mat_peptide KC792854_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWXWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792855_LHBs_P-B Product feature CHAIN KC792855_LHBs_P-B of FT:mat_peptide KC792855_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0208). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWTDTNKVGVGAFGPGFSPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792856_LHBs_P-B Product feature CHAIN KC792856_LHBs_P-B of FT:mat_peptide KC792856_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0209). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792858_LHBs_P-B Product feature CHAIN KC792858_LHBs_P-B of FT:mat_peptide KC792858_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0211). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792859_LHBs_P-B Product feature CHAIN KC792859_LHBs_P-B of FT:mat_peptide KC792859_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0212). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTAVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENXASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXXPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWXSVIWMMWFWGPXLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792860_LHBs_P-B Product feature CHAIN KC792860_LHBs_P-B of FT:mat_peptide KC792860_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0213). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSGNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSRTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNLQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KC792861_LHBs_P-B Product feature CHAIN KC792861_LHBs_P-B of FT:mat_peptide KC792861_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0214). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBLNPHKDNWPDANKVGVGAFGPGFTPSHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXGQNSQSQISSHSXTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792863_LHBs_P-B Product feature CHAIN KC792863_LHBs_P-B of FT:mat_peptide KC792863_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0216). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPXSLDSWWTSLXFLGXTPXCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRXFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNTLSPFIPQLPIFFCLWVYI
>gnl|hbvpro|KC792864_LHBs_P-B Product feature CHAIN KC792864_LHBs_P-B of FT:mat_peptide KC792864_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0217). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDXNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRAXYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792865_LHBs_P-B Product feature CHAIN KC792865_LHBs_P-B of FT:mat_peptide KC792865_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0218). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETXVCXGQNSQSQISSHSPTCCP
PICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792866_LHBs_P-B Product feature CHAIN KC792866_LHBs_P-B of FT:mat_peptide KC792866_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQXIQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792867_LHBs_P-B Product feature CHAIN KC792867_LHBs_P-B of FT:mat_peptide KC792867_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0220). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKADSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792869_LHBs_P-B Product feature CHAIN KC792869_LHBs_P-B of FT:mat_peptide KC792869_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0222). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792870_LHBs_P-B Product feature CHAIN KC792870_LHBs_P-B of FT:mat_peptide KC792870_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0223). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MXGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPACKXNSENPDSDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTXRQSGRQPTPLSPPLRDTHPQAXKWNSXTCHQTLQBPRVRALXLPAGGSSSGTVSPAQNTXSP
ISSXXSKTGDPVPNMENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHLLTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792871_LHBs_P-B Product feature CHAIN KC792871_LHBs_P-B of FT:mat_peptide KC792871_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0224). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSENPDWDLNPHKDNWPDATKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTIVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSXTFHQXLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPXCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792872_LHBs_P-B Product feature CHAIN KC792872_LHBs_P-B of FT:mat_peptide KC792872_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0225). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792874_LHBs_P-B Product feature CHAIN KC792874_LHBs_P-B of FT:mat_peptide KC792874_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792875_LHBs_P-B Product feature CHAIN KC792875_LHBs_P-B of FT:mat_peptide KC792875_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0228). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDXXKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNSVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792877_LHBs_P-B Product feature CHAIN KC792877_LHBs_P-B of FT:mat_peptide KC792877_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0230). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGXTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRXSGRQPTPLSPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVXPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792878_LHBs_P-B Product feature CHAIN KC792878_LHBs_P-B of FT:mat_peptide KC792878_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0231). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKDNWPDANKVGVGAFGPGXTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNXTTFLQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSRTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYXWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYXILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|KC792879_LHBs_P-B Product feature CHAIN KC792879_LHBs_P-B of FT:mat_peptide KC792879_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0232). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRTLYFPAGGSSSRTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792881_LHBs_P-B Product feature CHAIN KC792881_LHBs_P-B of FT:mat_peptide KC792881_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0234). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNQSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLALQAAFSLWTRILTIPQSLDSWWTSLSFLGGTPVCPGQNSQSQICSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792882_LHBs_P-B Product feature CHAIN KC792882_LHBs_P-B of FT:mat_peptide KC792882_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0235). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILXPFMPLLPIFXCLWVYX
>gnl|hbvpro|KC792883_LHBs_P-B Product feature CHAIN KC792883_LHBs_P-B of FT:mat_peptide KC792883_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQTTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792884_LHBs_P-B Product feature CHAIN KC792884_LHBs_P-B of FT:mat_peptide KC792884_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPGCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792885_LHBs_P-B Product feature CHAIN KC792885_LHBs_P-B of FT:mat_peptide KC792885_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0238). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXQXNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSX
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792887_LHBs_P-B Product feature CHAIN KC792887_LHBs_P-B of FT:mat_peptide KC792887_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0240). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGMLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVTWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792888_LHBs_P-B Product feature CHAIN KC792888_LHBs_P-B of FT:mat_peptide KC792888_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0241). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPNLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792889_LHBs_P-B Product feature CHAIN KC792889_LHBs_P-B of FT:mat_peptide KC792889_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0242). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPFSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMXPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792890_LHBs_P-B Product feature CHAIN KC792890_LHBs_P-B of FT:mat_peptide KC792890_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0243). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792892_LHBs_P-B Product feature CHAIN KC792892_LHBs_P-B of FT:mat_peptide KC792892_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0245). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGTFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792893_LHBs_P-B Product feature CHAIN KC792893_LHBs_P-B of FT:mat_peptide KC792893_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0246). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPVGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792894_LHBs_P-B Product feature CHAIN KC792894_LHBs_P-B of FT:mat_peptide KC792894_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQXNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISXHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792895_LHBs_P-B Product feature CHAIN KC792895_LHBs_P-B of FT:mat_peptide KC792895_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0248). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792896_LHBs_P-B Product feature CHAIN KC792896_LHBs_P-B of FT:mat_peptide KC792896_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0249). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAXRWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSA
XSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFXLWXYI
>gnl|hbvpro|KC792897_LHBs_P-B Product feature CHAIN KC792897_LHBs_P-B of FT:mat_peptide KC792897_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0250). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSSQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAIQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|KC792898_LHBs_P-B Product feature CHAIN KC792898_LHBs_P-B of FT:mat_peptide KC792898_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0251). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLXVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792899_LHBs_P-B Product feature CHAIN KC792899_LHBs_P-B of FT:mat_peptide KC792899_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0252). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792900_LHBs_P-B Product feature CHAIN KC792900_LHBs_P-B of FT:mat_peptide KC792900_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0253). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDAN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792901_LHBs_P-B Product feature CHAIN KC792901_LHBs_P-B of FT:mat_peptide KC792901_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0254). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFSPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAIQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTEGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792903_LHBs_P-B Product feature CHAIN KC792903_LHBs_P-B of FT:mat_peptide KC792903_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0256). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTSFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792904_LHBs_P-B Product feature CHAIN KC792904_LHBs_P-B of FT:mat_peptide KC792904_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0257). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGXLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMXWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792905_LHBs_P-B Product feature CHAIN KC792905_LHBs_P-B of FT:mat_peptide KC792905_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0258). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDTNKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTTRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
XSSIXSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792906_LHBs_P-B Product feature CHAIN KC792906_LHBs_P-B of FT:mat_peptide KC792906_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792907_LHBs_P-B Product feature CHAIN KC792907_LHBs_P-B of FT:mat_peptide KC792907_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0260). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWNPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792908_LHBs_P-B Product feature CHAIN KC792908_LHBs_P-B of FT:mat_peptide KC792908_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0261). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKDNWPDANKVGVGAFGPGFTPPHGGXLGWSPQ
AQGLLTTVPAAPPPASTNRXSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLNPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792909_LHBs_P-B Product feature CHAIN KC792909_LHBs_P-B of FT:mat_peptide KC792909_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0262). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWRDANKVGVGAFGPGFIPPHGGLLGWNPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792910_LHBs_P-B Product feature CHAIN KC792910_LHBs_P-B of FT:mat_peptide KC792910_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792912_LHBs_P-B Product feature CHAIN KC792912_LHBs_P-B of FT:mat_peptide KC792912_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0265). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792913_LHBs_P-B Product feature CHAIN KC792913_LHBs_P-B of FT:mat_peptide KC792913_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0266). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792915_LHBs_P-B Product feature CHAIN KC792915_LHBs_P-B of FT:mat_peptide KC792915_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRLSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792916_LHBs_P-B Product feature CHAIN KC792916_LHBs_P-B of FT:mat_peptide KC792916_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0269). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKDNWPNANKVGVGAFGPGFIPPHGGMLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYS
>gnl|hbvpro|KC792917_LHBs_P-B Product feature CHAIN KC792917_LHBs_P-B of FT:mat_peptide KC792917_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0270). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792918_LHBs_P-B Product feature CHAIN KC792918_LHBs_P-B of FT:mat_peptide KC792918_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0271). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNYATFHQTLQVHTVKGLNLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792919_LHBs_P-B Product feature CHAIN KC792919_LHBs_P-B of FT:mat_peptide KC792919_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0272). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDKWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTNTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792920_LHBs_P-B Product feature CHAIN KC792920_LHBs_P-B of FT:mat_peptide KC792920_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0273). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKDXWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVXPAQNTVSX
XSSILSXTGDPVPNMENIASGXLGPLLXLQAXFFLXTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWXYI
>gnl|hbvpro|KC792924_LHBs_P-B Product feature CHAIN KC792924_LHBs_P-B of FT:mat_peptide KC792924_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0277). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAPPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHHTLQDXRVRALYFPAGGSSSGTVSPAQNTVSA
TSSNSSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792925_LHBs_P-B Product feature CHAIN KC792925_LHBs_P-B of FT:mat_peptide KC792925_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0278). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQXSSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792928_LHBs_P-B Product feature CHAIN KC792928_LHBs_P-B of FT:mat_peptide KC792928_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0281). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPNANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSSTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQXLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792930_LHBs_P-B Product feature CHAIN KC792930_LHBs_P-B of FT:mat_peptide KC792930_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
TSSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792931_LHBs_P-B Product feature CHAIN KC792931_LHBs_P-B of FT:mat_peptide KC792931_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0284). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSH
ISSSSSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQFQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792932_LHBs_P-B Product feature CHAIN KC792932_LHBs_P-B of FT:mat_peptide KC792932_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0285). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTMPAAPPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792933_LHBs_P-B Product feature CHAIN KC792933_LHBs_P-B of FT:mat_peptide KC792933_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0286). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKXNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792934_LHBs_P-B Product feature CHAIN KC792934_LHBs_P-B of FT:mat_peptide KC792934_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0287). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFTANSENPDWDLNPRKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792935_LHBs_P-B Product feature CHAIN KC792935_LHBs_P-B of FT:mat_peptide KC792935_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0288). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFLQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792936_LHBs_P-B Product feature CHAIN KC792936_LHBs_P-B of FT:mat_peptide KC792936_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0289). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPXAPPPASTNRQSGRQPTPXSXPLRDTHPQAXQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMXLRXFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPXFFCLWVYI
>gnl|hbvpro|KC792937_LHBs_P-B Product feature CHAIN KC792937_LHBs_P-B of FT:mat_peptide KC792937_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0290). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANTENPDWDLSPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILRPFIPLLSIFFCLWVYI
>gnl|hbvpro|KC792938_LHBs_P-B Product feature CHAIN KC792938_LHBs_P-B of FT:mat_peptide KC792938_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQTTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792939_LHBs_P-B Product feature CHAIN KC792939_LHBs_P-B of FT:mat_peptide KC792939_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0292). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAXFFLLTKILTIPQSLDSWWTSLSFLGGTXXCLGQNSQSQISSHSPTCCP
PXCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLSIFLCLWVYI
>gnl|hbvpro|KC792942_LHBs_P-B Product feature CHAIN KC792942_LHBs_P-B of FT:mat_peptide KC792942_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0295). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVXPAQNTVSX
XSXXXSKTGXXVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|KC792943_LHBs_P-B Product feature CHAIN KC792943_LHBs_P-B of FT:mat_peptide KC792943_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSANPDWDLNPHKDSWPDANEVGVGAFGPGFTPPHGGMLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALNFPAGGSSSETVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792944_LHBs_P-B Product feature CHAIN KC792944_LHBs_P-B of FT:mat_peptide KC792944_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0297). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792945_LHBs_P-B Product feature CHAIN KC792945_LHBs_P-B of FT:mat_peptide KC792945_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0298). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLXDYQGMLPVCPLIPGSSTTSTGPCKTCTTXAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792947_LHBs_P-B Product feature CHAIN KC792947_LHBs_P-B of FT:mat_peptide KC792947_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0300). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPH
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWXXAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLCTILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|KC792948_LHBs_P-B Product feature CHAIN KC792948_LHBs_P-B of FT:mat_peptide KC792948_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0301). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFRANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792949_LHBs_P-B Product feature CHAIN KC792949_LHBs_P-B of FT:mat_peptide KC792949_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0302). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNSQKDNWPDAHKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGXSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792950_LHBs_P-B Product feature CHAIN KC792950_LHBs_P-B of FT:mat_peptide KC792950_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0303). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIFTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAXQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVXPXQNTXSA
ISSIXSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQXSSHXPTCCP
XICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAXAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLCXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792952_LHBs_P-B Product feature CHAIN KC792952_LHBs_P-B of FT:mat_peptide KC792952_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0305). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792953_LHBs_P-B Product feature CHAIN KC792953_LHBs_P-B of FT:mat_peptide KC792953_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0306). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTXXSPPLRDTHPQAMQWNSTTFHQTLQNPKVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVSNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792954_LHBs_P-B Product feature CHAIN KC792954_LHBs_P-B of FT:mat_peptide KC792954_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0307). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGMLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792955_LHBs_P-B Product feature CHAIN KC792955_LHBs_P-B of FT:mat_peptide KC792955_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNXPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRXSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTFCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792956_LHBs_P-B Product feature CHAIN KC792956_LHBs_P-B of FT:mat_peptide KC792956_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0309). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPEXNKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXKWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAPNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFXCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792957_LHBs_P-B Product feature CHAIN KC792957_LHBs_P-B of FT:mat_peptide KC792957_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0310). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWGSVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792958_LHBs_P-B Product feature CHAIN KC792958_LHBs_P-B of FT:mat_peptide KC792958_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0311). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVQWNSTTFHQTLQDTRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCFGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792959_LHBs_P-B Product feature CHAIN KC792959_LHBs_P-B of FT:mat_peptide KC792959_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0312). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAVKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRIRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMSLLPIFFCLWVYI
>gnl|hbvpro|KC792960_LHBs_P-B Product feature CHAIN KC792960_LHBs_P-B of FT:mat_peptide KC792960_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0313). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792963_LHBs_P-B Product feature CHAIN KC792963_LHBs_P-B of FT:mat_peptide KC792963_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0316). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792964_LHBs_P-B Product feature CHAIN KC792964_LHBs_P-B of FT:mat_peptide KC792964_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0317). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGRSPQ
AQGILTTMPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALXLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTNTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792966_LHBs_P-B Product feature CHAIN KC792966_LHBs_P-B of FT:mat_peptide KC792966_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0319). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFRANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTXXPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLSFLGGTPVCLGXDSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792967_LHBs_P-B Product feature CHAIN KC792967_LHBs_P-B of FT:mat_peptide KC792967_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0320). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKDNWPDAWKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSTLSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXXAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYX
>gnl|hbvpro|KC792969_LHBs_P-B Product feature CHAIN KC792969_LHBs_P-B of FT:mat_peptide KC792969_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGLIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRKSGRQPTPLSPPLRDTHPQAIQWNTTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792970_LHBs_P-B Product feature CHAIN KC792970_LHBs_P-B of FT:mat_peptide KC792970_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYXWMXLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792971_LHBs_P-B Product feature CHAIN KC792971_LHBs_P-B of FT:mat_peptide KC792971_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0324). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792972_LHBs_P-B Product feature CHAIN KC792972_LHBs_P-B of FT:mat_peptide KC792972_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0325). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792973_LHBs_P-B Product feature CHAIN KC792973_LHBs_P-B of FT:mat_peptide KC792973_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0326). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGXFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792974_LHBs_P-B Product feature CHAIN KC792974_LHBs_P-B of FT:mat_peptide KC792974_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0327). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSXTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792975_LHBs_P-B Product feature CHAIN KC792975_LHBs_P-B of FT:mat_peptide KC792975_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0328). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVFQAGFFLLTKILTIPMSLDSWWTSLSFLGGTTECLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILTPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792976_LHBs_P-B Product feature CHAIN KC792976_LHBs_P-B of FT:mat_peptide KC792976_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0329). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGXLGWSPQ
AQGILTXVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNSVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792977_LHBs_P-B Product feature CHAIN KC792977_LHBs_P-B of FT:mat_peptide KC792977_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0330). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGXGAFGPGFIPPHGGXLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYHGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792978_LHBs_P-B Product feature CHAIN KC792978_LHBs_P-B of FT:mat_peptide KC792978_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0331). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792980_LHBs_P-B Product feature CHAIN KC792980_LHBs_P-B of FT:mat_peptide KC792980_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0333). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGQLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792981_LHBs_P-B Product feature CHAIN KC792981_LHBs_P-B of FT:mat_peptide KC792981_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0334). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLFTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792982_LHBs_P-B Product feature CHAIN KC792982_LHBs_P-B of FT:mat_peptide KC792982_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0335). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFGGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792983_LHBs_P-B Product feature CHAIN KC792983_LHBs_P-B of FT:mat_peptide KC792983_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0336). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPXANKVGVGAFGLGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLXFLGXTXVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXXIWMMWXWGPNLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792984_LHBs_P-B Product feature CHAIN KC792984_LHBs_P-B of FT:mat_peptide KC792984_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0337). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFXPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792985_LHBs_P-B Product feature CHAIN KC792985_LHBs_P-B of FT:mat_peptide KC792985_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0338). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792986_LHBs_P-B Product feature CHAIN KC792986_LHBs_P-B of FT:mat_peptide KC792986_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGLLTSVPAAPPPAXTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDXWXTSLNFLGXTPVCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792987_LHBs_P-B Product feature CHAIN KC792987_LHBs_P-B of FT:mat_peptide KC792987_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0340). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGXLGWSPQ
AQGILTTVPAAPPPASTNRXSGRXPTPLXPPLRDTHPQAMQXNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNXVSA
XSSILXXTGDPVPNMENIXSGXLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNIXSPFMPLLPXFFCLWVYI
>gnl|hbvpro|KC792988_LHBs_P-B Product feature CHAIN KC792988_LHBs_P-B of FT:mat_peptide KC792988_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0341). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQXGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPNLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792990_LHBs_P-B Product feature CHAIN KC792990_LHBs_P-B of FT:mat_peptide KC792990_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0343). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792991_LHBs_P-B Product feature CHAIN KC792991_LHBs_P-B of FT:mat_peptide KC792991_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0344). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVXVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXSXTGXPVXNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792992_LHBs_P-B Product feature CHAIN KC792992_LHBs_P-B of FT:mat_peptide KC792992_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0345). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=396 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
TQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTPQWNYTTFHQTLQNPRVRALYFPAGGSSSGTVSPAQNTXSAISSI
LSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICP
GYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCI
PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792993_LHBs_P-B Product feature CHAIN KC792993_LHBs_P-B of FT:mat_peptide KC792993_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0346). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792994_LHBs_P-B Product feature CHAIN KC792994_LHBs_P-B of FT:mat_peptide KC792994_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0347). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSXSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792996_LHBs_P-B Product feature CHAIN KC792996_LHBs_P-B of FT:mat_peptide KC792996_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0349). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIVSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792997_LHBs_P-B Product feature CHAIN KC792997_LHBs_P-B of FT:mat_peptide KC792997_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPXAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNXTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTXPRSLDSWWTSLNFLGETPVCLGQNSQSQISSHSXTCCP
PICPGYRWMCLRHFIIFLFILLLCLIFXLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWFWGPBLCNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792998_LHBs_P-B Product feature CHAIN KC792998_LHBs_P-B of FT:mat_peptide KC792998_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0351). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNYTNFHRTLQNPRVRALYFPAGGSSSETVSPAQNTVLP
TSSILSTTGDPVLNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEGTPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC793000_LHBs_P-B Product feature CHAIN KC793000_LHBs_P-B of FT:mat_peptide KC793000_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0353). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFRANSDNPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGGSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNXTTFLQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGEKPVCLGQNLQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793001_LHBs_P-B Product feature CHAIN KC793001_LHBs_P-B of FT:mat_peptide KC793001_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0354). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793002_LHBs_P-B Product feature CHAIN KC793002_LHBs_P-B of FT:mat_peptide KC793002_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0355). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSXGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793004_LHBs_P-B Product feature CHAIN KC793004_LHBs_P-B of FT:mat_peptide KC793004_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0357). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGIXTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENXASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|KC793005_LHBs_P-B Product feature CHAIN KC793005_LHBs_P-B of FT:mat_peptide KC793005_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0358). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793006_LHBs_P-B Product feature CHAIN KC793006_LHBs_P-B of FT:mat_peptide KC793006_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFVPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCXKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793007_LHBs_P-B Product feature CHAIN KC793007_LHBs_P-B of FT:mat_peptide KC793007_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0360). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793008_LHBs_P-B Product feature CHAIN KC793008_LHBs_P-B of FT:mat_peptide KC793008_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0361). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLXGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTFHLTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGXTPXCXGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793009_LHBs_P-B Product feature CHAIN KC793009_LHBs_P-B of FT:mat_peptide KC793009_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0362). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNXPDXNKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPHAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVST
ISSIXSKTGDPVPNMENIASGPLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793010_LHBs_P-B Product feature CHAIN KC793010_LHBs_P-B of FT:mat_peptide KC793010_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0363). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793011_LHBs_P-B Product feature CHAIN KC793011_LHBs_P-B of FT:mat_peptide KC793011_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0364). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGETXVCXGQNSQSQISSHXPTCCP
PTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTXWLXVIWMMWYWGXXLYNTLSPFMPLLPXFXCLWVYI
>gnl|hbvpro|KC793012_LHBs_P-B Product feature CHAIN KC793012_LHBs_P-B of FT:mat_peptide KC793012_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0365). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDDNKVGVGAFGPGFVPPHGGLLGWSXQ
AQGILTTVPAAPPTASTNRQSGRQPTPISPPLRDTHPQAMXWNXTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSX
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793013_LHBs_P-B Product feature CHAIN KC793013_LHBs_P-B of FT:mat_peptide KC793013_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0366). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDRNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPTTPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793014_LHBs_P-B Product feature CHAIN KC793014_LHBs_P-B of FT:mat_peptide KC793014_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0367). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWXDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALXFPAGGSSSGTVXPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCMKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793015_LHBs_P-B Product feature CHAIN KC793015_LHBs_P-B of FT:mat_peptide KC793015_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0368). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKDNWPDANKVGVGAFGXGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTXVCLGQNSQSQISSHSPTCCP
XICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWXFAKXLWEWASVRFSWLSLLVPXVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793016_LHBs_P-B Product feature CHAIN KC793016_LHBs_P-B of FT:mat_peptide KC793016_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0369). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAALPPASTNRQSGRQPTPLTPPLRDTHPQAIQWNATTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSXYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793017_LHBs_P-B Product feature CHAIN KC793017_LHBs_P-B of FT:mat_peptide KC793017_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0370). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDXWPDANKVGVGAFGPGFTPPHGGLLGXSPQ
XQGLLTTVPAAPPPASTNRQSGRQPTPVSPPLRDTHPQAIQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSIXXKTGDPVPNMENIASGLLGPLLVLQAGYFSLTKILTIPQSLDSWWTSLSFLGDTPVCLGQNSQSXISSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPKLCNILSPFMPLLPIFCCLWAYI
>gnl|hbvpro|KC793018_LHBs_P-B Product feature CHAIN KC793018_LHBs_P-B of FT:mat_peptide KC793018_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0371). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793020_LHBs_P-B Product feature CHAIN KC793020_LHBs_P-B of FT:mat_peptide KC793020_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0373). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGIPVCLGQNSQSQISSHSPTCCP
PTCPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793021_LHBs_P-B Product feature CHAIN KC793021_LHBs_P-B of FT:mat_peptide KC793021_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKDNWRDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGXXWMCLRRFIIFLCILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793022_LHBs_P-B Product feature CHAIN KC793022_LHBs_P-B of FT:mat_peptide KC793022_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0375). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPVSTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793023_LHBs_P-B Product feature CHAIN KC793023_LHBs_P-B of FT:mat_peptide KC793023_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0376). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDQQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPACLGQNSQSQISSHLPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793025_LHBs_P-B Product feature CHAIN KC793025_LHBs_P-B of FT:mat_peptide KC793025_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0378). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793027_LHBs_P-B Product feature CHAIN KC793027_LHBs_P-B of FT:mat_peptide KC793027_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793028_LHBs_P-B Product feature CHAIN KC793028_LHBs_P-B of FT:mat_peptide KC793028_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0381). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMRWNSPTFHKTLQDPRVRALYFPAGGSSSGTVNPAQNSVST
TLLTSSTTGDPVLNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLXVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793029_LHBs_P-B Product feature CHAIN KC793029_LHBs_P-B of FT:mat_peptide KC793029_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0382). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAVQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793031_LHBs_P-B Product feature CHAIN KC793031_LHBs_P-B of FT:mat_peptide KC793031_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0384). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYHWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793032_LHBs_P-B Product feature CHAIN KC793032_LHBs_P-B of FT:mat_peptide KC793032_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0385). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGPSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAXXWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQXTVSA
VSSILSTTGDPXPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQICSHSPTCCP
PXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793033_LHBs_P-B Product feature CHAIN KC793033_LHBs_P-B of FT:mat_peptide KC793033_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDTFQNANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRRPTPLSLPLRDTHPQAVQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSALSKTGDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGERLVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793034_LHBs_P-B Product feature CHAIN KC793034_LHBs_P-B of FT:mat_peptide KC793034_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0387). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=401 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPXQNTVSX
ISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLXFLGXXPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYXILSPFIPLLPIFFCLWVYI
X
>gnl|hbvpro|KC793036_LHBs_P-B Product feature CHAIN KC793036_LHBs_P-B of FT:mat_peptide KC793036_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0389). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKNNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGIITTIPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLWTKVLTIPQSLDSWWTSLNFLGETPVCPGQNSQSQICSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXTLTPFMPLLPIFFCXWVYI
>gnl|hbvpro|KC793038_LHBs_P-B Product feature CHAIN KC793038_LHBs_P-B of FT:mat_peptide KC793038_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0391). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTAVPAXPPPASTNRQSGRQPTPLTPPLRDTHPQAAQWNSTTVNQTLQXPRVRAQNXPAGGSSSGTVSPAQNTVSA
ISLILSKIGDLVPNMENIASGLLGPLLALQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|KC793041_LHBs_P-B Product feature CHAIN KC793041_LHBs_P-B of FT:mat_peptide KC793041_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPXGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLXTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYXPAGGSSSGAVSPAQNTVSA
ISSISSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFLCLWVYM
>gnl|hbvpro|KC793042_LHBs_P-B Product feature CHAIN KC793042_LHBs_P-B of FT:mat_peptide KC793042_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0395). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFVPPHGGLLGWSPL
AQGILTTVPAAPPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIXLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793043_LHBs_P-B Product feature CHAIN KC793043_LHBs_P-B of FT:mat_peptide KC793043_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0396). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGTFGPGFIPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENITSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793044_LHBs_P-B Product feature CHAIN KC793044_LHBs_P-B of FT:mat_peptide KC793044_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0397). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENXASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTXXCLGQNSQSQICSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWXMWYWGPSLXNILXPFXPLLXIFFCLWVYI
>gnl|hbvpro|KC793045_LHBs_P-B Product feature CHAIN KC793045_LHBs_P-B of FT:mat_peptide KC793045_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0398). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGRTSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
ASGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
QICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793047_LHBs_P-B Product feature CHAIN KC793047_LHBs_P-B of FT:mat_peptide KC793047_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0400). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKDNWPNANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTMPAAPPPASTNRRSGRQPTPLTPPLRDTHPXAIQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPNLYNXLSPFMPLLPIFFCIWVYI
>gnl|hbvpro|KC793048_LHBs_P-B Product feature CHAIN KC793048_LHBs_P-B of FT:mat_peptide KC793048_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0401). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|KC793049_LHBs_P-B Product feature CHAIN KC793049_LHBs_P-B of FT:mat_peptide KC793049_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0402). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGTGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQXQISSHSPTCCP
PICPGYRWMYLRRFIIFLXILLLXLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793052_LHBs_P-B Product feature CHAIN KC793052_LHBs_P-B of FT:mat_peptide KC793052_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0405). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTXCLGQNSQSQISSHSXTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793053_LHBs_P-B Product feature CHAIN KC793053_LHBs_P-B of FT:mat_peptide KC793053_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793054_LHBs_P-B Product feature CHAIN KC793054_LHBs_P-B of FT:mat_peptide KC793054_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0407). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDFNPHKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLTPPLRDTHPQAVQWNSTTFHKTLQDPRVRALYLPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPXCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|KC793055_LHBs_P-B Product feature CHAIN KC793055_LHBs_P-B of FT:mat_peptide KC793055_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0408). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793056_LHBs_P-B Product feature CHAIN KC793056_LHBs_P-B of FT:mat_peptide KC793056_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0409). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFXPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQXGRQPTPLSPPLRDTHPQAMKWNSTTSHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPGCLGQNSQSQISSHSPTCCP
PICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCKTCTAPAQGTSMXPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793057_LHBs_P-B Product feature CHAIN KC793057_LHBs_P-B of FT:mat_peptide KC793057_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0410). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSA
ISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCP
PICPGYRWMCLRRFIIFLCILLLCLXFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVGLSPTVWLLVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793058_LHBs_P-B Product feature CHAIN KC793058_LHBs_P-B of FT:mat_peptide KC793058_LHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0411). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHB