HBVdb

Dataset for protein MHBs of genotype B

[Download (right click)] [Alignment] [Repertoires]

2753 sequence(s)

>gnl|hbvpro|AB010289_MHBs_P-B Product feature CHAIN AB010289_MHBs_P-B of FT:mat_peptide AB010289_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB010290_MHBs_P-B Product feature CHAIN AB010290_MHBs_P-B of FT:mat_peptide AB010290_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|AB010291_MHBs_P-B Product feature CHAIN AB010291_MHBs_P-B of FT:mat_peptide AB010291_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|AB010292_MHBs_P-B Product feature CHAIN AB010292_MHBs_P-B of FT:mat_peptide AB010292_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNATTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB014366_MHBs_P-B Product feature CHAIN AB014366_MHBs_P-B of FT:mat_peptide AB014366_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 07D07HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGIVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB031267_MHBs_P-B Product feature CHAIN AB031267_MHBs_P-B of FT:mat_peptide AB031267_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSATFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTASPISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMFP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB033554_MHBs_P-B Product feature CHAIN AB033554_MHBs_P-B of FT:mat_peptide AB033554_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB033555_MHBs_P-B Product feature CHAIN AB033555_MHBs_P-B of FT:mat_peptide AB033555_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB048705_MHBs_P-B Product feature CHAIN AB048705_MHBs_P-B of FT:mat_peptide AB048705_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTKTGDPASNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB073821_MHBs_P-B Product feature CHAIN AB073821_MHBs_P-B of FT:mat_peptide AB073821_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPXCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073822_MHBs_P-B Product feature CHAIN AB073822_MHBs_P-B of FT:mat_peptide AB073822_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073823_MHBs_P-B Product feature CHAIN AB073823_MHBs_P-B of FT:mat_peptide AB073823_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMESIASGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCPGQNLQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073824_MHBs_P-B Product feature CHAIN AB073824_MHBs_P-B of FT:mat_peptide AB073824_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNTLKPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073825_MHBs_P-B Product feature CHAIN AB073825_MHBs_P-B of FT:mat_peptide AB073825_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073826_MHBs_P-B Product feature CHAIN AB073826_MHBs_P-B of FT:mat_peptide AB073826_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073827_MHBs_P-B Product feature CHAIN AB073827_MHBs_P-B of FT:mat_peptide AB073827_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073828_MHBs_P-B Product feature CHAIN AB073828_MHBs_P-B of FT:mat_peptide AB073828_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073829_MHBs_P-B Product feature CHAIN AB073829_MHBs_P-B of FT:mat_peptide AB073829_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073830_MHBs_P-B Product feature CHAIN AB073830_MHBs_P-B of FT:mat_peptide AB073830_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073831_MHBs_P-B Product feature CHAIN AB073831_MHBs_P-B of FT:mat_peptide AB073831_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGILP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073832_MHBs_P-B Product feature CHAIN AB073832_MHBs_P-B of FT:mat_peptide AB073832_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073833_MHBs_P-B Product feature CHAIN AB073833_MHBs_P-B of FT:mat_peptide AB073833_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFXSLTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073834_MHBs_P-B Product feature CHAIN AB073834_MHBs_P-B of FT:mat_peptide AB073834_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073835_MHBs_P-B Product feature CHAIN AB073835_MHBs_P-B of FT:mat_peptide AB073835_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073836_MHBs_P-B Product feature CHAIN AB073836_MHBs_P-B of FT:mat_peptide AB073836_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073837_MHBs_P-B Product feature CHAIN AB073837_MHBs_P-B of FT:mat_peptide AB073837_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=281 residues).
IHWKPPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073838_MHBs_P-B Product feature CHAIN AB073838_MHBs_P-B of FT:mat_peptide AB073838_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073839_MHBs_P-B Product feature CHAIN AB073839_MHBs_P-B of FT:mat_peptide AB073839_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKIGDPVPNMETISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDPLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073840_MHBs_P-B Product feature CHAIN AB073840_MHBs_P-B of FT:mat_peptide AB073840_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISXILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWXTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVG
LSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073841_MHBs_P-B Product feature CHAIN AB073841_MHBs_P-B of FT:mat_peptide AB073841_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073842_MHBs_P-B Product feature CHAIN AB073842_MHBs_P-B of FT:mat_peptide AB073842_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTIFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073843_MHBs_P-B Product feature CHAIN AB073843_MHBs_P-B of FT:mat_peptide AB073843_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073844_MHBs_P-B Product feature CHAIN AB073844_MHBs_P-B of FT:mat_peptide AB073844_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073845_MHBs_P-B Product feature CHAIN AB073845_MHBs_P-B of FT:mat_peptide AB073845_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073846_MHBs_P-B Product feature CHAIN AB073846_MHBs_P-B of FT:mat_peptide AB073846_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073847_MHBs_P-B Product feature CHAIN AB073847_MHBs_P-B of FT:mat_peptide AB073847_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPVCPGRNSQSQISSHSPISCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPQIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073848_MHBs_P-B Product feature CHAIN AB073848_MHBs_P-B of FT:mat_peptide AB073848_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073849_MHBs_P-B Product feature CHAIN AB073849_MHBs_P-B of FT:mat_peptide AB073849_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETTVCLGQNSQCQISSHSPTFCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073850_MHBs_P-B Product feature CHAIN AB073850_MHBs_P-B of FT:mat_peptide AB073850_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073851_MHBs_P-B Product feature CHAIN AB073851_MHBs_P-B of FT:mat_peptide AB073851_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRLMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGNFTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFFWLSLLVPFVQWFVG
LSPTVWLLVTWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073852_MHBs_P-B Product feature CHAIN AB073852_MHBs_P-B of FT:mat_peptide AB073852_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTTSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLEGPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073853_MHBs_P-B Product feature CHAIN AB073853_MHBs_P-B of FT:mat_peptide AB073853_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIFSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDLWWTSLSFLGEPPVCHGQNSQCQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB073854_MHBs_P-B Product feature CHAIN AB073854_MHBs_P-B of FT:mat_peptide AB073854_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPPICPGYRWMYLRRFIIXLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073855_MHBs_P-B Product feature CHAIN AB073855_MHBs_P-B of FT:mat_peptide AB073855_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073856_MHBs_P-B Product feature CHAIN AB073856_MHBs_P-B of FT:mat_peptide AB073856_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry46). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGIVSPAQNTVSAISSILSTTGDPVLNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073857_MHBs_P-B Product feature CHAIN AB073857_MHBs_P-B of FT:mat_peptide AB073857_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQARFFLLTKI
LTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073858_MHBs_P-B Product feature CHAIN AB073858_MHBs_P-B of FT:mat_peptide AB073858_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPKMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB100695_MHBs_P-B Product feature CHAIN AB100695_MHBs_P-B of FT:mat_peptide AB100695_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSLWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB106884_MHBs_P-B Product feature CHAIN AB106884_MHBs_P-B of FT:mat_peptide AB106884_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGIVSPAQNTVSTISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB115551_MHBs_P-B Product feature CHAIN AB115551_MHBs_P-B of FT:mat_peptide AB115551_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB117759_MHBs_P-B Product feature CHAIN AB117759_MHBs_P-B of FT:mat_peptide AB117759_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCPGQNSQSQIFSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARNPSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB195933_MHBs_P-B Product feature CHAIN AB195933_MHBs_P-B of FT:mat_peptide AB195933_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB195934_MHBs_P-B Product feature CHAIN AB195934_MHBs_P-B of FT:mat_peptide AB195934_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB195935_MHBs_P-B Product feature CHAIN AB195935_MHBs_P-B of FT:mat_peptide AB195935_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205119_MHBs_P-B Product feature CHAIN AB205119_MHBs_P-B of FT:mat_peptide AB205119_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLMPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205120_MHBs_P-B Product feature CHAIN AB205120_MHBs_P-B of FT:mat_peptide AB205120_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205121_MHBs_P-B Product feature CHAIN AB205121_MHBs_P-B of FT:mat_peptide AB205121_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQRLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205122_MHBs_P-B Product feature CHAIN AB205122_MHBs_P-B of FT:mat_peptide AB205122_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMFP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLLVYI
>gnl|hbvpro|AB212625_MHBs_P-B Product feature CHAIN AB212625_MHBs_P-B of FT:mat_peptide AB212625_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB212626_MHBs_P-B Product feature CHAIN AB212626_MHBs_P-B of FT:mat_peptide AB212626_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGIVSPAQNTASAISSTFSKTGDPVPNMGNIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMVPSCCCTKPTDRNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219426_MHBs_P-B Product feature CHAIN AB219426_MHBs_P-B of FT:mat_peptide AB219426_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSPTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|AB219427_MHBs_P-B Product feature CHAIN AB219427_MHBs_P-B of FT:mat_peptide AB219427_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTEGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219428_MHBs_C-B Product feature CHAIN AB219428_MHBs_C-B of FT:mat_peptide AB219428_MHBs_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219429_MHBs_P-B Product feature CHAIN AB219429_MHBs_P-B of FT:mat_peptide AB219429_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDFQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219430_MHBs_P-B Product feature CHAIN AB219430_MHBs_P-B of FT:mat_peptide AB219430_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB231909_MHBs_P-B Product feature CHAIN AB231909_MHBs_P-B of FT:mat_peptide AB231909_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPPIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB241117_MHBs_P-B Product feature CHAIN AB241117_MHBs_P-B of FT:mat_peptide AB241117_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVRWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246339_MHBs_P-B Product feature CHAIN AB246339_MHBs_P-B of FT:mat_peptide AB246339_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246340_MHBs_P-B Product feature CHAIN AB246340_MHBs_P-B of FT:mat_peptide AB246340_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246341_MHBs_P-B Product feature CHAIN AB246341_MHBs_P-B of FT:mat_peptide AB246341_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246342_MHBs_P-B Product feature CHAIN AB246342_MHBs_P-B of FT:mat_peptide AB246342_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTIFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246343_MHBs_P-B Product feature CHAIN AB246343_MHBs_P-B of FT:mat_peptide AB246343_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTIFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWLTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287314_MHBs_P-B Product feature CHAIN AB287314_MHBs_P-B of FT:mat_peptide AB287314_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGAVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287315_MHBs_P-B Product feature CHAIN AB287315_MHBs_P-B of FT:mat_peptide AB287315_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGAVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287316_MHBs_P-B Product feature CHAIN AB287316_MHBs_P-B of FT:mat_peptide AB287316_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGAVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGPNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|AB287317_MHBs_P-B Product feature CHAIN AB287317_MHBs_P-B of FT:mat_peptide AB287317_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287318_MHBs_P-B Product feature CHAIN AB287318_MHBs_P-B of FT:mat_peptide AB287318_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSPTFHQTLQHPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB287319_MHBs_P-B Product feature CHAIN AB287319_MHBs_P-B of FT:mat_peptide AB287319_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287320_MHBs_P-B Product feature CHAIN AB287320_MHBs_P-B of FT:mat_peptide AB287320_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSTTGDPVPNMENITSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWCVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287321_MHBs_P-B Product feature CHAIN AB287321_MHBs_P-B of FT:mat_peptide AB287321_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGAPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB287322_MHBs_P-B Product feature CHAIN AB287322_MHBs_P-B of FT:mat_peptide AB287322_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287323_MHBs_P-B Product feature CHAIN AB287323_MHBs_P-B of FT:mat_peptide AB287323_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQSTASAISSTLSTTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEMPGCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNILRPFTPLLPIFLCLWVYI
>gnl|hbvpro|AB287325_MHBs_P-B Product feature CHAIN AB287325_MHBs_P-B of FT:mat_peptide AB287325_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPNLCTILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB287326_MHBs_P-B Product feature CHAIN AB287326_MHBs_P-B of FT:mat_peptide AB287326_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB287327_MHBs_P-B Product feature CHAIN AB287327_MHBs_P-B of FT:mat_peptide AB287327_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSNSSTTGGPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287328_MHBs_P-B Product feature CHAIN AB287328_MHBs_P-B of FT:mat_peptide AB287328_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287329_MHBs_P-B Product feature CHAIN AB287329_MHBs_P-B of FT:mat_peptide AB287329_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLKPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB300364_MHBs_P-B Product feature CHAIN AB300364_MHBs_P-B of FT:mat_peptide AB300364_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB300371_MHBs_P-B Product feature CHAIN AB300371_MHBs_P-B of FT:mat_peptide AB300371_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSTTSSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPMIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWTMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302095_MHBs_P-B Product feature CHAIN AB302095_MHBs_P-B of FT:mat_peptide AB302095_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVTNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSSIPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB302942_MHBs_P-B Product feature CHAIN AB302942_MHBs_P-B of FT:mat_peptide AB302942_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302943_MHBs_P-B Product feature CHAIN AB302943_MHBs_P-B of FT:mat_peptide AB302943_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302944_MHBs_P-B Product feature CHAIN AB302944_MHBs_P-B of FT:mat_peptide AB302944_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302945_MHBs_P-B Product feature CHAIN AB302945_MHBs_P-B of FT:mat_peptide AB302945_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPVQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB362933_MHBs_P-B Product feature CHAIN AB362933_MHBs_P-B of FT:mat_peptide AB362933_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTECLGQNSQFQISNHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB365445_MHBs_P-B Product feature CHAIN AB365445_MHBs_P-B of FT:mat_peptide AB365445_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWCVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB368295_MHBs_P-B Product feature CHAIN AB368295_MHBs_P-B of FT:mat_peptide AB368295_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVSQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB471854_MHBs_P-B Product feature CHAIN AB471854_MHBs_P-B of FT:mat_peptide AB471854_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQRLDSWWNSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB471855_MHBs_P-B Product feature CHAIN AB471855_MHBs_P-B of FT:mat_peptide AB471855_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB493827_MHBs_P-B Product feature CHAIN AB493827_MHBs_P-B of FT:mat_peptide AB493827_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB493833_MHBs_P-B Product feature CHAIN AB493833_MHBs_P-B of FT:mat_peptide AB493833_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVFI
>gnl|hbvpro|AB493835_MHBs_P-B Product feature CHAIN AB493835_MHBs_P-B of FT:mat_peptide AB493835_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB555498_MHBs_P-B Product feature CHAIN AB555498_MHBs_P-B of FT:mat_peptide AB555498_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB555499_MHBs_P-B Product feature CHAIN AB555499_MHBs_P-B of FT:mat_peptide AB555499_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHHSPHGPRVRALYFPAGGSSSGTVSPAQITVSAISSILSKTGDPAPNMENIASGLPGHLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB642093_MHBs_P-B Product feature CHAIN AB642093_MHBs_P-B of FT:mat_peptide AB642093_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGETPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWXXXFWGPXLXNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|AB642094_MHBs_P-B Product feature CHAIN AB642094_MHBs_P-B of FT:mat_peptide AB642094_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB642101_MHBs_P-B Product feature CHAIN AB642101_MHBs_P-B of FT:mat_peptide AB642101_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT2009-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSITFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFRGEAPVCPGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB675676_MHBs_P-B Product feature CHAIN AB675676_MHBs_P-B of FT:mat_peptide AB675676_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713527_MHBs_P-B Product feature CHAIN AB713527_MHBs_P-B of FT:mat_peptide AB713527_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713528_MHBs_P-B Product feature CHAIN AB713528_MHBs_P-B of FT:mat_peptide AB713528_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPKFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713529_MHBs_P-B Product feature CHAIN AB713529_MHBs_P-B of FT:mat_peptide AB713529_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv68). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQNLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713530_MHBs_P-B Product feature CHAIN AB713530_MHBs_P-B of FT:mat_peptide AB713530_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQNLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSWCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSGLSLLVPFVQWFVG
LSPPVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713531_MHBs_P-B Product feature CHAIN AB713531_MHBs_P-B of FT:mat_peptide AB713531_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMEDIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LAPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB828708_MHBs_P-B Product feature CHAIN AB828708_MHBs_P-B of FT:mat_peptide AB828708_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HB12-0626). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSATSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900095_MHBs_P-B Product feature CHAIN AB900095_MHBs_P-B of FT:mat_peptide AB900095_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQICSHLPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB900096_MHBs_P-B Product feature CHAIN AB900096_MHBs_P-B of FT:mat_peptide AB900096_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQTTVSAISSISSKTGDPVTNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILRPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB900097_MHBs_P-B Product feature CHAIN AB900097_MHBs_P-B of FT:mat_peptide AB900097_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLALLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB900098_MHBs_P-B Product feature CHAIN AB900098_MHBs_P-B of FT:mat_peptide AB900098_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVSTISSISSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB900102_MHBs_P-B Product feature CHAIN AB900102_MHBs_P-B of FT:mat_peptide AB900102_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900103_MHBs_P-B Product feature CHAIN AB900103_MHBs_P-B of FT:mat_peptide AB900103_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900104_MHBs_P-B Product feature CHAIN AB900104_MHBs_P-B of FT:mat_peptide AB900104_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900105_MHBs_P-B Product feature CHAIN AB900105_MHBs_P-B of FT:mat_peptide AB900105_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQCQISSHSPTCCPPTCPGYXWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900106_MHBs_P-B Product feature CHAIN AB900106_MHBs_P-B of FT:mat_peptide AB900106_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900107_MHBs_P-B Product feature CHAIN AB900107_MHBs_P-B of FT:mat_peptide AB900107_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFVLWVYI
>gnl|hbvpro|AB900108_MHBs_P-B Product feature CHAIN AB900108_MHBs_P-B of FT:mat_peptide AB900108_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900110_MHBs_P-B Product feature CHAIN AB900110_MHBs_P-B of FT:mat_peptide AB900110_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB900111_MHBs_P-B Product feature CHAIN AB900111_MHBs_P-B of FT:mat_peptide AB900111_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900112_MHBs_P-B Product feature CHAIN AB900112_MHBs_P-B of FT:mat_peptide AB900112_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAXSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLXLWVYI
>gnl|hbvpro|AB931168_MHBs_P-B Product feature CHAIN AB931168_MHBs_P-B of FT:mat_peptide AB931168_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGVPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB931169_MHBs_P-B Product feature CHAIN AB931169_MHBs_P-B of FT:mat_peptide AB931169_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGVPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLCNILSPFMPLLPIFCCLWVFI
>gnl|hbvpro|AB976562_MHBs_P-B Product feature CHAIN AB976562_MHBs_P-B of FT:mat_peptide AB976562_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPVLPIFFCLWVYI
>gnl|hbvpro|AF100308_MHBs_P-B Product feature CHAIN AF100308_MHBs_P-B of FT:mat_peptide AF100308_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF100309_MHBs_P-B Product feature CHAIN AF100309_MHBs_P-B of FT:mat_peptide AF100309_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPALNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121243_MHBs_P-B Product feature CHAIN AF121243_MHBs_P-B of FT:mat_peptide AF121243_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121244_MHBs_P-B Product feature CHAIN AF121244_MHBs_P-B of FT:mat_peptide AF121244_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF121245_MHBs_P-B Product feature CHAIN AF121245_MHBs_P-B of FT:mat_peptide AF121245_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121246_MHBs_P-B Product feature CHAIN AF121246_MHBs_P-B of FT:mat_peptide AF121246_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121247_MHBs_P-B Product feature CHAIN AF121247_MHBs_P-B of FT:mat_peptide AF121247_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121248_MHBs_P-B Product feature CHAIN AF121248_MHBs_P-B of FT:mat_peptide AF121248_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121249_MHBs_P-B Product feature CHAIN AF121249_MHBs_P-B of FT:mat_peptide AF121249_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121250_MHBs_P-B Product feature CHAIN AF121250_MHBs_P-B of FT:mat_peptide AF121250_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASRLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121251_MHBs_P-B Product feature CHAIN AF121251_MHBs_P-B of FT:mat_peptide AF121251_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGQTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLCNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF279464_MHBs_P-B Product feature CHAIN AF279464_MHBs_P-B of FT:mat_peptide AF279464_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF282917_MHBs_P-B Product feature CHAIN AF282917_MHBs_P-B of FT:mat_peptide AF282917_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AF282918_MHBs_P-B Product feature CHAIN AF282918_MHBs_P-B of FT:mat_peptide AF282918_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVYAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF461360_MHBs_P-B Product feature CHAIN AF461360_MHBs_P-B of FT:mat_peptide AF461360_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF479684_MHBs_P-B Product feature CHAIN AF479684_MHBs_P-B of FT:mat_peptide AF479684_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AJ627225_MHBs_P-B Product feature CHAIN AJ627225_MHBs_P-B of FT:mat_peptide AJ627225_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011084_MHBs_P-B Product feature CHAIN AP011084_MHBs_P-B of FT:mat_peptide AP011084_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSRTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWSVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011085_MHBs_P-B Product feature CHAIN AP011085_MHBs_P-B of FT:mat_peptide AP011085_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011086_MHBs_P-B Product feature CHAIN AP011086_MHBs_P-B of FT:mat_peptide AP011086_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011087_MHBs_P-B Product feature CHAIN AP011087_MHBs_P-B of FT:mat_peptide AP011087_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011088_MHBs_P-B Product feature CHAIN AP011088_MHBs_P-B of FT:mat_peptide AP011088_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011089_MHBs_P-B Product feature CHAIN AP011089_MHBs_P-B of FT:mat_peptide AP011089_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AP011090_MHBs_P-B Product feature CHAIN AP011090_MHBs_P-B of FT:mat_peptide AP011090_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011091_MHBs_P-B Product feature CHAIN AP011091_MHBs_P-B of FT:mat_peptide AP011091_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011092_MHBs_P-B Product feature CHAIN AP011092_MHBs_P-B of FT:mat_peptide AP011092_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011093_MHBs_P-B Product feature CHAIN AP011093_MHBs_P-B of FT:mat_peptide AP011093_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFIQWFVG
LSPTVWLSVLWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011094_MHBs_P-B Product feature CHAIN AP011094_MHBs_P-B of FT:mat_peptide AP011094_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011095_MHBs_P-B Product feature CHAIN AP011095_MHBs_P-B of FT:mat_peptide AP011095_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011096_MHBs_P-B Product feature CHAIN AP011096_MHBs_P-B of FT:mat_peptide AP011096_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY033072_MHBs_P-B Product feature CHAIN AY033072_MHBs_P-B of FT:mat_peptide AY033072_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY033073_MHBs_P-B Product feature CHAIN AY033073_MHBs_P-B of FT:mat_peptide AY033073_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIVMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY163869_MHBs_P-B Product feature CHAIN AY163869_MHBs_P-B of FT:mat_peptide AY163869_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY163870_MHBs_P-B Product feature CHAIN AY163870_MHBs_P-B of FT:mat_peptide AY163870_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167089_MHBs_P-B Product feature CHAIN AY167089_MHBs_P-B of FT:mat_peptide AY167089_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167093_MHBs_P-B Product feature CHAIN AY167093_MHBs_P-B of FT:mat_peptide AY167093_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILTPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167094_MHBs_P-B Product feature CHAIN AY167094_MHBs_P-B of FT:mat_peptide AY167094_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167097_MHBs_P-B Product feature CHAIN AY167097_MHBs_P-B of FT:mat_peptide AY167097_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167098_MHBs_P-B Product feature CHAIN AY167098_MHBs_P-B of FT:mat_peptide AY167098_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|AY167100_MHBs_P-B Product feature CHAIN AY167100_MHBs_P-B of FT:mat_peptide AY167100_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=281 residues).
MHWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKTGDPVPNMENIVSGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167101_MHBs_P-B Product feature CHAIN AY167101_MHBs_P-B of FT:mat_peptide AY167101_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167102_MHBs_P-B Product feature CHAIN AY167102_MHBs_P-B of FT:mat_peptide AY167102_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGIPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPLSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY206373_MHBs_P-B Product feature CHAIN AY206373_MHBs_P-B of FT:mat_peptide AY206373_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKTGDPVPNMENITSGLLGPLLVSQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLVDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSLFMPLLPIFFCLWVYI
>gnl|hbvpro|AY206375_MHBs_P-B Product feature CHAIN AY206375_MHBs_P-B of FT:mat_peptide AY206375_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNRTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY206383_MHBs_P-B Product feature CHAIN AY206383_MHBs_P-B of FT:mat_peptide AY206383_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHHTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY206390_MHBs_P-B Product feature CHAIN AY206390_MHBs_P-B of FT:mat_peptide AY206390_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYV
>gnl|hbvpro|AY206391_MHBs_P-B Product feature CHAIN AY206391_MHBs_P-B of FT:mat_peptide AY206391_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYPPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217355_MHBs_P-B Product feature CHAIN AY217355_MHBs_P-B of FT:mat_peptide AY217355_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A6-2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217356_MHBs_P-B Product feature CHAIN AY217356_MHBs_P-B of FT:mat_peptide AY217356_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217357_MHBs_P-B Product feature CHAIN AY217357_MHBs_P-B of FT:mat_peptide AY217357_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217358_MHBs_P-B Product feature CHAIN AY217358_MHBs_P-B of FT:mat_peptide AY217358_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217359_MHBs_P-B Product feature CHAIN AY217359_MHBs_P-B of FT:mat_peptide AY217359_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVGALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPVQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217360_MHBs_P-B Product feature CHAIN AY217360_MHBs_P-B of FT:mat_peptide AY217360_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217362_MHBs_P-B Product feature CHAIN AY217362_MHBs_P-B of FT:mat_peptide AY217362_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYVPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217368_MHBs_P-B Product feature CHAIN AY217368_MHBs_P-B of FT:mat_peptide AY217368_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21949). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNIVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQAMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFFLWAYI
>gnl|hbvpro|AY220697_MHBs_P-B Product feature CHAIN AY220697_MHBs_P-B of FT:mat_peptide AY220697_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLPAGFSLLTKI
LTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY220698_MHBs_P-B Product feature CHAIN AY220698_MHBs_P-B of FT:mat_peptide AY220698_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY220703_MHBs_P-B Product feature CHAIN AY220703_MHBs_P-B of FT:mat_peptide AY220703_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYLPAGGSSSEIVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AY220704_MHBs_P-B Product feature CHAIN AY220704_MHBs_P-B of FT:mat_peptide AY220704_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYLPAGGSSSEIVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVISMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY293309_MHBs_P-B Product feature CHAIN AY293309_MHBs_P-B of FT:mat_peptide AY293309_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY517489_MHBs_P-B Product feature CHAIN AY517489_MHBs_P-B of FT:mat_peptide AY517489_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNPTTFHQTLQDPKVRALYFPAGSSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLPGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY517619_MHBs_P-B Product feature CHAIN AY517619_MHBs_P-B of FT:mat_peptide AY517619_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLPGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY518556_MHBs_P-B Product feature CHAIN AY518556_MHBs_P-B of FT:mat_peptide AY518556_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596102_MHBs_P-B Product feature CHAIN AY596102_MHBs_P-B of FT:mat_peptide AY596102_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596103_MHBs_P-B Product feature CHAIN AY596103_MHBs_P-B of FT:mat_peptide AY596103_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596104_MHBs_P-B Product feature CHAIN AY596104_MHBs_P-B of FT:mat_peptide AY596104_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY596105_MHBs_P-B Product feature CHAIN AY596105_MHBs_P-B of FT:mat_peptide AY596105_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596106_MHBs_P-B Product feature CHAIN AY596106_MHBs_P-B of FT:mat_peptide AY596106_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596109_MHBs_P-B Product feature CHAIN AY596109_MHBs_P-B of FT:mat_peptide AY596109_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596110_MHBs_P-B Product feature CHAIN AY596110_MHBs_P-B of FT:mat_peptide AY596110_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596111_MHBs_P-B Product feature CHAIN AY596111_MHBs_P-B of FT:mat_peptide AY596111_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYSILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AY596112_MHBs_P-B Product feature CHAIN AY596112_MHBs_P-B of FT:mat_peptide AY596112_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY766463_MHBs_P-B Product feature CHAIN AY766463_MHBs_P-B of FT:mat_peptide AY766463_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSPWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800389_MHBs_P-B Product feature CHAIN AY800389_MHBs_P-B of FT:mat_peptide AY800389_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPPLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800391_MHBs_P-B Product feature CHAIN AY800391_MHBs_P-B of FT:mat_peptide AY800391_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASSKSSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800392_MHBs_P-B Product feature CHAIN AY800392_MHBs_P-B of FT:mat_peptide AY800392_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASSKSSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|D00329_MHBs_P-B Product feature CHAIN D00329_MHBs_P-B of FT:mat_peptide D00329_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D00330_MHBs_P-B Product feature CHAIN D00330_MHBs_P-B of FT:mat_peptide D00330_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPGVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D00331_MHBs_C-B Product feature CHAIN D00331_MHBs_C-B of FT:mat_peptide D00331_MHBs_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPLSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D23678_MHBs_P-B Product feature CHAIN D23678_MHBs_P-B of FT:mat_peptide D23678_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVTNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D23679_MHBs_P-B Product feature CHAIN D23679_MHBs_P-B of FT:mat_peptide D23679_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSATFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D50521_MHBs_P-B Product feature CHAIN D50521_MHBs_P-B of FT:mat_peptide D50521_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLA
VCPLIPGSSTTSTGPCKTCTTPARNTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWAYI
>gnl|hbvpro|D50522_MHBs_P-B Product feature CHAIN D50522_MHBs_P-B of FT:mat_peptide D50522_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLA
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141615_MHBs_P-B Product feature CHAIN DQ141615_MHBs_P-B of FT:mat_peptide DQ141615_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141616_MHBs_P-B Product feature CHAIN DQ141616_MHBs_P-B of FT:mat_peptide DQ141616_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141617_MHBs_P-B Product feature CHAIN DQ141617_MHBs_P-B of FT:mat_peptide DQ141617_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH16AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141618_MHBs_P-B Product feature CHAIN DQ141618_MHBs_P-B of FT:mat_peptide DQ141618_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPEGLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141619_MHBs_P-B Product feature CHAIN DQ141619_MHBs_P-B of FT:mat_peptide DQ141619_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH38AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLPGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141620_MHBs_P-B Product feature CHAIN DQ141620_MHBs_P-B of FT:mat_peptide DQ141620_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH30AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141621_MHBs_P-B Product feature CHAIN DQ141621_MHBs_P-B of FT:mat_peptide DQ141621_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH42AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTFQDPRVRGLYFPVGGSSSGTVSPAQNTVSAISSILSTTGDPVPKMENIASGLLGPLLVVQEGIFSLTKI
LTIPQSLESGWTSLNFLGETPVGLGQNSQSQISSHSPTCCPPICPGYRWMGLRRFIIFLCILLLCLIFLLVLLDYQGMLP
ACPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141622_MHBs_P-B Product feature CHAIN DQ141622_MHBs_P-B of FT:mat_peptide DQ141622_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVNPVQNTVSSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141623_MHBs_P-B Product feature CHAIN DQ141623_MHBs_P-B of FT:mat_peptide DQ141623_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1877Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141624_MHBs_P-B Product feature CHAIN DQ141624_MHBs_P-B of FT:mat_peptide DQ141624_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2069Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141626_MHBs_P-B Product feature CHAIN DQ141626_MHBs_P-B of FT:mat_peptide DQ141626_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2175Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALFLPVGGSSSGTVNPVQNTASSTSSTFSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLNSWWTSLNFLGGTPVCLGQNSQSQISSHSPTWCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141627_MHBs_P-B Product feature CHAIN DQ141627_MHBs_P-B of FT:mat_peptide DQ141627_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141628_MHBs_P-B Product feature CHAIN DQ141628_MHBs_P-B of FT:mat_peptide DQ141628_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH44AJava). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VRWNSPTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141629_MHBs_P-B Product feature CHAIN DQ141629_MHBs_P-B of FT:mat_peptide DQ141629_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2028Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141630_MHBs_P-B Product feature CHAIN DQ141630_MHBs_P-B of FT:mat_peptide DQ141630_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH24AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141631_MHBs_P-B Product feature CHAIN DQ141631_MHBs_P-B of FT:mat_peptide DQ141631_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1932Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVNPVQTTASPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ141632_MHBs_P-B Product feature CHAIN DQ141632_MHBs_P-B of FT:mat_peptide DQ141632_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM1Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141633_MHBs_P-B Product feature CHAIN DQ141633_MHBs_P-B of FT:mat_peptide DQ141633_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM2Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141634_MHBs_P-B Product feature CHAIN DQ141634_MHBs_P-B of FT:mat_peptide DQ141634_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM4Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141635_MHBs_P-B Product feature CHAIN DQ141635_MHBs_P-B of FT:mat_peptide DQ141635_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH27AJava). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCGCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141636_MHBs_P-B Product feature CHAIN DQ141636_MHBs_P-B of FT:mat_peptide DQ141636_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH31AJava). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSGWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCGCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141637_MHBs_P-B Product feature CHAIN DQ141637_MHBs_P-B of FT:mat_peptide DQ141637_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH32Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWLWGPSLDNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141638_MHBs_P-B Product feature CHAIN DQ141638_MHBs_P-B of FT:mat_peptide DQ141638_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr026East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDSRVRALYFPAGGSSSGTVNPVQNTASPISSILSRTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFTKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141639_MHBs_P-B Product feature CHAIN DQ141639_MHBs_P-B of FT:mat_peptide DQ141639_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr056East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLSLIFLLVLLDYQGMLP
VCPLIPGSSTTSPGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141640_MHBs_P-B Product feature CHAIN DQ141640_MHBs_P-B of FT:mat_peptide DQ141640_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr178East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDSRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141641_MHBs_P-B Product feature CHAIN DQ141641_MHBs_P-B of FT:mat_peptide DQ141641_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2077Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VKWNSPTFHQTLQDPRVKALYFPAGGSSSGIVNPVQNTASSISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLGPFVQGFVG
LSPTVGLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141642_MHBs_P-B Product feature CHAIN DQ141642_MHBs_P-B of FT:mat_peptide DQ141642_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2052Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQTLQDPVVRALYLPVGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141643_MHBs_P-B Product feature CHAIN DQ141643_MHBs_P-B of FT:mat_peptide DQ141643_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2050Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141644_MHBs_P-B Product feature CHAIN DQ141644_MHBs_P-B of FT:mat_peptide DQ141644_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141645_MHBs_P-B Product feature CHAIN DQ141645_MHBs_P-B of FT:mat_peptide DQ141645_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM3Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141646_MHBs_P-B Product feature CHAIN DQ141646_MHBs_P-B of FT:mat_peptide DQ141646_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH43AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141647_MHBs_P-B Product feature CHAIN DQ141647_MHBs_P-B of FT:mat_peptide DQ141647_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr001East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGQVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141648_MHBs_P-B Product feature CHAIN DQ141648_MHBs_P-B of FT:mat_peptide DQ141648_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr029East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCWTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141649_MHBs_P-B Product feature CHAIN DQ141649_MHBs_P-B of FT:mat_peptide DQ141649_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr040East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVPLDYQGMLP
VCPLIPGLSTTSTGPCRTCTTPAQGTSMFSSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141650_MHBs_P-B Product feature CHAIN DQ141650_MHBs_P-B of FT:mat_peptide DQ141650_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIESGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSFIIFLCILLLCLMFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141651_MHBs_P-B Product feature CHAIN DQ141651_MHBs_P-B of FT:mat_peptide DQ141651_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr052East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGQVNPVQTTASSISSILSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQRLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLFLIFLLVLLDYQGMLP
LCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141652_MHBs_P-B Product feature CHAIN DQ141652_MHBs_P-B of FT:mat_peptide DQ141652_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr060East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141653_MHBs_P-B Product feature CHAIN DQ141653_MHBs_P-B of FT:mat_peptide DQ141653_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD48East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141654_MHBs_P-B Product feature CHAIN DQ141654_MHBs_P-B of FT:mat_peptide DQ141654_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SBT19East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTKFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|DQ141655_MHBs_P-B Product feature CHAIN DQ141655_MHBs_P-B of FT:mat_peptide DQ141655_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD35East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSRSGTVNPVQNTASSISSTLSKTGDPVPNMENIASRLPRPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLRGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ377158_MHBs_P-B Product feature CHAIN DQ377158_MHBs_P-B of FT:mat_peptide DQ377158_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448619_MHBs_P-B Product feature CHAIN DQ448619_MHBs_P-B of FT:mat_peptide DQ448619_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448620_MHBs_P-B Product feature CHAIN DQ448620_MHBs_P-B of FT:mat_peptide DQ448620_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448621_MHBs_P-B Product feature CHAIN DQ448621_MHBs_P-B of FT:mat_peptide DQ448621_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448622_MHBs_P-B Product feature CHAIN DQ448622_MHBs_P-B of FT:mat_peptide DQ448622_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDSVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448623_MHBs_P-B Product feature CHAIN DQ448623_MHBs_P-B of FT:mat_peptide DQ448623_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448624_MHBs_P-B Product feature CHAIN DQ448624_MHBs_P-B of FT:mat_peptide DQ448624_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448625_MHBs_P-B Product feature CHAIN DQ448625_MHBs_P-B of FT:mat_peptide DQ448625_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNFTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448626_MHBs_P-B Product feature CHAIN DQ448626_MHBs_P-B of FT:mat_peptide DQ448626_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448627_MHBs_P-B Product feature CHAIN DQ448627_MHBs_P-B of FT:mat_peptide DQ448627_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448628_MHBs_P-B Product feature CHAIN DQ448628_MHBs_P-B of FT:mat_peptide DQ448628_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463787_MHBs_P-B Product feature CHAIN DQ463787_MHBs_P-B of FT:mat_peptide DQ463787_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPECLGQNSQFQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ463788_MHBs_P-B Product feature CHAIN DQ463788_MHBs_P-B of FT:mat_peptide DQ463788_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463789_MHBs_P-B Product feature CHAIN DQ463789_MHBs_P-B of FT:mat_peptide DQ463789_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463790_MHBs_P-B Product feature CHAIN DQ463790_MHBs_P-B of FT:mat_peptide DQ463790_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLILLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463791_MHBs_P-B Product feature CHAIN DQ463791_MHBs_P-B of FT:mat_peptide DQ463791_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDTPVCPGQNSQSQICSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLALLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWSWGPNLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463792_MHBs_P-B Product feature CHAIN DQ463792_MHBs_P-B of FT:mat_peptide DQ463792_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463793_MHBs_P-B Product feature CHAIN DQ463793_MHBs_P-B of FT:mat_peptide DQ463793_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASPISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463794_MHBs_P-B Product feature CHAIN DQ463794_MHBs_P-B of FT:mat_peptide DQ463794_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGEPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463795_MHBs_P-B Product feature CHAIN DQ463795_MHBs_P-B of FT:mat_peptide DQ463795_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTTPQSLDSWWTSLSFLGGTPECLGQNSQFQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLCNTLSRFVPLFPIFFCLWVYI
>gnl|hbvpro|DQ463796_MHBs_P-B Product feature CHAIN DQ463796_MHBs_P-B of FT:mat_peptide DQ463796_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYHWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463797_MHBs_P-B Product feature CHAIN DQ463797_MHBs_P-B of FT:mat_peptide DQ463797_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLYLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLRNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463798_MHBs_P-B Product feature CHAIN DQ463798_MHBs_P-B of FT:mat_peptide DQ463798_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463799_MHBs_P-B Product feature CHAIN DQ463799_MHBs_P-B of FT:mat_peptide DQ463799_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463800_MHBs_P-B Product feature CHAIN DQ463800_MHBs_P-B of FT:mat_peptide DQ463800_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463801_MHBs_P-B Product feature CHAIN DQ463801_MHBs_P-B of FT:mat_peptide DQ463801_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASPISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463802_MHBs_P-B Product feature CHAIN DQ463802_MHBs_P-B of FT:mat_peptide DQ463802_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDSTVRTLNLPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCHIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ904357_MHBs_P-B Product feature CHAIN DQ904357_MHBs_P-B of FT:mat_peptide DQ904357_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993680_MHBs_P-B Product feature CHAIN DQ993680_MHBs_P-B of FT:mat_peptide DQ993680_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993681_MHBs_P-B Product feature CHAIN DQ993681_MHBs_P-B of FT:mat_peptide DQ993681_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|DQ993682_MHBs_P-B Product feature CHAIN DQ993682_MHBs_P-B of FT:mat_peptide DQ993682_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 479). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993683_MHBs_P-B Product feature CHAIN DQ993683_MHBs_P-B of FT:mat_peptide DQ993683_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993684_MHBs_P-B Product feature CHAIN DQ993684_MHBs_P-B of FT:mat_peptide DQ993684_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLQGPLLVLQAGFFLLTKS
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPDCPGYPRMCLRGFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993685_MHBs_P-B Product feature CHAIN DQ993685_MHBs_P-B of FT:mat_peptide DQ993685_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993686_MHBs_P-B Product feature CHAIN DQ993686_MHBs_P-B of FT:mat_peptide DQ993686_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCPGQNSQSQIFSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARNPSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993687_MHBs_P-B Product feature CHAIN DQ993687_MHBs_P-B of FT:mat_peptide DQ993687_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAXXTASAISXTFXKTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKI
LTIPQXLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIRIPSSWAFAKYLWEWASVRFSWLSLLLPFVQWFVR
LSPTVWFSVIWMMWNWGPSLYKIGSPFMPLLPIFFCXXXFI
>gnl|hbvpro|DQ993696_MHBs_P-B Product feature CHAIN DQ993696_MHBs_P-B of FT:mat_peptide DQ993696_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWGTSLNFLVGAPVCLDQNSQSPISSHSPTCCPPICPDYPWMCLRRFIIFLCILLLCLIFLMVLLDYQGMLP
VCPLIPGSSTTSTGPWNTCTAPAQGTSMFPSCCCTKPTDGNCACIPVPSSWAFPKYLWEWASVRFSWLGLLVPFVQWFVR
LSPLVWLSVIWMMWYWGPSLYNILSPFMPLLPXFFCLWVYI
>gnl|hbvpro|DQ993697_MHBs_P-B Product feature CHAIN DQ993697_MHBs_P-B of FT:mat_peptide DQ993697_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993698_MHBs_P-B Product feature CHAIN DQ993698_MHBs_P-B of FT:mat_peptide DQ993698_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRSCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993699_MHBs_P-B Product feature CHAIN DQ993699_MHBs_P-B of FT:mat_peptide DQ993699_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRSCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993700_MHBs_P-B Product feature CHAIN DQ993700_MHBs_P-B of FT:mat_peptide DQ993700_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVQFVQWFVG
LSPTVWLSVMWKMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993701_MHBs_P-B Product feature CHAIN DQ993701_MHBs_P-B of FT:mat_peptide DQ993701_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ993702_MHBs_P-B Product feature CHAIN DQ993702_MHBs_P-B of FT:mat_peptide DQ993702_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=281 residues).
MEWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSTTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFLCLWVYL
>gnl|hbvpro|DQ993703_MHBs_P-B Product feature CHAIN DQ993703_MHBs_P-B of FT:mat_peptide DQ993703_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993704_MHBs_P-B Product feature CHAIN DQ993704_MHBs_P-B of FT:mat_peptide DQ993704_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993705_MHBs_P-B Product feature CHAIN DQ993705_MHBs_P-B of FT:mat_peptide DQ993705_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLPAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSHISSHSPTCCPPICPGYRWMCLPRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993706_MHBs_P-B Product feature CHAIN DQ993706_MHBs_P-B of FT:mat_peptide DQ993706_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993707_MHBs_P-B Product feature CHAIN DQ993707_MHBs_P-B of FT:mat_peptide DQ993707_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993708_MHBs_P-B Product feature CHAIN DQ993708_MHBs_P-B of FT:mat_peptide DQ993708_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993709_MHBs_P-B Product feature CHAIN DQ993709_MHBs_P-B of FT:mat_peptide DQ993709_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVKALYFPAGGSSSGTVSPAQNTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993710_MHBs_P-B Product feature CHAIN DQ993710_MHBs_P-B of FT:mat_peptide DQ993710_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ995801_MHBs_P-B Product feature CHAIN DQ995801_MHBs_P-B of FT:mat_peptide DQ995801_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMSLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCAKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995802_MHBs_P-B Product feature CHAIN DQ995802_MHBs_P-B of FT:mat_peptide DQ995802_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLRAGFFSLTKI
LTIPQSLDSWWTSLNFLGEIPVCLGQNSQSPISSHSPTCCPPICPGYRRMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995804_MHBs_P-B Product feature CHAIN DQ995804_MHBs_P-B of FT:mat_peptide DQ995804_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTKFHQTLQDPRVRALYIPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLGFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLLILFCLWVYI
>gnl|hbvpro|EF134945_MHBs_P-B Product feature CHAIN EF134945_MHBs_P-B of FT:mat_peptide EF134945_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPPLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQRTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF134946_MHBs_P-B Product feature CHAIN EF134946_MHBs_P-B of FT:mat_peptide EF134946_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQRTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473971_MHBs_P-B Product feature CHAIN EF473971_MHBs_P-B of FT:mat_peptide EF473971_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473972_MHBs_P-B Product feature CHAIN EF473972_MHBs_P-B of FT:mat_peptide EF473972_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVNPVQNTVSSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473973_MHBs_P-B Product feature CHAIN EF473973_MHBs_P-B of FT:mat_peptide EF473973_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473974_MHBs_P-B Product feature CHAIN EF473974_MHBs_P-B of FT:mat_peptide EF473974_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPEGLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473975_MHBs_P-B Product feature CHAIN EF473975_MHBs_P-B of FT:mat_peptide EF473975_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473976_MHBs_P-B Product feature CHAIN EF473976_MHBs_P-B of FT:mat_peptide EF473976_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIESGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSFIIFLCILLLCLMFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473977_MHBs_P-B Product feature CHAIN EF473977_MHBs_P-B of FT:mat_peptide EF473977_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494380_MHBs_P-B Product feature CHAIN EF494380_MHBs_P-B of FT:mat_peptide EF494380_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWSSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCACIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494381_MHBs_P-B Product feature CHAIN EF494381_MHBs_P-B of FT:mat_peptide EF494381_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLICLLGLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU139543_MHBs_P-B Product feature CHAIN EU139543_MHBs_P-B of FT:mat_peptide EU139543_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU158262_MHBs_P-B Product feature CHAIN EU158262_MHBs_P-B of FT:mat_peptide EU158262_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFSLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU158263_MHBs_P-B Product feature CHAIN EU158263_MHBs_P-B of FT:mat_peptide EU158263_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU305547_MHBs_P-B Product feature CHAIN EU305547_MHBs_P-B of FT:mat_peptide EU305547_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSGSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCAKPTNGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFRLWVYI
>gnl|hbvpro|EU305548_MHBs_P-B Product feature CHAIN EU305548_MHBs_P-B of FT:mat_peptide EU305548_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSIGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306678_MHBs_P-B Product feature CHAIN EU306678_MHBs_P-B of FT:mat_peptide EU306678_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306679_MHBs_P-B Product feature CHAIN EU306679_MHBs_P-B of FT:mat_peptide EU306679_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYV
>gnl|hbvpro|EU306680_MHBs_P-B Product feature CHAIN EU306680_MHBs_P-B of FT:mat_peptide EU306680_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYV
>gnl|hbvpro|EU306681_MHBs_P-B Product feature CHAIN EU306681_MHBs_P-B of FT:mat_peptide EU306681_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306695_MHBs_P-B Product feature CHAIN EU306695_MHBs_P-B of FT:mat_peptide EU306695_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306696_MHBs_P-B Product feature CHAIN EU306696_MHBs_P-B of FT:mat_peptide EU306696_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWERASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306697_MHBs_P-B Product feature CHAIN EU306697_MHBs_P-B of FT:mat_peptide EU306697_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306698_MHBs_P-B Product feature CHAIN EU306698_MHBs_P-B of FT:mat_peptide EU306698_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306699_MHBs_P-B Product feature CHAIN EU306699_MHBs_P-B of FT:mat_peptide EU306699_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCRTSTTLAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLGLLVPFVQWFVG
LSPTVWLPVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306700_MHBs_P-B Product feature CHAIN EU306700_MHBs_P-B of FT:mat_peptide EU306700_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306701_MHBs_P-B Product feature CHAIN EU306701_MHBs_P-B of FT:mat_peptide EU306701_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306702_MHBs_P-B Product feature CHAIN EU306702_MHBs_P-B of FT:mat_peptide EU306702_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306703_MHBs_P-B Product feature CHAIN EU306703_MHBs_P-B of FT:mat_peptide EU306703_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWLCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306704_MHBs_P-B Product feature CHAIN EU306704_MHBs_P-B of FT:mat_peptide EU306704_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKCLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306705_MHBs_P-B Product feature CHAIN EU306705_MHBs_P-B of FT:mat_peptide EU306705_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPAVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306706_MHBs_P-B Product feature CHAIN EU306706_MHBs_P-B of FT:mat_peptide EU306706_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306707_MHBs_P-B Product feature CHAIN EU306707_MHBs_P-B of FT:mat_peptide EU306707_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKCLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306708_MHBs_P-B Product feature CHAIN EU306708_MHBs_P-B of FT:mat_peptide EU306708_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306709_MHBs_P-B Product feature CHAIN EU306709_MHBs_P-B of FT:mat_peptide EU306709_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306710_MHBs_P-B Product feature CHAIN EU306710_MHBs_P-B of FT:mat_peptide EU306710_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSNSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306711_MHBs_P-B Product feature CHAIN EU306711_MHBs_P-B of FT:mat_peptide EU306711_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSITFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306712_MHBs_P-B Product feature CHAIN EU306712_MHBs_P-B of FT:mat_peptide EU306712_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU330989_MHBs_P-B Product feature CHAIN EU330989_MHBs_P-B of FT:mat_peptide EU330989_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSATSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKHLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330990_MHBs_P-B Product feature CHAIN EU330990_MHBs_P-B of FT:mat_peptide EU330990_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSATSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKHLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330994_MHBs_P-B Product feature CHAIN EU330994_MHBs_P-B of FT:mat_peptide EU330994_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISGHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVR
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330995_MHBs_P-B Product feature CHAIN EU330995_MHBs_P-B of FT:mat_peptide EU330995_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTEI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMIWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|EU330996_MHBs_P-B Product feature CHAIN EU330996_MHBs_P-B of FT:mat_peptide EU330996_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330997_MHBs_P-B Product feature CHAIN EU330997_MHBs_P-B of FT:mat_peptide EU330997_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330998_MHBs_P-B Product feature CHAIN EU330998_MHBs_P-B of FT:mat_peptide EU330998_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRLFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330999_MHBs_P-B Product feature CHAIN EU330999_MHBs_P-B of FT:mat_peptide EU330999_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRLFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU331000_MHBs_P-B Product feature CHAIN EU331000_MHBs_P-B of FT:mat_peptide EU331000_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU331001_MHBs_P-B Product feature CHAIN EU331001_MHBs_P-B of FT:mat_peptide EU331001_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU350409_MHBs_P-B Product feature CHAIN EU350409_MHBs_P-B of FT:mat_peptide EU350409_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439018_MHBs_P-B Product feature CHAIN EU439018_MHBs_P-B of FT:mat_peptide EU439018_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439020_MHBs_P-B Product feature CHAIN EU439020_MHBs_P-B of FT:mat_peptide EU439020_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439021_MHBs_P-B Product feature CHAIN EU439021_MHBs_P-B of FT:mat_peptide EU439021_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMESIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPILFCLWVYI
>gnl|hbvpro|EU439022_MHBs_P-B Product feature CHAIN EU439022_MHBs_P-B of FT:mat_peptide EU439022_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNRTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439023_MHBs_P-B Product feature CHAIN EU439023_MHBs_P-B of FT:mat_peptide EU439023_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTPQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGPSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU487256_MHBs_P-B Product feature CHAIN EU487256_MHBs_P-B of FT:mat_peptide EU487256_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIQLLPIFFCLWVYI
>gnl|hbvpro|EU487257_MHBs_P-B Product feature CHAIN EU487257_MHBs_P-B of FT:mat_peptide EU487257_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLRPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU522067_MHBs_P-B Product feature CHAIN EU522067_MHBs_P-B of FT:mat_peptide EU522067_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU522072_MHBs_P-B Product feature CHAIN EU522072_MHBs_P-B of FT:mat_peptide EU522072_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|EU522074_MHBs_P-B Product feature CHAIN EU522074_MHBs_P-B of FT:mat_peptide EU522074_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU547563_MHBs_P-B Product feature CHAIN EU547563_MHBs_P-B of FT:mat_peptide EU547563_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNATTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564822_MHBs_P-B Product feature CHAIN EU564822_MHBs_P-B of FT:mat_peptide EU564822_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNATTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564823_MHBs_P-B Product feature CHAIN EU564823_MHBs_P-B of FT:mat_peptide EU564823_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564824_MHBs_P-B Product feature CHAIN EU564824_MHBs_P-B of FT:mat_peptide EU564824_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMLLLPIFFCLWVYI
>gnl|hbvpro|EU564826_MHBs_P-B Product feature CHAIN EU564826_MHBs_P-B of FT:mat_peptide EU564826_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALNFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570070_MHBs_P-B Product feature CHAIN EU570070_MHBs_P-B of FT:mat_peptide EU570070_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570071_MHBs_P-B Product feature CHAIN EU570071_MHBs_P-B of FT:mat_peptide EU570071_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570075_MHBs_P-B Product feature CHAIN EU570075_MHBs_P-B of FT:mat_peptide EU570075_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGTPACLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU579441_MHBs_P-B Product feature CHAIN EU579441_MHBs_P-B of FT:mat_peptide EU579441_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSPNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|EU589335_MHBs_P-B Product feature CHAIN EU589335_MHBs_P-B of FT:mat_peptide EU589335_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|EU595031_MHBs_P-B Product feature CHAIN EU595031_MHBs_P-B of FT:mat_peptide EU595031_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVILMMWFWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|EU660230_MHBs_P-B Product feature CHAIN EU660230_MHBs_P-B of FT:mat_peptide EU660230_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
VRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU660231_MHBs_P-B Product feature CHAIN EU660231_MHBs_P-B of FT:mat_peptide EU660231_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
VRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU660232_MHBs_P-B Product feature CHAIN EU660232_MHBs_P-B of FT:mat_peptide EU660232_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=278 residues).
VRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSP
TVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU660233_MHBs_P-B Product feature CHAIN EU660233_MHBs_P-B of FT:mat_peptide EU660233_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=278 residues).
VRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSP
TVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU796066_MHBs_P-B Product feature CHAIN EU796066_MHBs_P-B of FT:mat_peptide EU796066_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU796067_MHBs_P-B Product feature CHAIN EU796067_MHBs_P-B of FT:mat_peptide EU796067_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILLETGDPVPNMENIASGLLGPLLVLQAGLFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU796068_MHBs_P-B Product feature CHAIN EU796068_MHBs_P-B of FT:mat_peptide EU796068_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMVNIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU881997_MHBs_P-B Product feature CHAIN EU881997_MHBs_P-B of FT:mat_peptide EU881997_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCRGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU881998_MHBs_P-B Product feature CHAIN EU881998_MHBs_P-B of FT:mat_peptide EU881998_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU882002_MHBs_P-B Product feature CHAIN EU882002_MHBs_P-B of FT:mat_peptide EU882002_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU882003_MHBs_P-B Product feature CHAIN EU882003_MHBs_P-B of FT:mat_peptide EU882003_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Non-functional genomic sequence. [Hepadnaviridae] (length=278 residues).
MQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGNSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSP
TAWLSVIWMMWYWGPSLYNILSPFMPLLPIFYCLWVYI
>gnl|hbvpro|EU882004_MHBs_P-B Product feature CHAIN EU882004_MHBs_P-B of FT:mat_peptide EU882004_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFAQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|EU919171_MHBs_P-B Product feature CHAIN EU919171_MHBs_P-B of FT:mat_peptide EU919171_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919172_MHBs_P-B Product feature CHAIN EU919172_MHBs_P-B of FT:mat_peptide EU919172_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAQFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919173_MHBs_P-B Product feature CHAIN EU919173_MHBs_P-B of FT:mat_peptide EU919173_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919175_MHBs_P-B Product feature CHAIN EU919175_MHBs_P-B of FT:mat_peptide EU919175_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919176_MHBs_P-B Product feature CHAIN EU919176_MHBs_P-B of FT:mat_peptide EU919176_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939559_MHBs_P-B Product feature CHAIN EU939559_MHBs_P-B of FT:mat_peptide EU939559_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939633_MHBs_P-B Product feature CHAIN EU939633_MHBs_P-B of FT:mat_peptide EU939633_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFGLWVYM
>gnl|hbvpro|EU939634_MHBs_P-B Product feature CHAIN EU939634_MHBs_P-B of FT:mat_peptide EU939634_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFXLWVYM
>gnl|hbvpro|EU939635_MHBs_P-B Product feature CHAIN EU939635_MHBs_P-B of FT:mat_peptide EU939635_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B125). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGYFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPKLYSILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939636_MHBs_P-B Product feature CHAIN EU939636_MHBs_P-B of FT:mat_peptide EU939636_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939637_MHBs_P-B Product feature CHAIN EU939637_MHBs_P-B of FT:mat_peptide EU939637_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLRPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKVCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYDILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939638_MHBs_P-B Product feature CHAIN EU939638_MHBs_P-B of FT:mat_peptide EU939638_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSLWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939639_MHBs_P-B Product feature CHAIN EU939639_MHBs_P-B of FT:mat_peptide EU939639_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939661_MHBs_P-B Product feature CHAIN EU939661_MHBs_P-B of FT:mat_peptide EU939661_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLRPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939663_MHBs_P-B Product feature CHAIN EU939663_MHBs_P-B of FT:mat_peptide EU939663_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939664_MHBs_P-B Product feature CHAIN EU939664_MHBs_P-B of FT:mat_peptide EU939664_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENITSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939665_MHBs_P-B Product feature CHAIN EU939665_MHBs_P-B of FT:mat_peptide EU939665_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSXISSILXKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939666_MHBs_P-B Product feature CHAIN EU939666_MHBs_P-B of FT:mat_peptide EU939666_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDLRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939667_MHBs_P-B Product feature CHAIN EU939667_MHBs_P-B of FT:mat_peptide EU939667_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQSTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939669_MHBs_P-B Product feature CHAIN EU939669_MHBs_P-B of FT:mat_peptide EU939669_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939670_MHBs_P-B Product feature CHAIN EU939670_MHBs_P-B of FT:mat_peptide EU939670_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYIPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKV
LTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939671_MHBs_P-B Product feature CHAIN EU939671_MHBs_P-B of FT:mat_peptide EU939671_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C201). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFLQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLTPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939672_MHBs_P-B Product feature CHAIN EU939672_MHBs_P-B of FT:mat_peptide EU939672_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939673_MHBs_P-B Product feature CHAIN EU939673_MHBs_P-B of FT:mat_peptide EU939673_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939674_MHBs_P-B Product feature CHAIN EU939674_MHBs_P-B of FT:mat_peptide EU939674_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|EU939675_MHBs_P-B Product feature CHAIN EU939675_MHBs_P-B of FT:mat_peptide EU939675_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939676_MHBs_P-B Product feature CHAIN EU939676_MHBs_P-B of FT:mat_peptide EU939676_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939677_MHBs_P-B Product feature CHAIN EU939677_MHBs_P-B of FT:mat_peptide EU939677_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939678_MHBs_P-B Product feature CHAIN EU939678_MHBs_P-B of FT:mat_peptide EU939678_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSIFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFLCLWAYI
>gnl|hbvpro|FJ023631_MHBs_P-B Product feature CHAIN FJ023631_MHBs_P-B of FT:mat_peptide FJ023631_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHRALQTPKVRALYFPAGGSSSGTVSPAQNTVSPISSNSSTTGVPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPFIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWYWGPSLYNILSPFIPLFPIFLCLWVYI
>gnl|hbvpro|FJ023632_MHBs_P-B Product feature CHAIN FJ023632_MHBs_P-B of FT:mat_peptide FJ023632_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023633_MHBs_P-B Product feature CHAIN FJ023633_MHBs_P-B of FT:mat_peptide FJ023633_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023634_MHBs_P-B Product feature CHAIN FJ023634_MHBs_P-B of FT:mat_peptide FJ023634_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023635_MHBs_P-B Product feature CHAIN FJ023635_MHBs_P-B of FT:mat_peptide FJ023635_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFLKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023636_MHBs_P-B Product feature CHAIN FJ023636_MHBs_P-B of FT:mat_peptide FJ023636_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSPTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023637_MHBs_P-B Product feature CHAIN FJ023637_MHBs_P-B of FT:mat_peptide FJ023637_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTLNPVQNTASSISSILSKTGDPAPNMENIXSXLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023638_MHBs_P-B Product feature CHAIN FJ023638_MHBs_P-B of FT:mat_peptide FJ023638_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ032342_MHBs_P-B Product feature CHAIN FJ032342_MHBs_P-B of FT:mat_peptide FJ032342_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQTLQDPRVRALYFPAGGSSSGTLSPAQNTVSTTSSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSSLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|FJ032344_MHBs_P-B Product feature CHAIN FJ032344_MHBs_P-B of FT:mat_peptide FJ032344_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSSLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|FJ032349_MHBs_P-B Product feature CHAIN FJ032349_MHBs_P-B of FT:mat_peptide FJ032349_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSSTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSRCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032352_MHBs_P-B Product feature CHAIN FJ032352_MHBs_P-B of FT:mat_peptide FJ032352_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032353_MHBs_P-B Product feature CHAIN FJ032353_MHBs_P-B of FT:mat_peptide FJ032353_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSTLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032354_MHBs_P-B Product feature CHAIN FJ032354_MHBs_P-B of FT:mat_peptide FJ032354_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032357_MHBs_P-B Product feature CHAIN FJ032357_MHBs_P-B of FT:mat_peptide FJ032357_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLPGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|FJ032358_MHBs_P-B Product feature CHAIN FJ032358_MHBs_P-B of FT:mat_peptide FJ032358_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLAKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMWP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLNLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|FJ349236_MHBs_P-B Product feature CHAIN FJ349236_MHBs_P-B of FT:mat_peptide FJ349236_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386582_MHBs_P-B Product feature CHAIN FJ386582_MHBs_P-B of FT:mat_peptide FJ386582_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386583_MHBs_P-B Product feature CHAIN FJ386583_MHBs_P-B of FT:mat_peptide FJ386583_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386584_MHBs_P-B Product feature CHAIN FJ386584_MHBs_P-B of FT:mat_peptide FJ386584_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386600_MHBs_P-B Product feature CHAIN FJ386600_MHBs_P-B of FT:mat_peptide FJ386600_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386608_MHBs_P-B Product feature CHAIN FJ386608_MHBs_P-B of FT:mat_peptide FJ386608_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVILMMWFWGPSLYNIVRPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ386610_MHBs_P-B Product feature CHAIN FJ386610_MHBs_P-B of FT:mat_peptide FJ386610_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386615_MHBs_P-B Product feature CHAIN FJ386615_MHBs_P-B of FT:mat_peptide FJ386615_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386634_MHBs_P-B Product feature CHAIN FJ386634_MHBs_P-B of FT:mat_peptide FJ386634_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQNPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386636_MHBs_P-B Product feature CHAIN FJ386636_MHBs_P-B of FT:mat_peptide FJ386636_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSANFHQTLQDPRVRALYFPAGGSSLGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386642_MHBs_P-B Product feature CHAIN FJ386642_MHBs_P-B of FT:mat_peptide FJ386642_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386648_MHBs_P-B Product feature CHAIN FJ386648_MHBs_P-B of FT:mat_peptide FJ386648_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFARYLWEWASIRFSSLNLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386654_MHBs_P-B Product feature CHAIN FJ386654_MHBs_P-B of FT:mat_peptide FJ386654_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386655_MHBs_P-B Product feature CHAIN FJ386655_MHBs_P-B of FT:mat_peptide FJ386655_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386656_MHBs_P-B Product feature CHAIN FJ386656_MHBs_P-B of FT:mat_peptide FJ386656_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|FJ386658_MHBs_P-B Product feature CHAIN FJ386658_MHBs_P-B of FT:mat_peptide FJ386658_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAVFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386660_MHBs_P-B Product feature CHAIN FJ386660_MHBs_P-B of FT:mat_peptide FJ386660_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386666_MHBs_P-B Product feature CHAIN FJ386666_MHBs_P-B of FT:mat_peptide FJ386666_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386668_MHBs_P-B Product feature CHAIN FJ386668_MHBs_P-B of FT:mat_peptide FJ386668_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386669_MHBs_P-B Product feature CHAIN FJ386669_MHBs_P-B of FT:mat_peptide FJ386669_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=281 residues).
MTRNSTTFHQTLQDPRVRALYFPVGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGPLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386675_MHBs_P-B Product feature CHAIN FJ386675_MHBs_P-B of FT:mat_peptide FJ386675_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKIGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386676_MHBs_P-B Product feature CHAIN FJ386676_MHBs_P-B of FT:mat_peptide FJ386676_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMFP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386680_MHBs_P-B Product feature CHAIN FJ386680_MHBs_P-B of FT:mat_peptide FJ386680_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1244). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386681_MHBs_P-B Product feature CHAIN FJ386681_MHBs_P-B of FT:mat_peptide FJ386681_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386682_MHBs_P-B Product feature CHAIN FJ386682_MHBs_P-B of FT:mat_peptide FJ386682_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386683_MHBs_P-B Product feature CHAIN FJ386683_MHBs_P-B of FT:mat_peptide FJ386683_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWTSTTVHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386684_MHBs_P-B Product feature CHAIN FJ386684_MHBs_P-B of FT:mat_peptide FJ386684_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386688_MHBs_P-B Product feature CHAIN FJ386688_MHBs_P-B of FT:mat_peptide FJ386688_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ518812_MHBs_P-B Product feature CHAIN FJ518812_MHBs_P-B of FT:mat_peptide FJ518812_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSCLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562219_MHBs_P-B Product feature CHAIN FJ562219_MHBs_P-B of FT:mat_peptide FJ562219_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSSFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562222_MHBs_P-B Product feature CHAIN FJ562222_MHBs_P-B of FT:mat_peptide FJ562222_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562224_MHBs_P-B Product feature CHAIN FJ562224_MHBs_P-B of FT:mat_peptide FJ562224_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVSQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLISLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562231_MHBs_P-B Product feature CHAIN FJ562231_MHBs_P-B of FT:mat_peptide FJ562231_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDRNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562234_MHBs_P-B Product feature CHAIN FJ562234_MHBs_P-B of FT:mat_peptide FJ562234_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFSSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562236_MHBs_P-B Product feature CHAIN FJ562236_MHBs_P-B of FT:mat_peptide FJ562236_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ562237_MHBs_P-B Product feature CHAIN FJ562237_MHBs_P-B of FT:mat_peptide FJ562237_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562240_MHBs_P-B Product feature CHAIN FJ562240_MHBs_P-B of FT:mat_peptide FJ562240_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562246_MHBs_P-B Product feature CHAIN FJ562246_MHBs_P-B of FT:mat_peptide FJ562246_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562253_MHBs_P-B Product feature CHAIN FJ562253_MHBs_P-B of FT:mat_peptide FJ562253_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFSLLIKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562254_MHBs_P-B Product feature CHAIN FJ562254_MHBs_P-B of FT:mat_peptide FJ562254_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562257_MHBs_P-B Product feature CHAIN FJ562257_MHBs_P-B of FT:mat_peptide FJ562257_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSIGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562259_MHBs_P-B Product feature CHAIN FJ562259_MHBs_P-B of FT:mat_peptide FJ562259_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHLTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562260_MHBs_P-B Product feature CHAIN FJ562260_MHBs_P-B of FT:mat_peptide FJ562260_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSPXSSTLSTTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LXIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562289_MHBs_P-B Product feature CHAIN FJ562289_MHBs_P-B of FT:mat_peptide FJ562289_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562296_MHBs_P-B Product feature CHAIN FJ562296_MHBs_P-B of FT:mat_peptide FJ562296_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPKLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562303_MHBs_P-B Product feature CHAIN FJ562303_MHBs_P-B of FT:mat_peptide FJ562303_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562311_MHBs_P-B Product feature CHAIN FJ562311_MHBs_P-B of FT:mat_peptide FJ562311_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFXQTLQBPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562312_MHBs_P-B Product feature CHAIN FJ562312_MHBs_P-B of FT:mat_peptide FJ562312_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562316_MHBs_P-B Product feature CHAIN FJ562316_MHBs_P-B of FT:mat_peptide FJ562316_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQSLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562321_MHBs_P-B Product feature CHAIN FJ562321_MHBs_P-B of FT:mat_peptide FJ562321_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I214). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562322_MHBs_P-B Product feature CHAIN FJ562322_MHBs_P-B of FT:mat_peptide FJ562322_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787444_MHBs_P-B Product feature CHAIN FJ787444_MHBs_P-B of FT:mat_peptide FJ787444_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787475_MHBs_P-B Product feature CHAIN FJ787475_MHBs_P-B of FT:mat_peptide FJ787475_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWVWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPYMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787477_MHBs_P-B Product feature CHAIN FJ787477_MHBs_P-B of FT:mat_peptide FJ787477_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPQICPGYRLMCLRRFIILLCILLLCLIFLLVLLDYQGMLL
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ899779_MHBs_P-B Product feature CHAIN FJ899779_MHBs_P-B of FT:mat_peptide FJ899779_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRLIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ899784_MHBs_P-B Product feature CHAIN FJ899784_MHBs_P-B of FT:mat_peptide FJ899784_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899785_MHBs_P-B Product feature CHAIN FJ899785_MHBs_P-B of FT:mat_peptide FJ899785_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899786_MHBs_P-B Product feature CHAIN FJ899786_MHBs_P-B of FT:mat_peptide FJ899786_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899787_MHBs_P-B Product feature CHAIN FJ899787_MHBs_P-B of FT:mat_peptide FJ899787_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTTPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899790_MHBs_P-B Product feature CHAIN FJ899790_MHBs_P-B of FT:mat_peptide FJ899790_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ899791_MHBs_P-B Product feature CHAIN FJ899791_MHBs_P-B of FT:mat_peptide FJ899791_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|GQ358136_MHBs_P-B Product feature CHAIN GQ358136_MHBs_P-B of FT:mat_peptide GQ358136_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358137_MHBs_P-B Product feature CHAIN GQ358137_MHBs_P-B of FT:mat_peptide GQ358137_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISTILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358138_MHBs_P-B Product feature CHAIN GQ358138_MHBs_P-B of FT:mat_peptide GQ358138_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358139_MHBs_P-B Product feature CHAIN GQ358139_MHBs_P-B of FT:mat_peptide GQ358139_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT032). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQNLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358140_MHBs_P-B Product feature CHAIN GQ358140_MHBs_P-B of FT:mat_peptide GQ358140_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358141_MHBs_P-B Product feature CHAIN GQ358141_MHBs_P-B of FT:mat_peptide GQ358141_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358142_MHBs_P-B Product feature CHAIN GQ358142_MHBs_P-B of FT:mat_peptide GQ358142_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358143_MHBs_P-B Product feature CHAIN GQ358143_MHBs_P-B of FT:mat_peptide GQ358143_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358144_MHBs_P-B Product feature CHAIN GQ358144_MHBs_P-B of FT:mat_peptide GQ358144_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSRSGTVNPVQNTASSISSTLSKTGDPVPNMENIASRLPRPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLRGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLREWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358145_MHBs_P-B Product feature CHAIN GQ358145_MHBs_P-B of FT:mat_peptide GQ358145_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358146_MHBs_P-B Product feature CHAIN GQ358146_MHBs_P-B of FT:mat_peptide GQ358146_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSGSGTVNPVQNTASSISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358147_MHBs_P-B Product feature CHAIN GQ358147_MHBs_P-B of FT:mat_peptide GQ358147_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNIASSISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358148_MHBs_P-B Product feature CHAIN GQ358148_MHBs_P-B of FT:mat_peptide GQ358148_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358149_MHBs_P-B Product feature CHAIN GQ358149_MHBs_P-B of FT:mat_peptide GQ358149_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358150_MHBs_P-B Product feature CHAIN GQ358150_MHBs_P-B of FT:mat_peptide GQ358150_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ358151_MHBs_P-B Product feature CHAIN GQ358151_MHBs_P-B of FT:mat_peptide GQ358151_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358152_MHBs_P-B Product feature CHAIN GQ358152_MHBs_P-B of FT:mat_peptide GQ358152_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377519_MHBs_P-B Product feature CHAIN GQ377519_MHBs_P-B of FT:mat_peptide GQ377519_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377525_MHBs_P-B Product feature CHAIN GQ377525_MHBs_P-B of FT:mat_peptide GQ377525_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377537_MHBs_P-B Product feature CHAIN GQ377537_MHBs_P-B of FT:mat_peptide GQ377537_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSGLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377542_MHBs_P-B Product feature CHAIN GQ377542_MHBs_P-B of FT:mat_peptide GQ377542_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377547_MHBs_P-B Product feature CHAIN GQ377547_MHBs_P-B of FT:mat_peptide GQ377547_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377558_MHBs_P-B Product feature CHAIN GQ377558_MHBs_P-B of FT:mat_peptide GQ377558_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377561_MHBs_P-B Product feature CHAIN GQ377561_MHBs_P-B of FT:mat_peptide GQ377561_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377566_MHBs_P-B Product feature CHAIN GQ377566_MHBs_P-B of FT:mat_peptide GQ377566_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377567_MHBs_P-B Product feature CHAIN GQ377567_MHBs_P-B of FT:mat_peptide GQ377567_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTTTGPCKTCTVPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377568_MHBs_P-B Product feature CHAIN GQ377568_MHBs_P-B of FT:mat_peptide GQ377568_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377569_MHBs_P-B Product feature CHAIN GQ377569_MHBs_P-B of FT:mat_peptide GQ377569_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377582_MHBs_P-B Product feature CHAIN GQ377582_MHBs_P-B of FT:mat_peptide GQ377582_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377587_MHBs_P-B Product feature CHAIN GQ377587_MHBs_P-B of FT:mat_peptide GQ377587_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377588_MHBs_P-B Product feature CHAIN GQ377588_MHBs_P-B of FT:mat_peptide GQ377588_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377606_MHBs_P-B Product feature CHAIN GQ377606_MHBs_P-B of FT:mat_peptide GQ377606_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=281 residues).
IQRNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLRPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377610_MHBs_P-B Product feature CHAIN GQ377610_MHBs_P-B of FT:mat_peptide GQ377610_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ377612_MHBs_P-B Product feature CHAIN GQ377612_MHBs_P-B of FT:mat_peptide GQ377612_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIVSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377622_MHBs_P-B Product feature CHAIN GQ377622_MHBs_P-B of FT:mat_peptide GQ377622_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377625_MHBs_P-B Product feature CHAIN GQ377625_MHBs_P-B of FT:mat_peptide GQ377625_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377629_MHBs_P-B Product feature CHAIN GQ377629_MHBs_P-B of FT:mat_peptide GQ377629_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377638_MHBs_P-B Product feature CHAIN GQ377638_MHBs_P-B of FT:mat_peptide GQ377638_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377639_MHBs_P-B Product feature CHAIN GQ377639_MHBs_P-B of FT:mat_peptide GQ377639_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377641_MHBs_P-B Product feature CHAIN GQ377641_MHBs_P-B of FT:mat_peptide GQ377641_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377643_MHBs_P-B Product feature CHAIN GQ377643_MHBs_P-B of FT:mat_peptide GQ377643_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377644_MHBs_P-B Product feature CHAIN GQ377644_MHBs_P-B of FT:mat_peptide GQ377644_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLALQAGFFLLTKI
LTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWELASARFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWAYT
>gnl|hbvpro|GQ475340_MHBs_P-B Product feature CHAIN GQ475340_MHBs_P-B of FT:mat_peptide GQ475340_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924603_MHBs_P-B Product feature CHAIN GQ924603_MHBs_P-B of FT:mat_peptide GQ924603_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924605_MHBs_P-B Product feature CHAIN GQ924605_MHBs_P-B of FT:mat_peptide GQ924605_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924606_MHBs_P-B Product feature CHAIN GQ924606_MHBs_P-B of FT:mat_peptide GQ924606_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924607_MHBs_P-B Product feature CHAIN GQ924607_MHBs_P-B of FT:mat_peptide GQ924607_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLIGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924608_MHBs_P-B Product feature CHAIN GQ924608_MHBs_P-B of FT:mat_peptide GQ924608_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924610_MHBs_P-B Product feature CHAIN GQ924610_MHBs_P-B of FT:mat_peptide GQ924610_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ924611_MHBs_P-B Product feature CHAIN GQ924611_MHBs_P-B of FT:mat_peptide GQ924611_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924617_MHBs_P-B Product feature CHAIN GQ924617_MHBs_P-B of FT:mat_peptide GQ924617_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSAKFHQTLQDTRVRALYFPAGGSSSGIVNPVQNTASPISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ924621_MHBs_P-B Product feature CHAIN GQ924621_MHBs_P-B of FT:mat_peptide GQ924621_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGPLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVHWFGG
LSPTVWLSLIWMIWFWGPSLYNILSPFIPLFPIFFCLWVYI
>gnl|hbvpro|GQ924624_MHBs_P-B Product feature CHAIN GQ924624_MHBs_P-B of FT:mat_peptide GQ924624_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924625_MHBs_P-B Product feature CHAIN GQ924625_MHBs_P-B of FT:mat_peptide GQ924625_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924626_MHBs_P-B Product feature CHAIN GQ924626_MHBs_P-B of FT:mat_peptide GQ924626_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETLVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924627_MHBs_P-B Product feature CHAIN GQ924627_MHBs_P-B of FT:mat_peptide GQ924627_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924628_MHBs_P-B Product feature CHAIN GQ924628_MHBs_P-B of FT:mat_peptide GQ924628_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924630_MHBs_P-B Product feature CHAIN GQ924630_MHBs_P-B of FT:mat_peptide GQ924630_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSTTFHQTLQDPRVRHLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLKPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILNPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924631_MHBs_P-B Product feature CHAIN GQ924631_MHBs_P-B of FT:mat_peptide GQ924631_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924632_MHBs_P-B Product feature CHAIN GQ924632_MHBs_P-B of FT:mat_peptide GQ924632_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924634_MHBs_P-B Product feature CHAIN GQ924634_MHBs_P-B of FT:mat_peptide GQ924634_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924635_MHBs_P-B Product feature CHAIN GQ924635_MHBs_P-B of FT:mat_peptide GQ924635_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSILSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924637_MHBs_P-B Product feature CHAIN GQ924637_MHBs_P-B of FT:mat_peptide GQ924637_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTKFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924638_MHBs_P-B Product feature CHAIN GQ924638_MHBs_P-B of FT:mat_peptide GQ924638_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFLLTLQDHRVRDLYFPAGGSSSGTVNPVQNTVSSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFFWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924639_MHBs_P-B Product feature CHAIN GQ924639_MHBs_P-B of FT:mat_peptide GQ924639_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFFWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924640_MHBs_P-B Product feature CHAIN GQ924640_MHBs_P-B of FT:mat_peptide GQ924640_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924641_MHBs_P-B Product feature CHAIN GQ924641_MHBs_P-B of FT:mat_peptide GQ924641_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M76). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSPTFHQTLQDPRVRALYLPAGGSSSGTVIPVQSTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQVGFSLLTKI
LTIPQSLDSWWTSLSFLGGTPACLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924644_MHBs_P-B Product feature CHAIN GQ924644_MHBs_P-B of FT:mat_peptide GQ924644_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M79). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924645_MHBs_P-B Product feature CHAIN GQ924645_MHBs_P-B of FT:mat_peptide GQ924645_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSTSSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFREGTPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924646_MHBs_P-B Product feature CHAIN GQ924646_MHBs_P-B of FT:mat_peptide GQ924646_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSTLSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924647_MHBs_P-B Product feature CHAIN GQ924647_MHBs_P-B of FT:mat_peptide GQ924647_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVVLDCQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924648_MHBs_P-B Product feature CHAIN GQ924648_MHBs_P-B of FT:mat_peptide GQ924648_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924651_MHBs_P-B Product feature CHAIN GQ924651_MHBs_P-B of FT:mat_peptide GQ924651_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924653_MHBs_P-B Product feature CHAIN GQ924653_MHBs_P-B of FT:mat_peptide GQ924653_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924654_MHBs_P-B Product feature CHAIN GQ924654_MHBs_P-B of FT:mat_peptide GQ924654_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924656_MHBs_P-B Product feature CHAIN GQ924656_MHBs_P-B of FT:mat_peptide GQ924656_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTANPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU332695_MHBs_P-B Product feature CHAIN GU332695_MHBs_P-B of FT:mat_peptide GU332695_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMD74). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU357842_MHBs_P-B Product feature CHAIN GU357842_MHBs_P-B of FT:mat_peptide GU357842_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPKSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSTFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYS
>gnl|hbvpro|GU434372_MHBs_P-B Product feature CHAIN GU434372_MHBs_P-B of FT:mat_peptide GU434372_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNIWSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU434373_MHBs_P-B Product feature CHAIN GU434373_MHBs_P-B of FT:mat_peptide GU434373_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU451682_MHBs_P-B Product feature CHAIN GU451682_MHBs_P-B of FT:mat_peptide GU451682_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815548_MHBs_P-B Product feature CHAIN GU815548_MHBs_P-B of FT:mat_peptide GU815548_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815549_MHBs_P-B Product feature CHAIN GU815549_MHBs_P-B of FT:mat_peptide GU815549_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLPVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815550_MHBs_P-B Product feature CHAIN GU815550_MHBs_P-B of FT:mat_peptide GU815550_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815551_MHBs_P-B Product feature CHAIN GU815551_MHBs_P-B of FT:mat_peptide GU815551_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815552_MHBs_P-B Product feature CHAIN GU815552_MHBs_P-B of FT:mat_peptide GU815552_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815553_MHBs_P-B Product feature CHAIN GU815553_MHBs_P-B of FT:mat_peptide GU815553_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815554_MHBs_P-B Product feature CHAIN GU815554_MHBs_P-B of FT:mat_peptide GU815554_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VRPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815555_MHBs_P-B Product feature CHAIN GU815555_MHBs_P-B of FT:mat_peptide GU815555_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815556_MHBs_P-B Product feature CHAIN GU815556_MHBs_P-B of FT:mat_peptide GU815556_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815557_MHBs_P-B Product feature CHAIN GU815557_MHBs_P-B of FT:mat_peptide GU815557_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815558_MHBs_P-B Product feature CHAIN GU815558_MHBs_P-B of FT:mat_peptide GU815558_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815559_MHBs_P-B Product feature CHAIN GU815559_MHBs_P-B of FT:mat_peptide GU815559_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815560_MHBs_P-B Product feature CHAIN GU815560_MHBs_P-B of FT:mat_peptide GU815560_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815561_MHBs_P-B Product feature CHAIN GU815561_MHBs_P-B of FT:mat_peptide GU815561_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815562_MHBs_P-B Product feature CHAIN GU815562_MHBs_P-B of FT:mat_peptide GU815562_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815563_MHBs_P-B Product feature CHAIN GU815563_MHBs_P-B of FT:mat_peptide GU815563_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815564_MHBs_P-B Product feature CHAIN GU815564_MHBs_P-B of FT:mat_peptide GU815564_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815565_MHBs_P-B Product feature CHAIN GU815565_MHBs_P-B of FT:mat_peptide GU815565_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815566_MHBs_P-B Product feature CHAIN GU815566_MHBs_P-B of FT:mat_peptide GU815566_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815567_MHBs_P-B Product feature CHAIN GU815567_MHBs_P-B of FT:mat_peptide GU815567_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815568_MHBs_P-B Product feature CHAIN GU815568_MHBs_P-B of FT:mat_peptide GU815568_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815569_MHBs_P-B Product feature CHAIN GU815569_MHBs_P-B of FT:mat_peptide GU815569_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815570_MHBs_P-B Product feature CHAIN GU815570_MHBs_P-B of FT:mat_peptide GU815570_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815571_MHBs_P-B Product feature CHAIN GU815571_MHBs_P-B of FT:mat_peptide GU815571_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815572_MHBs_P-B Product feature CHAIN GU815572_MHBs_P-B of FT:mat_peptide GU815572_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815574_MHBs_P-B Product feature CHAIN GU815574_MHBs_P-B of FT:mat_peptide GU815574_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815575_MHBs_P-B Product feature CHAIN GU815575_MHBs_P-B of FT:mat_peptide GU815575_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815576_MHBs_P-B Product feature CHAIN GU815576_MHBs_P-B of FT:mat_peptide GU815576_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815577_MHBs_P-B Product feature CHAIN GU815577_MHBs_P-B of FT:mat_peptide GU815577_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815578_MHBs_P-B Product feature CHAIN GU815578_MHBs_P-B of FT:mat_peptide GU815578_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815579_MHBs_P-B Product feature CHAIN GU815579_MHBs_P-B of FT:mat_peptide GU815579_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815581_MHBs_P-B Product feature CHAIN GU815581_MHBs_P-B of FT:mat_peptide GU815581_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDSRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815583_MHBs_P-B Product feature CHAIN GU815583_MHBs_P-B of FT:mat_peptide GU815583_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815584_MHBs_P-B Product feature CHAIN GU815584_MHBs_P-B of FT:mat_peptide GU815584_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|GU815585_MHBs_P-B Product feature CHAIN GU815585_MHBs_P-B of FT:mat_peptide GU815585_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815586_MHBs_P-B Product feature CHAIN GU815586_MHBs_P-B of FT:mat_peptide GU815586_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815587_MHBs_P-B Product feature CHAIN GU815587_MHBs_P-B of FT:mat_peptide GU815587_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWRTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815588_MHBs_P-B Product feature CHAIN GU815588_MHBs_P-B of FT:mat_peptide GU815588_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815589_MHBs_P-B Product feature CHAIN GU815589_MHBs_P-B of FT:mat_peptide GU815589_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815590_MHBs_P-B Product feature CHAIN GU815590_MHBs_P-B of FT:mat_peptide GU815590_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815591_MHBs_P-B Product feature CHAIN GU815591_MHBs_P-B of FT:mat_peptide GU815591_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815593_MHBs_P-B Product feature CHAIN GU815593_MHBs_P-B of FT:mat_peptide GU815593_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815594_MHBs_P-B Product feature CHAIN GU815594_MHBs_P-B of FT:mat_peptide GU815594_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815595_MHBs_P-B Product feature CHAIN GU815595_MHBs_P-B of FT:mat_peptide GU815595_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815596_MHBs_P-B Product feature CHAIN GU815596_MHBs_P-B of FT:mat_peptide GU815596_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815597_MHBs_P-B Product feature CHAIN GU815597_MHBs_P-B of FT:mat_peptide GU815597_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815598_MHBs_P-B Product feature CHAIN GU815598_MHBs_P-B of FT:mat_peptide GU815598_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815599_MHBs_P-B Product feature CHAIN GU815599_MHBs_P-B of FT:mat_peptide GU815599_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815600_MHBs_P-B Product feature CHAIN GU815600_MHBs_P-B of FT:mat_peptide GU815600_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815601_MHBs_P-B Product feature CHAIN GU815601_MHBs_P-B of FT:mat_peptide GU815601_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815602_MHBs_P-B Product feature CHAIN GU815602_MHBs_P-B of FT:mat_peptide GU815602_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815603_MHBs_P-B Product feature CHAIN GU815603_MHBs_P-B of FT:mat_peptide GU815603_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815604_MHBs_P-B Product feature CHAIN GU815604_MHBs_P-B of FT:mat_peptide GU815604_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815605_MHBs_P-B Product feature CHAIN GU815605_MHBs_P-B of FT:mat_peptide GU815605_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815606_MHBs_P-B Product feature CHAIN GU815606_MHBs_P-B of FT:mat_peptide GU815606_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815607_MHBs_P-B Product feature CHAIN GU815607_MHBs_P-B of FT:mat_peptide GU815607_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKHLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815608_MHBs_P-B Product feature CHAIN GU815608_MHBs_P-B of FT:mat_peptide GU815608_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQVGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815609_MHBs_P-B Product feature CHAIN GU815609_MHBs_P-B of FT:mat_peptide GU815609_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815610_MHBs_P-B Product feature CHAIN GU815610_MHBs_P-B of FT:mat_peptide GU815610_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASRLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815612_MHBs_P-B Product feature CHAIN GU815612_MHBs_P-B of FT:mat_peptide GU815612_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815613_MHBs_P-B Product feature CHAIN GU815613_MHBs_P-B of FT:mat_peptide GU815613_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815614_MHBs_P-B Product feature CHAIN GU815614_MHBs_P-B of FT:mat_peptide GU815614_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815617_MHBs_P-B Product feature CHAIN GU815617_MHBs_P-B of FT:mat_peptide GU815617_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSPYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815618_MHBs_P-B Product feature CHAIN GU815618_MHBs_P-B of FT:mat_peptide GU815618_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPMCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815619_MHBs_P-B Product feature CHAIN GU815619_MHBs_P-B of FT:mat_peptide GU815619_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815620_MHBs_P-B Product feature CHAIN GU815620_MHBs_P-B of FT:mat_peptide GU815620_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLPVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815621_MHBs_P-B Product feature CHAIN GU815621_MHBs_P-B of FT:mat_peptide GU815621_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLPVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815622_MHBs_P-B Product feature CHAIN GU815622_MHBs_P-B of FT:mat_peptide GU815622_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSPYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815623_MHBs_P-B Product feature CHAIN GU815623_MHBs_P-B of FT:mat_peptide GU815623_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815624_MHBs_P-B Product feature CHAIN GU815624_MHBs_P-B of FT:mat_peptide GU815624_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815625_MHBs_P-B Product feature CHAIN GU815625_MHBs_P-B of FT:mat_peptide GU815625_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVSFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815626_MHBs_P-B Product feature CHAIN GU815626_MHBs_P-B of FT:mat_peptide GU815626_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVFAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815627_MHBs_P-B Product feature CHAIN GU815627_MHBs_P-B of FT:mat_peptide GU815627_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815628_MHBs_P-B Product feature CHAIN GU815628_MHBs_P-B of FT:mat_peptide GU815628_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815629_MHBs_P-B Product feature CHAIN GU815629_MHBs_P-B of FT:mat_peptide GU815629_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815630_MHBs_P-B Product feature CHAIN GU815630_MHBs_P-B of FT:mat_peptide GU815630_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815631_MHBs_P-B Product feature CHAIN GU815631_MHBs_P-B of FT:mat_peptide GU815631_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815632_MHBs_P-B Product feature CHAIN GU815632_MHBs_P-B of FT:mat_peptide GU815632_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815633_MHBs_P-B Product feature CHAIN GU815633_MHBs_P-B of FT:mat_peptide GU815633_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPCMPLLPIFFCLWVYI
>gnl|hbvpro|GU815635_MHBs_P-B Product feature CHAIN GU815635_MHBs_P-B of FT:mat_peptide GU815635_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLKPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815636_MHBs_P-B Product feature CHAIN GU815636_MHBs_P-B of FT:mat_peptide GU815636_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815637_MHBs_P-B Product feature CHAIN GU815637_MHBs_P-B of FT:mat_peptide GU815637_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815638_MHBs_P-B Product feature CHAIN GU815638_MHBs_P-B of FT:mat_peptide GU815638_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815639_MHBs_P-B Product feature CHAIN GU815639_MHBs_P-B of FT:mat_peptide GU815639_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLEPLLVLQAGLFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815640_MHBs_P-B Product feature CHAIN GU815640_MHBs_P-B of FT:mat_peptide GU815640_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815641_MHBs_P-B Product feature CHAIN GU815641_MHBs_P-B of FT:mat_peptide GU815641_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815642_MHBs_P-B Product feature CHAIN GU815642_MHBs_P-B of FT:mat_peptide GU815642_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815643_MHBs_P-B Product feature CHAIN GU815643_MHBs_P-B of FT:mat_peptide GU815643_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815644_MHBs_P-B Product feature CHAIN GU815644_MHBs_P-B of FT:mat_peptide GU815644_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815645_MHBs_P-B Product feature CHAIN GU815645_MHBs_P-B of FT:mat_peptide GU815645_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815646_MHBs_P-B Product feature CHAIN GU815646_MHBs_P-B of FT:mat_peptide GU815646_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815647_MHBs_P-B Product feature CHAIN GU815647_MHBs_P-B of FT:mat_peptide GU815647_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815648_MHBs_P-B Product feature CHAIN GU815648_MHBs_P-B of FT:mat_peptide GU815648_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815649_MHBs_P-B Product feature CHAIN GU815649_MHBs_P-B of FT:mat_peptide GU815649_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815650_MHBs_P-B Product feature CHAIN GU815650_MHBs_P-B of FT:mat_peptide GU815650_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815651_MHBs_P-B Product feature CHAIN GU815651_MHBs_P-B of FT:mat_peptide GU815651_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGSFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815652_MHBs_P-B Product feature CHAIN GU815652_MHBs_P-B of FT:mat_peptide GU815652_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815653_MHBs_P-B Product feature CHAIN GU815653_MHBs_P-B of FT:mat_peptide GU815653_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815654_MHBs_P-B Product feature CHAIN GU815654_MHBs_P-B of FT:mat_peptide GU815654_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815656_MHBs_P-B Product feature CHAIN GU815656_MHBs_P-B of FT:mat_peptide GU815656_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQRFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815657_MHBs_P-B Product feature CHAIN GU815657_MHBs_P-B of FT:mat_peptide GU815657_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIILLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
PSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815658_MHBs_P-B Product feature CHAIN GU815658_MHBs_P-B of FT:mat_peptide GU815658_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFPWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815659_MHBs_P-B Product feature CHAIN GU815659_MHBs_P-B of FT:mat_peptide GU815659_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815660_MHBs_P-B Product feature CHAIN GU815660_MHBs_P-B of FT:mat_peptide GU815660_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815661_MHBs_P-B Product feature CHAIN GU815661_MHBs_P-B of FT:mat_peptide GU815661_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815662_MHBs_P-B Product feature CHAIN GU815662_MHBs_P-B of FT:mat_peptide GU815662_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815663_MHBs_P-B Product feature CHAIN GU815663_MHBs_P-B of FT:mat_peptide GU815663_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815664_MHBs_P-B Product feature CHAIN GU815664_MHBs_P-B of FT:mat_peptide GU815664_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815665_MHBs_P-B Product feature CHAIN GU815665_MHBs_P-B of FT:mat_peptide GU815665_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815666_MHBs_P-B Product feature CHAIN GU815666_MHBs_P-B of FT:mat_peptide GU815666_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815667_MHBs_P-B Product feature CHAIN GU815667_MHBs_P-B of FT:mat_peptide GU815667_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815668_MHBs_P-B Product feature CHAIN GU815668_MHBs_P-B of FT:mat_peptide GU815668_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815669_MHBs_P-B Product feature CHAIN GU815669_MHBs_P-B of FT:mat_peptide GU815669_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815670_MHBs_P-B Product feature CHAIN GU815670_MHBs_P-B of FT:mat_peptide GU815670_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLILLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815672_MHBs_P-B Product feature CHAIN GU815672_MHBs_P-B of FT:mat_peptide GU815672_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815673_MHBs_P-B Product feature CHAIN GU815673_MHBs_P-B of FT:mat_peptide GU815673_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815674_MHBs_P-B Product feature CHAIN GU815674_MHBs_P-B of FT:mat_peptide GU815674_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815675_MHBs_P-B Product feature CHAIN GU815675_MHBs_P-B of FT:mat_peptide GU815675_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815676_MHBs_P-B Product feature CHAIN GU815676_MHBs_P-B of FT:mat_peptide GU815676_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815677_MHBs_P-B Product feature CHAIN GU815677_MHBs_P-B of FT:mat_peptide GU815677_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815678_MHBs_P-B Product feature CHAIN GU815678_MHBs_P-B of FT:mat_peptide GU815678_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWPSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815679_MHBs_P-B Product feature CHAIN GU815679_MHBs_P-B of FT:mat_peptide GU815679_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815680_MHBs_P-B Product feature CHAIN GU815680_MHBs_P-B of FT:mat_peptide GU815680_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815681_MHBs_P-B Product feature CHAIN GU815681_MHBs_P-B of FT:mat_peptide GU815681_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|GU815683_MHBs_P-B Product feature CHAIN GU815683_MHBs_P-B of FT:mat_peptide GU815683_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815684_MHBs_P-B Product feature CHAIN GU815684_MHBs_P-B of FT:mat_peptide GU815684_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815685_MHBs_P-B Product feature CHAIN GU815685_MHBs_P-B of FT:mat_peptide GU815685_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815686_MHBs_P-B Product feature CHAIN GU815686_MHBs_P-B of FT:mat_peptide GU815686_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815687_MHBs_P-B Product feature CHAIN GU815687_MHBs_P-B of FT:mat_peptide GU815687_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815688_MHBs_P-B Product feature CHAIN GU815688_MHBs_P-B of FT:mat_peptide GU815688_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815689_MHBs_P-B Product feature CHAIN GU815689_MHBs_P-B of FT:mat_peptide GU815689_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815691_MHBs_P-B Product feature CHAIN GU815691_MHBs_P-B of FT:mat_peptide GU815691_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815692_MHBs_P-B Product feature CHAIN GU815692_MHBs_P-B of FT:mat_peptide GU815692_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815693_MHBs_P-B Product feature CHAIN GU815693_MHBs_P-B of FT:mat_peptide GU815693_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815694_MHBs_P-B Product feature CHAIN GU815694_MHBs_P-B of FT:mat_peptide GU815694_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815695_MHBs_P-B Product feature CHAIN GU815695_MHBs_P-B of FT:mat_peptide GU815695_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815696_MHBs_P-B Product feature CHAIN GU815696_MHBs_P-B of FT:mat_peptide GU815696_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815697_MHBs_P-B Product feature CHAIN GU815697_MHBs_P-B of FT:mat_peptide GU815697_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815698_MHBs_P-B Product feature CHAIN GU815698_MHBs_P-B of FT:mat_peptide GU815698_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815699_MHBs_P-B Product feature CHAIN GU815699_MHBs_P-B of FT:mat_peptide GU815699_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815700_MHBs_P-B Product feature CHAIN GU815700_MHBs_P-B of FT:mat_peptide GU815700_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815701_MHBs_P-B Product feature CHAIN GU815701_MHBs_P-B of FT:mat_peptide GU815701_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815702_MHBs_P-B Product feature CHAIN GU815702_MHBs_P-B of FT:mat_peptide GU815702_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815703_MHBs_P-B Product feature CHAIN GU815703_MHBs_P-B of FT:mat_peptide GU815703_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815704_MHBs_P-B Product feature CHAIN GU815704_MHBs_P-B of FT:mat_peptide GU815704_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815705_MHBs_P-B Product feature CHAIN GU815705_MHBs_P-B of FT:mat_peptide GU815705_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815706_MHBs_P-B Product feature CHAIN GU815706_MHBs_P-B of FT:mat_peptide GU815706_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815707_MHBs_P-B Product feature CHAIN GU815707_MHBs_P-B of FT:mat_peptide GU815707_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815708_MHBs_P-B Product feature CHAIN GU815708_MHBs_P-B of FT:mat_peptide GU815708_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815709_MHBs_P-B Product feature CHAIN GU815709_MHBs_P-B of FT:mat_peptide GU815709_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815710_MHBs_P-B Product feature CHAIN GU815710_MHBs_P-B of FT:mat_peptide GU815710_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815711_MHBs_P-B Product feature CHAIN GU815711_MHBs_P-B of FT:mat_peptide GU815711_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMSLLPIFFCLWVYI
>gnl|hbvpro|GU815712_MHBs_P-B Product feature CHAIN GU815712_MHBs_P-B of FT:mat_peptide GU815712_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815713_MHBs_P-B Product feature CHAIN GU815713_MHBs_P-B of FT:mat_peptide GU815713_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVLFVQWFVG
LSPTVRLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815715_MHBs_P-B Product feature CHAIN GU815715_MHBs_P-B of FT:mat_peptide GU815715_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815716_MHBs_P-B Product feature CHAIN GU815716_MHBs_P-B of FT:mat_peptide GU815716_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815717_MHBs_P-B Product feature CHAIN GU815717_MHBs_P-B of FT:mat_peptide GU815717_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815718_MHBs_P-B Product feature CHAIN GU815718_MHBs_P-B of FT:mat_peptide GU815718_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGPSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815719_MHBs_P-B Product feature CHAIN GU815719_MHBs_P-B of FT:mat_peptide GU815719_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815720_MHBs_P-B Product feature CHAIN GU815720_MHBs_P-B of FT:mat_peptide GU815720_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815721_MHBs_P-B Product feature CHAIN GU815721_MHBs_P-B of FT:mat_peptide GU815721_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815722_MHBs_P-B Product feature CHAIN GU815722_MHBs_P-B of FT:mat_peptide GU815722_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWLVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815723_MHBs_P-B Product feature CHAIN GU815723_MHBs_P-B of FT:mat_peptide GU815723_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPESSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815724_MHBs_P-B Product feature CHAIN GU815724_MHBs_P-B of FT:mat_peptide GU815724_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815725_MHBs_P-B Product feature CHAIN GU815725_MHBs_P-B of FT:mat_peptide GU815725_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815726_MHBs_P-B Product feature CHAIN GU815726_MHBs_P-B of FT:mat_peptide GU815726_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815727_MHBs_P-B Product feature CHAIN GU815727_MHBs_P-B of FT:mat_peptide GU815727_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815728_MHBs_P-B Product feature CHAIN GU815728_MHBs_P-B of FT:mat_peptide GU815728_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815729_MHBs_P-B Product feature CHAIN GU815729_MHBs_P-B of FT:mat_peptide GU815729_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815730_MHBs_P-B Product feature CHAIN GU815730_MHBs_P-B of FT:mat_peptide GU815730_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815731_MHBs_P-B Product feature CHAIN GU815731_MHBs_P-B of FT:mat_peptide GU815731_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815732_MHBs_P-B Product feature CHAIN GU815732_MHBs_P-B of FT:mat_peptide GU815732_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815733_MHBs_P-B Product feature CHAIN GU815733_MHBs_P-B of FT:mat_peptide GU815733_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815734_MHBs_P-B Product feature CHAIN GU815734_MHBs_P-B of FT:mat_peptide GU815734_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815735_MHBs_P-B Product feature CHAIN GU815735_MHBs_P-B of FT:mat_peptide GU815735_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSSFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815736_MHBs_P-B Product feature CHAIN GU815736_MHBs_P-B of FT:mat_peptide GU815736_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815737_MHBs_P-B Product feature CHAIN GU815737_MHBs_P-B of FT:mat_peptide GU815737_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815738_MHBs_P-B Product feature CHAIN GU815738_MHBs_P-B of FT:mat_peptide GU815738_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815739_MHBs_P-B Product feature CHAIN GU815739_MHBs_P-B of FT:mat_peptide GU815739_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815740_MHBs_P-B Product feature CHAIN GU815740_MHBs_P-B of FT:mat_peptide GU815740_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815742_MHBs_P-B Product feature CHAIN GU815742_MHBs_P-B of FT:mat_peptide GU815742_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815743_MHBs_P-B Product feature CHAIN GU815743_MHBs_P-B of FT:mat_peptide GU815743_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWALVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815744_MHBs_P-B Product feature CHAIN GU815744_MHBs_P-B of FT:mat_peptide GU815744_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815745_MHBs_P-B Product feature CHAIN GU815745_MHBs_P-B of FT:mat_peptide GU815745_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815746_MHBs_P-B Product feature CHAIN GU815746_MHBs_P-B of FT:mat_peptide GU815746_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815747_MHBs_P-B Product feature CHAIN GU815747_MHBs_P-B of FT:mat_peptide GU815747_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815748_MHBs_P-B Product feature CHAIN GU815748_MHBs_P-B of FT:mat_peptide GU815748_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815749_MHBs_P-B Product feature CHAIN GU815749_MHBs_P-B of FT:mat_peptide GU815749_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815750_MHBs_P-B Product feature CHAIN GU815750_MHBs_P-B of FT:mat_peptide GU815750_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815751_MHBs_P-B Product feature CHAIN GU815751_MHBs_P-B of FT:mat_peptide GU815751_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815752_MHBs_P-B Product feature CHAIN GU815752_MHBs_P-B of FT:mat_peptide GU815752_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSVFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815753_MHBs_P-B Product feature CHAIN GU815753_MHBs_P-B of FT:mat_peptide GU815753_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815754_MHBs_P-B Product feature CHAIN GU815754_MHBs_P-B of FT:mat_peptide GU815754_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815755_MHBs_P-B Product feature CHAIN GU815755_MHBs_P-B of FT:mat_peptide GU815755_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815756_MHBs_P-B Product feature CHAIN GU815756_MHBs_P-B of FT:mat_peptide GU815756_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815757_MHBs_P-B Product feature CHAIN GU815757_MHBs_P-B of FT:mat_peptide GU815757_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815759_MHBs_P-B Product feature CHAIN GU815759_MHBs_P-B of FT:mat_peptide GU815759_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815760_MHBs_P-B Product feature CHAIN GU815760_MHBs_P-B of FT:mat_peptide GU815760_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815761_MHBs_P-B Product feature CHAIN GU815761_MHBs_P-B of FT:mat_peptide GU815761_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815762_MHBs_P-B Product feature CHAIN GU815762_MHBs_P-B of FT:mat_peptide GU815762_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815764_MHBs_P-B Product feature CHAIN GU815764_MHBs_P-B of FT:mat_peptide GU815764_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815765_MHBs_P-B Product feature CHAIN GU815765_MHBs_P-B of FT:mat_peptide GU815765_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815766_MHBs_P-B Product feature CHAIN GU815766_MHBs_P-B of FT:mat_peptide GU815766_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815767_MHBs_P-B Product feature CHAIN GU815767_MHBs_P-B of FT:mat_peptide GU815767_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815768_MHBs_P-B Product feature CHAIN GU815768_MHBs_P-B of FT:mat_peptide GU815768_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815769_MHBs_P-B Product feature CHAIN GU815769_MHBs_P-B of FT:mat_peptide GU815769_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815770_MHBs_P-B Product feature CHAIN GU815770_MHBs_P-B of FT:mat_peptide GU815770_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRAPYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815771_MHBs_P-B Product feature CHAIN GU815771_MHBs_P-B of FT:mat_peptide GU815771_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815772_MHBs_P-B Product feature CHAIN GU815772_MHBs_P-B of FT:mat_peptide GU815772_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWVSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815773_MHBs_P-B Product feature CHAIN GU815773_MHBs_P-B of FT:mat_peptide GU815773_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|GU815774_MHBs_P-B Product feature CHAIN GU815774_MHBs_P-B of FT:mat_peptide GU815774_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815775_MHBs_P-B Product feature CHAIN GU815775_MHBs_P-B of FT:mat_peptide GU815775_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815776_MHBs_P-B Product feature CHAIN GU815776_MHBs_P-B of FT:mat_peptide GU815776_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|GU815777_MHBs_P-B Product feature CHAIN GU815777_MHBs_P-B of FT:mat_peptide GU815777_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815778_MHBs_P-B Product feature CHAIN GU815778_MHBs_P-B of FT:mat_peptide GU815778_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815779_MHBs_P-B Product feature CHAIN GU815779_MHBs_P-B of FT:mat_peptide GU815779_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFRLWVYI
>gnl|hbvpro|GU815780_MHBs_P-B Product feature CHAIN GU815780_MHBs_P-B of FT:mat_peptide GU815780_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815781_MHBs_P-B Product feature CHAIN GU815781_MHBs_P-B of FT:mat_peptide GU815781_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815782_MHBs_P-B Product feature CHAIN GU815782_MHBs_P-B of FT:mat_peptide GU815782_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815783_MHBs_P-B Product feature CHAIN GU815783_MHBs_P-B of FT:mat_peptide GU815783_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGHLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011466_MHBs_P-B Product feature CHAIN HM011466_MHBs_P-B of FT:mat_peptide HM011466_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSAXSSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGEKLVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWLWGPNLYNXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011467_MHBs_P-B Product feature CHAIN HM011467_MHBs_P-B of FT:mat_peptide HM011467_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWXFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFIPLFPIFFCLWXYI
>gnl|hbvpro|HM011469_MHBs_P-B Product feature CHAIN HM011469_MHBs_P-B of FT:mat_peptide HM011469_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXXPVCXGQNSQSQXSSHSPTCCPPTCPGYRWMXLRXFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLCNIXXPFXPLFPIFXCLWVYI
>gnl|hbvpro|HM011470_MHBs_P-B Product feature CHAIN HM011470_MHBs_P-B of FT:mat_peptide HM011470_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALHVPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011471_MHBs_P-B Product feature CHAIN HM011471_MHBs_P-B of FT:mat_peptide HM011471_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLWTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLCNILSPFMPLLXIFFCLWAYI
>gnl|hbvpro|HM011473_MHBs_P-B Product feature CHAIN HM011473_MHBs_P-B of FT:mat_peptide HM011473_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLXFLGETPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011474_MHBs_P-B Product feature CHAIN HM011474_MHBs_P-B of FT:mat_peptide HM011474_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
IRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPVCRGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011475_MHBs_P-B Product feature CHAIN HM011475_MHBs_P-B of FT:mat_peptide HM011475_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM011476_MHBs_P-B Product feature CHAIN HM011476_MHBs_P-B of FT:mat_peptide HM011476_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTIQDPRVRALYFPAGGSSSGTVSPAQSTVSPTSSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLEGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM011477_MHBs_P-B Product feature CHAIN HM011477_MHBs_P-B of FT:mat_peptide HM011477_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|HM011478_MHBs_P-B Product feature CHAIN HM011478_MHBs_P-B of FT:mat_peptide HM011478_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGXXPXCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011480_MHBs_P-B Product feature CHAIN HM011480_MHBs_P-B of FT:mat_peptide HM011480_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQXLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIXLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011482_MHBs_P-B Product feature CHAIN HM011482_MHBs_P-B of FT:mat_peptide HM011482_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWFWGPXLYXXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011483_MHBs_P-B Product feature CHAIN HM011483_MHBs_P-B of FT:mat_peptide HM011483_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011484_MHBs_P-B Product feature CHAIN HM011484_MHBs_P-B of FT:mat_peptide HM011484_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVLNMENIASGLLGPLLVLQAGFFLLTKX
LTIPQXLDXWWTSLSFLGVPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011487_MHBs_P-B Product feature CHAIN HM011487_MHBs_P-B of FT:mat_peptide HM011487_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSTSSKTGDPVPNMENIASGLLRPLLGLQAGFFLLTKI
LTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAXGNSTFPSCCCTKPTDANCTCIPIPXSWAFAKFLWEWASVRFSWLSLLXPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011490_MHBs_P-B Product feature CHAIN HM011490_MHBs_P-B of FT:mat_peptide HM011490_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011492_MHBs_P-B Product feature CHAIN HM011492_MHBs_P-B of FT:mat_peptide HM011492_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVSNMENITSGLLRPLLGLQAGFFLLTKI
LTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011494_MHBs_P-B Product feature CHAIN HM011494_MHBs_P-B of FT:mat_peptide HM011494_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFXXLXKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011496_MHBs_P-B Product feature CHAIN HM011496_MHBs_P-B of FT:mat_peptide HM011496_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTANPVQNTASSISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM011499_MHBs_P-B Product feature CHAIN HM011499_MHBs_P-B of FT:mat_peptide HM011499_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
XXWNSXTFHHTLQDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKTGDPVLXMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLCSILSPXMXLFPIFFCLWVYI
>gnl|hbvpro|HM011503_MHBs_P-B Product feature CHAIN HM011503_MHBs_P-B of FT:mat_peptide HM011503_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYXILXPFIPLLPIFXCLWVYI
>gnl|hbvpro|HM011504_MHBs_P-B Product feature CHAIN HM011504_MHBs_P-B of FT:mat_peptide HM011504_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|HM153811_MHBs_P-B Product feature CHAIN HM153811_MHBs_P-B of FT:mat_peptide HM153811_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 712005001256). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HQ700546_MHBs_P-B Product feature CHAIN HQ700546_MHBs_P-B of FT:mat_peptide HQ700546_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HQ700548_MHBs_P-B Product feature CHAIN HQ700548_MHBs_P-B of FT:mat_peptide HQ700548_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTXFHQTLQDSRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HQ700549_MHBs_P-B Product feature CHAIN HQ700549_MHBs_P-B of FT:mat_peptide HQ700549_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JF412801_MHBs_P-B Product feature CHAIN JF412801_MHBs_P-B of FT:mat_peptide JF412801_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JF436921_MHBs_P-B Product feature CHAIN JF436921_MHBs_P-B of FT:mat_peptide JF436921_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNYTTFHQTLQDPKVRALYFPAGGSSSGTVSPAPNTVSAISSILSTTGDPVPNMATNLSELLKLLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILPLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMQLLLIFFCLWVSI
>gnl|hbvpro|JF899335_MHBs_P-B Product feature CHAIN JF899335_MHBs_P-B of FT:mat_peptide JF899335_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN406371_MHBs_P-B Product feature CHAIN JN406371_MHBs_P-B of FT:mat_peptide JN406371_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604119_MHBs_P-B Product feature CHAIN JN604119_MHBs_P-B of FT:mat_peptide JN604119_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-6420-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604122_MHBs_P-B Product feature CHAIN JN604122_MHBs_P-B of FT:mat_peptide JN604122_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-8130-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604123_MHBs_P-B Product feature CHAIN JN604123_MHBs_P-B of FT:mat_peptide JN604123_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-8616-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNTVHNTASSISSILSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMLPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604124_MHBs_P-B Product feature CHAIN JN604124_MHBs_P-B of FT:mat_peptide JN604124_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-8619-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604125_MHBs_P-B Product feature CHAIN JN604125_MHBs_P-B of FT:mat_peptide JN604125_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-1766-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604127_MHBs_P-B Product feature CHAIN JN604127_MHBs_P-B of FT:mat_peptide JN604127_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-2999-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604130_MHBs_P-B Product feature CHAIN JN604130_MHBs_P-B of FT:mat_peptide JN604130_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-7793-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMADITSGLLXPLLALQAGFFSLTKI
LTIPQSLDSGWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLP
VCPLIPGSSTTSTGPCKTCTTPARSTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMTWYWGPSLYNTLSPLMPLLLLFFCLWVYT
>gnl|hbvpro|JN604132_MHBs_P-B Product feature CHAIN JN604132_MHBs_P-B of FT:mat_peptide JN604132_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-9698-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604134_MHBs_P-B Product feature CHAIN JN604134_MHBs_P-B of FT:mat_peptide JN604134_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-1993-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604138_MHBs_P-B Product feature CHAIN JN604138_MHBs_P-B of FT:mat_peptide JN604138_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-6805-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
PTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPDLHNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|JN604141_MHBs_P-B Product feature CHAIN JN604141_MHBs_P-B of FT:mat_peptide JN604141_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-9028-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPSVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604143_MHBs_P-B Product feature CHAIN JN604143_MHBs_P-B of FT:mat_peptide JN604143_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-0606-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604146_MHBs_P-B Product feature CHAIN JN604146_MHBs_P-B of FT:mat_peptide JN604146_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-2316-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHHTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604149_MHBs_P-B Product feature CHAIN JN604149_MHBs_P-B of FT:mat_peptide JN604149_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-5331-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMDNITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604154_MHBs_P-B Product feature CHAIN JN604154_MHBs_P-B of FT:mat_peptide JN604154_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 480-0167-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604187_MHBs_P-B Product feature CHAIN JN604187_MHBs_P-B of FT:mat_peptide JN604187_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-1713-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|JN604212_MHBs_P-B Product feature CHAIN JN604212_MHBs_P-B of FT:mat_peptide JN604212_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-7995-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQNTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604213_MHBs_P-B Product feature CHAIN JN604213_MHBs_P-B of FT:mat_peptide JN604213_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 476-9306-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLXFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604219_MHBs_P-B Product feature CHAIN JN604219_MHBs_P-B of FT:mat_peptide JN604219_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-2927-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQTTAFAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGNSSFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLXLLXPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|JN604221_MHBs_P-B Product feature CHAIN JN604221_MHBs_P-B of FT:mat_peptide JN604221_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-4136-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTXHQTLQDPXVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LXIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604223_MHBs_P-B Product feature CHAIN JN604223_MHBs_P-B of FT:mat_peptide JN604223_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-4979-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604224_MHBs_P-B Product feature CHAIN JN604224_MHBs_P-B of FT:mat_peptide JN604224_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-5048-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LXIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604234_MHBs_P-B Product feature CHAIN JN604234_MHBs_P-B of FT:mat_peptide JN604234_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 478-0688-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNSASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFXGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFXLWVYX
>gnl|hbvpro|JN604244_MHBs_P-B Product feature CHAIN JN604244_MHBs_P-B of FT:mat_peptide JN604244_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-0396-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTASAISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604253_MHBs_P-B Product feature CHAIN JN604253_MHBs_P-B of FT:mat_peptide JN604253_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-5640-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604284_MHBs_P-B Product feature CHAIN JN604284_MHBs_P-B of FT:mat_peptide JN604284_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 477-8831-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN604311_MHBs_P-B Product feature CHAIN JN604311_MHBs_P-B of FT:mat_peptide JN604311_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 479-5511-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792893_MHBs_P-B Product feature CHAIN JN792893_MHBs_P-B of FT:mat_peptide JN792893_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2004). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASPISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792894_MHBs_P-B Product feature CHAIN JN792894_MHBs_P-B of FT:mat_peptide JN792894_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYPWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792895_MHBs_P-B Product feature CHAIN JN792895_MHBs_P-B of FT:mat_peptide JN792895_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLYLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLRNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792896_MHBs_P-B Product feature CHAIN JN792896_MHBs_P-B of FT:mat_peptide JN792896_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNILSPFMPLLSIFLCLWVYI
>gnl|hbvpro|JN792897_MHBs_P-B Product feature CHAIN JN792897_MHBs_P-B of FT:mat_peptide JN792897_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792898_MHBs_P-B Product feature CHAIN JN792898_MHBs_P-B of FT:mat_peptide JN792898_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792899_MHBs_P-B Product feature CHAIN JN792899_MHBs_P-B of FT:mat_peptide JN792899_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792900_MHBs_P-B Product feature CHAIN JN792900_MHBs_P-B of FT:mat_peptide JN792900_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQITASSISSILPKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792901_MHBs_P-B Product feature CHAIN JN792901_MHBs_P-B of FT:mat_peptide JN792901_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQNSSTFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN792902_MHBs_P-B Product feature CHAIN JN792902_MHBs_P-B of FT:mat_peptide JN792902_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTXPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JN827419_MHBs_P-B Product feature CHAIN JN827419_MHBs_P-B of FT:mat_peptide JN827419_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENTASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ027311_MHBs_P-B Product feature CHAIN JQ027311_MHBs_P-B of FT:mat_peptide JQ027311_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDXWWTSLXFLGGTXXCLGQNSQSQISSHXPTCCPPICPGYRWMCLRRXIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILXPFMPLFPIFFCLWVYI
>gnl|hbvpro|JQ027312_MHBs_P-B Product feature CHAIN JQ027312_MHBs_P-B of FT:mat_peptide JQ027312_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYLPAGGSSSXTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWFWGPSLYXTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027315_MHBs_P-B Product feature CHAIN JQ027315_MHBs_P-B of FT:mat_peptide JQ027315_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSPISRHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027316_MHBs_P-B Product feature CHAIN JQ027316_MHBs_P-B of FT:mat_peptide JQ027316_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDRNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPKLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027325_MHBs_P-B Product feature CHAIN JQ027325_MHBs_P-B of FT:mat_peptide JQ027325_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHXTLQDPRVRALYLPAGGSSSGTVSPAQXTVSATSSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027330_MHBs_P-B Product feature CHAIN JQ027330_MHBs_P-B of FT:mat_peptide JQ027330_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTXHQTLQDPRVRAXNFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027331_MHBs_P-B Product feature CHAIN JQ027331_MHBs_P-B of FT:mat_peptide JQ027331_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTXHQTLQDPRVRAXNFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ027334_MHBs_P-B Product feature CHAIN JQ027334_MHBs_P-B of FT:mat_peptide JQ027334_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
VXWNSTXFHQTLQDPRVRALYLPAGGSSSGTVNPVPNTASSISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQCQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040125_MHBs_P-B Product feature CHAIN JQ040125_MHBs_P-B of FT:mat_peptide JQ040125_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040128_MHBs_P-B Product feature CHAIN JQ040128_MHBs_P-B of FT:mat_peptide JQ040128_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ040138_MHBs_P-B Product feature CHAIN JQ040138_MHBs_P-B of FT:mat_peptide JQ040138_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVLNMENIASGLLRPLLVLQAGFFLLTKI
LTXPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040147_MHBs_P-B Product feature CHAIN JQ040147_MHBs_P-B of FT:mat_peptide JQ040147_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ040157_MHBs_P-B Product feature CHAIN JQ040157_MHBs_P-B of FT:mat_peptide JQ040157_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTRI
LTIPXSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGXSTTSTGPCKTCTIPAQGTSMFXSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSXIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040170_MHBs_P-B Product feature CHAIN JQ040170_MHBs_P-B of FT:mat_peptide JQ040170_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAXYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040171_MHBs_P-B Product feature CHAIN JQ040171_MHBs_P-B of FT:mat_peptide JQ040171_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ040173_MHBs_P-B Product feature CHAIN JQ040173_MHBs_P-B of FT:mat_peptide JQ040173_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281129_MHBs_P-B Product feature CHAIN JQ281129_MHBs_P-B of FT:mat_peptide JQ281129_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4321). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSXTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTHVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGXSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281131_MHBs_P-B Product feature CHAIN JQ281131_MHBs_P-B of FT:mat_peptide JQ281131_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0277). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSKTFHQTLQDPRVRALYSPAGGSSLGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281132_MHBs_P-B Product feature CHAIN JQ281132_MHBs_P-B of FT:mat_peptide JQ281132_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0330). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWHTPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWAYI
>gnl|hbvpro|JQ281133_MHBs_P-B Product feature CHAIN JQ281133_MHBs_P-B of FT:mat_peptide JQ281133_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0348). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFXQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSXTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPXSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGXSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ281134_MHBs_P-B Product feature CHAIN JQ281134_MHBs_P-B of FT:mat_peptide JQ281134_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0809). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWYWGXSLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281137_MHBs_P-B Product feature CHAIN JQ281137_MHBs_P-B of FT:mat_peptide JQ281137_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0872). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSKTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281138_MHBs_P-B Product feature CHAIN JQ281138_MHBs_P-B of FT:mat_peptide JQ281138_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0904). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281139_MHBs_P-B Product feature CHAIN JQ281139_MHBs_P-B of FT:mat_peptide JQ281139_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0923). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ281140_MHBs_P-B Product feature CHAIN JQ281140_MHBs_P-B of FT:mat_peptide JQ281140_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/0988). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281141_MHBs_P-B Product feature CHAIN JQ281141_MHBs_P-B of FT:mat_peptide JQ281141_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1031). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKIGDPVPNMENIASGLLGPLLALQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTXCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281143_MHBs_P-B Product feature CHAIN JQ281143_MHBs_P-B of FT:mat_peptide JQ281143_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281144_MHBs_P-B Product feature CHAIN JQ281144_MHBs_P-B of FT:mat_peptide JQ281144_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1207). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSNTSTGPCRTCTTTAQGTSXXPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPXLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281147_MHBs_P-B Product feature CHAIN JQ281147_MHBs_P-B of FT:mat_peptide JQ281147_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1359). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSGSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281148_MHBs_P-B Product feature CHAIN JQ281148_MHBs_P-B of FT:mat_peptide JQ281148_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1406). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAXSSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281149_MHBs_P-B Product feature CHAIN JQ281149_MHBs_P-B of FT:mat_peptide JQ281149_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1485). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281150_MHBs_P-B Product feature CHAIN JQ281150_MHBs_P-B of FT:mat_peptide JQ281150_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1604). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ281151_MHBs_P-B Product feature CHAIN JQ281151_MHBs_P-B of FT:mat_peptide JQ281151_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1708). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVXQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281152_MHBs_P-B Product feature CHAIN JQ281152_MHBs_P-B of FT:mat_peptide JQ281152_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1753). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTXHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDLVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGXCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLXLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVXI
>gnl|hbvpro|JQ281153_MHBs_P-B Product feature CHAIN JQ281153_MHBs_P-B of FT:mat_peptide JQ281153_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1843). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQILQEPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNXQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWXWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281154_MHBs_P-B Product feature CHAIN JQ281154_MHBs_P-B of FT:mat_peptide JQ281154_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1845). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGXSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281156_MHBs_P-B Product feature CHAIN JQ281156_MHBs_P-B of FT:mat_peptide JQ281156_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1949). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWAWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281157_MHBs_P-B Product feature CHAIN JQ281157_MHBs_P-B of FT:mat_peptide JQ281157_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/1980). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVTPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEPPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ281158_MHBs_P-B Product feature CHAIN JQ281158_MHBs_P-B of FT:mat_peptide JQ281158_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2012). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281159_MHBs_P-B Product feature CHAIN JQ281159_MHBs_P-B of FT:mat_peptide JQ281159_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2021). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281160_MHBs_P-B Product feature CHAIN JQ281160_MHBs_P-B of FT:mat_peptide JQ281160_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2042). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGRNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ281161_MHBs_P-B Product feature CHAIN JQ281161_MHBs_P-B of FT:mat_peptide JQ281161_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2050). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLXFLGGTPVCXGQNSQSXISSHXPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDXQGMLP
VCPLIPGSSTTSTGPCRTCTTXAXGNSTIPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|JQ281163_MHBs_P-B Product feature CHAIN JQ281163_MHBs_P-B of FT:mat_peptide JQ281163_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2140). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQXGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281164_MHBs_P-B Product feature CHAIN JQ281164_MHBs_P-B of FT:mat_peptide JQ281164_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2184). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGXVSPAQNTASAISSTFSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGXSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPKLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281165_MHBs_P-B Product feature CHAIN JQ281165_MHBs_P-B of FT:mat_peptide JQ281165_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2203). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDANCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281166_MHBs_P-B Product feature CHAIN JQ281166_MHBs_P-B of FT:mat_peptide JQ281166_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2286). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281167_MHBs_P-B Product feature CHAIN JQ281167_MHBs_P-B of FT:mat_peptide JQ281167_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2553). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSXWTSLNFLGGTPVCLGQNSQSQISSHXPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDXNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281168_MHBs_P-B Product feature CHAIN JQ281168_MHBs_P-B of FT:mat_peptide JQ281168_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2556). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281170_MHBs_P-B Product feature CHAIN JQ281170_MHBs_P-B of FT:mat_peptide JQ281170_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2608). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQXTASAISSTFLKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEXPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|JQ281171_MHBs_P-B Product feature CHAIN JQ281171_MHBs_P-B of FT:mat_peptide JQ281171_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2647). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHXTLQDPRVRALYXPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ281172_MHBs_P-B Product feature CHAIN JQ281172_MHBs_P-B of FT:mat_peptide JQ281172_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2656). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281176_MHBs_P-B Product feature CHAIN JQ281176_MHBs_P-B of FT:mat_peptide JQ281176_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2728). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281177_MHBs_P-B Product feature CHAIN JQ281177_MHBs_P-B of FT:mat_peptide JQ281177_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2777). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281178_MHBs_P-B Product feature CHAIN JQ281178_MHBs_P-B of FT:mat_peptide JQ281178_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2869). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281179_MHBs_P-B Product feature CHAIN JQ281179_MHBs_P-B of FT:mat_peptide JQ281179_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2883). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281180_MHBs_P-B Product feature CHAIN JQ281180_MHBs_P-B of FT:mat_peptide JQ281180_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2906). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281181_MHBs_P-B Product feature CHAIN JQ281181_MHBs_P-B of FT:mat_peptide JQ281181_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/2930). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281184_MHBs_P-B Product feature CHAIN JQ281184_MHBs_P-B of FT:mat_peptide JQ281184_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3117). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281185_MHBs_P-B Product feature CHAIN JQ281185_MHBs_P-B of FT:mat_peptide JQ281185_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3124). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTASVISSTFSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281186_MHBs_P-B Product feature CHAIN JQ281186_MHBs_P-B of FT:mat_peptide JQ281186_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQXLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281187_MHBs_P-B Product feature CHAIN JQ281187_MHBs_P-B of FT:mat_peptide JQ281187_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3190). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281188_MHBs_P-B Product feature CHAIN JQ281188_MHBs_P-B of FT:mat_peptide JQ281188_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3508). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAIXSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281189_MHBs_P-B Product feature CHAIN JQ281189_MHBs_P-B of FT:mat_peptide JQ281189_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3570). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281190_MHBs_P-B Product feature CHAIN JQ281190_MHBs_P-B of FT:mat_peptide JQ281190_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3581). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKTGGPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|JQ281192_MHBs_P-B Product feature CHAIN JQ281192_MHBs_P-B of FT:mat_peptide JQ281192_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3612). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281193_MHBs_P-B Product feature CHAIN JQ281193_MHBs_P-B of FT:mat_peptide JQ281193_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3630). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCXTCTTXAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|JQ281194_MHBs_P-B Product feature CHAIN JQ281194_MHBs_P-B of FT:mat_peptide JQ281194_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3649). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281195_MHBs_P-B Product feature CHAIN JQ281195_MHBs_P-B of FT:mat_peptide JQ281195_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3702). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFXGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|JQ281196_MHBs_P-B Product feature CHAIN JQ281196_MHBs_P-B of FT:mat_peptide JQ281196_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3707). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRXLYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWXWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281197_MHBs_P-B Product feature CHAIN JQ281197_MHBs_P-B of FT:mat_peptide JQ281197_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3708). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281199_MHBs_P-B Product feature CHAIN JQ281199_MHBs_P-B of FT:mat_peptide JQ281199_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3731). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281200_MHBs_P-B Product feature CHAIN JQ281200_MHBs_P-B of FT:mat_peptide JQ281200_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/3805). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281202_MHBs_P-B Product feature CHAIN JQ281202_MHBs_P-B of FT:mat_peptide JQ281202_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4358). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281203_MHBs_P-B Product feature CHAIN JQ281203_MHBs_P-B of FT:mat_peptide JQ281203_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4367). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281204_MHBs_P-B Product feature CHAIN JQ281204_MHBs_P-B of FT:mat_peptide JQ281204_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4375). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQHTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281205_MHBs_P-B Product feature CHAIN JQ281205_MHBs_P-B of FT:mat_peptide JQ281205_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4376). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCRTCTTPAQGTSMFXSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281206_MHBs_P-B Product feature CHAIN JQ281206_MHBs_P-B of FT:mat_peptide JQ281206_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4411). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGXSXFPSCCCXKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ281207_MHBs_P-B Product feature CHAIN JQ281207_MHBs_P-B of FT:mat_peptide JQ281207_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4414). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYXWMCLRRFIIFLCILLLCLIFLXVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281208_MHBs_P-B Product feature CHAIN JQ281208_MHBs_P-B of FT:mat_peptide JQ281208_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4528). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281209_MHBs_P-B Product feature CHAIN JQ281209_MHBs_P-B of FT:mat_peptide JQ281209_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4531). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281210_MHBs_P-B Product feature CHAIN JQ281210_MHBs_P-B of FT:mat_peptide JQ281210_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4550). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281211_MHBs_P-B Product feature CHAIN JQ281211_MHBs_P-B of FT:mat_peptide JQ281211_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4751). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281212_MHBs_P-B Product feature CHAIN JQ281212_MHBs_P-B of FT:mat_peptide JQ281212_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4775). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281213_MHBs_P-B Product feature CHAIN JQ281213_MHBs_P-B of FT:mat_peptide JQ281213_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4783). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281214_MHBs_P-B Product feature CHAIN JQ281214_MHBs_P-B of FT:mat_peptide JQ281214_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4795). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNXXTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281215_MHBs_P-B Product feature CHAIN JQ281215_MHBs_P-B of FT:mat_peptide JQ281215_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4856). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281216_MHBs_P-B Product feature CHAIN JQ281216_MHBs_P-B of FT:mat_peptide JQ281216_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4864). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281217_MHBs_P-B Product feature CHAIN JQ281217_MHBs_P-B of FT:mat_peptide JQ281217_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4879). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281218_MHBs_P-B Product feature CHAIN JQ281218_MHBs_P-B of FT:mat_peptide JQ281218_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08/IVVI/4904). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASXISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
XTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGXCRXCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281220_MHBs_P-B Product feature CHAIN JQ281220_MHBs_P-B of FT:mat_peptide JQ281220_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5279). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281221_MHBs_P-B Product feature CHAIN JQ281221_MHBs_P-B of FT:mat_peptide JQ281221_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5304). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSPTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLXLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLICLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWYWGPSLYNILSPFMPLLXIFFCLWVYI
>gnl|hbvpro|JQ281222_MHBs_P-B Product feature CHAIN JQ281222_MHBs_P-B of FT:mat_peptide JQ281222_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5358). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNIASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281223_MHBs_P-B Product feature CHAIN JQ281223_MHBs_P-B of FT:mat_peptide JQ281223_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5365). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281224_MHBs_P-B Product feature CHAIN JQ281224_MHBs_P-B of FT:mat_peptide JQ281224_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5371). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTEGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ281225_MHBs_P-B Product feature CHAIN JQ281225_MHBs_P-B of FT:mat_peptide JQ281225_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5388). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281226_MHBs_P-B Product feature CHAIN JQ281226_MHBs_P-B of FT:mat_peptide JQ281226_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5444). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281227_MHBs_P-B Product feature CHAIN JQ281227_MHBs_P-B of FT:mat_peptide JQ281227_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5454). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281228_MHBs_P-B Product feature CHAIN JQ281228_MHBs_P-B of FT:mat_peptide JQ281228_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5457). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281229_MHBs_P-B Product feature CHAIN JQ281229_MHBs_P-B of FT:mat_peptide JQ281229_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5476). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ281230_MHBs_P-B Product feature CHAIN JQ281230_MHBs_P-B of FT:mat_peptide JQ281230_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5497). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ281231_MHBs_P-B Product feature CHAIN JQ281231_MHBs_P-B of FT:mat_peptide JQ281231_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/5522). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281234_MHBs_P-B Product feature CHAIN JQ281234_MHBs_P-B of FT:mat_peptide JQ281234_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/6467). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQNLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281235_MHBs_P-B Product feature CHAIN JQ281235_MHBs_P-B of FT:mat_peptide JQ281235_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/6515). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281236_MHBs_P-B Product feature CHAIN JQ281236_MHBs_P-B of FT:mat_peptide JQ281236_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/6527). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|JQ281237_MHBs_P-B Product feature CHAIN JQ281237_MHBs_P-B of FT:mat_peptide JQ281237_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/6610). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281238_MHBs_P-B Product feature CHAIN JQ281238_MHBs_P-B of FT:mat_peptide JQ281238_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/6649). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281239_MHBs_P-B Product feature CHAIN JQ281239_MHBs_P-B of FT:mat_peptide JQ281239_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7051). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTXSXIGDPVPNMENIASGLLGPLLXLQAGFFXLTKI
LTIPQSLDSWWTSLXFLGXKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFXLWVYX
>gnl|hbvpro|JQ281240_MHBs_P-B Product feature CHAIN JQ281240_MHBs_P-B of FT:mat_peptide JQ281240_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVXQAGXFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281241_MHBs_P-B Product feature CHAIN JQ281241_MHBs_P-B of FT:mat_peptide JQ281241_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7209). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLNFXGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281242_MHBs_P-B Product feature CHAIN JQ281242_MHBs_P-B of FT:mat_peptide JQ281242_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7215). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281243_MHBs_P-B Product feature CHAIN JQ281243_MHBs_P-B of FT:mat_peptide JQ281243_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7218). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFSLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281244_MHBs_P-B Product feature CHAIN JQ281244_MHBs_P-B of FT:mat_peptide JQ281244_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7283). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAXNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTXPQSLDSWWTSLNFLGXXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDXQGMLP
VCPLIPGSSTTSTGPCRTCTTXAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281245_MHBs_P-B Product feature CHAIN JQ281245_MHBs_P-B of FT:mat_peptide JQ281245_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7302). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281246_MHBs_P-B Product feature CHAIN JQ281246_MHBs_P-B of FT:mat_peptide JQ281246_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7316). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281247_MHBs_P-B Product feature CHAIN JQ281247_MHBs_P-B of FT:mat_peptide JQ281247_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7369). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281248_MHBs_P-B Product feature CHAIN JQ281248_MHBs_P-B of FT:mat_peptide JQ281248_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/7392). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTXPQSLDSWWTSLNFLGXKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDXQGMLP
VCPLIPGSSTTSTGPCRTCTTXAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281249_MHBs_P-B Product feature CHAIN JQ281249_MHBs_P-B of FT:mat_peptide JQ281249_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8208). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281252_MHBs_P-B Product feature CHAIN JQ281252_MHBs_P-B of FT:mat_peptide JQ281252_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8234). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHLPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLHNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281253_MHBs_P-B Product feature CHAIN JQ281253_MHBs_P-B of FT:mat_peptide JQ281253_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8248). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQXLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWTMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ281254_MHBs_P-B Product feature CHAIN JQ281254_MHBs_P-B of FT:mat_peptide JQ281254_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8259). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281255_MHBs_P-B Product feature CHAIN JQ281255_MHBs_P-B of FT:mat_peptide JQ281255_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8274). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFXGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCQGMLP
VCPLIPGSSTTSTGXCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281256_MHBs_P-B Product feature CHAIN JQ281256_MHBs_P-B of FT:mat_peptide JQ281256_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8310). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLFPIFFCLWVYS
>gnl|hbvpro|JQ281257_MHBs_P-B Product feature CHAIN JQ281257_MHBs_P-B of FT:mat_peptide JQ281257_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8353). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ281258_MHBs_P-B Product feature CHAIN JQ281258_MHBs_P-B of FT:mat_peptide JQ281258_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09/IVVI/8424). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQTTASAISSTFSXTGDPVPNMENITSGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCHIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ341549_MHBs_P-B Product feature CHAIN JQ341549_MHBs_P-B of FT:mat_peptide JQ341549_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341550_MHBs_P-B Product feature CHAIN JQ341550_MHBs_P-B of FT:mat_peptide JQ341550_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341551_MHBs_P-B Product feature CHAIN JQ341551_MHBs_P-B of FT:mat_peptide JQ341551_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGXLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGXSXXPSCCCTKPTDGNCTCIPIPSSWAFAKXLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341552_MHBs_P-B Product feature CHAIN JQ341552_MHBs_P-B of FT:mat_peptide JQ341552_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPALNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLXPIFFCLWVYI
>gnl|hbvpro|JQ341553_MHBs_P-B Product feature CHAIN JQ341553_MHBs_P-B of FT:mat_peptide JQ341553_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSSTFHQTLQBPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPXCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWXYX
>gnl|hbvpro|JQ341554_MHBs_P-B Product feature CHAIN JQ341554_MHBs_P-B of FT:mat_peptide JQ341554_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLFPIFFCLWVYI
>gnl|hbvpro|JQ341555_MHBs_P-B Product feature CHAIN JQ341555_MHBs_P-B of FT:mat_peptide JQ341555_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341556_MHBs_P-B Product feature CHAIN JQ341556_MHBs_P-B of FT:mat_peptide JQ341556_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341557_MHBs_P-B Product feature CHAIN JQ341557_MHBs_P-B of FT:mat_peptide JQ341557_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno09). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCTKPTDXNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341558_MHBs_P-B Product feature CHAIN JQ341558_MHBs_P-B of FT:mat_peptide JQ341558_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341559_MHBs_P-B Product feature CHAIN JQ341559_MHBs_P-B of FT:mat_peptide JQ341559_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341560_MHBs_P-B Product feature CHAIN JQ341560_MHBs_P-B of FT:mat_peptide JQ341560_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341561_MHBs_P-B Product feature CHAIN JQ341561_MHBs_P-B of FT:mat_peptide JQ341561_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno13). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGXLXPLLVLQAGFFXXTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAXXTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMXWFWGPSLYNXLRPLIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341562_MHBs_P-B Product feature CHAIN JQ341562_MHBs_P-B of FT:mat_peptide JQ341562_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWFWGXSLYXILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ341563_MHBs_P-B Product feature CHAIN JQ341563_MHBs_P-B of FT:mat_peptide JQ341563_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKXCTTPAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341564_MHBs_P-B Product feature CHAIN JQ341564_MHBs_P-B of FT:mat_peptide JQ341564_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLXPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341565_MHBs_P-B Product feature CHAIN JQ341565_MHBs_P-B of FT:mat_peptide JQ341565_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341566_MHBs_P-B Product feature CHAIN JQ341566_MHBs_P-B of FT:mat_peptide JQ341566_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSXWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341567_MHBs_P-B Product feature CHAIN JQ341567_MHBs_P-B of FT:mat_peptide JQ341567_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXXNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|JQ341568_MHBs_P-B Product feature CHAIN JQ341568_MHBs_P-B of FT:mat_peptide JQ341568_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341569_MHBs_P-B Product feature CHAIN JQ341569_MHBs_P-B of FT:mat_peptide JQ341569_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341570_MHBs_P-B Product feature CHAIN JQ341570_MHBs_P-B of FT:mat_peptide JQ341570_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSNSGTVSPAQTTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341571_MHBs_P-B Product feature CHAIN JQ341571_MHBs_P-B of FT:mat_peptide JQ341571_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341572_MHBs_P-B Product feature CHAIN JQ341572_MHBs_P-B of FT:mat_peptide JQ341572_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341573_MHBs_P-B Product feature CHAIN JQ341573_MHBs_P-B of FT:mat_peptide JQ341573_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341574_MHBs_P-B Product feature CHAIN JQ341574_MHBs_P-B of FT:mat_peptide JQ341574_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341575_MHBs_P-B Product feature CHAIN JQ341575_MHBs_P-B of FT:mat_peptide JQ341575_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341576_MHBs_P-B Product feature CHAIN JQ341576_MHBs_P-B of FT:mat_peptide JQ341576_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPACLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLNNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341577_MHBs_P-B Product feature CHAIN JQ341577_MHBs_P-B of FT:mat_peptide JQ341577_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGXLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDXNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFXCLWVYX
>gnl|hbvpro|JQ341578_MHBs_P-B Product feature CHAIN JQ341578_MHBs_P-B of FT:mat_peptide JQ341578_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341579_MHBs_P-B Product feature CHAIN JQ341579_MHBs_P-B of FT:mat_peptide JQ341579_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341580_MHBs_P-B Product feature CHAIN JQ341580_MHBs_P-B of FT:mat_peptide JQ341580_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRXCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFXCLWVYX
>gnl|hbvpro|JQ341581_MHBs_P-B Product feature CHAIN JQ341581_MHBs_P-B of FT:mat_peptide JQ341581_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFXGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341582_MHBs_P-B Product feature CHAIN JQ341582_MHBs_P-B of FT:mat_peptide JQ341582_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAPNTVSAISSIXSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|JQ341583_MHBs_P-B Product feature CHAIN JQ341583_MHBs_P-B of FT:mat_peptide JQ341583_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341584_MHBs_P-B Product feature CHAIN JQ341584_MHBs_P-B of FT:mat_peptide JQ341584_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341585_MHBs_P-B Product feature CHAIN JQ341585_MHBs_P-B of FT:mat_peptide JQ341585_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno37). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341586_MHBs_P-B Product feature CHAIN JQ341586_MHBs_P-B of FT:mat_peptide JQ341586_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLXPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFXLWVYI
>gnl|hbvpro|JQ341587_MHBs_P-B Product feature CHAIN JQ341587_MHBs_P-B of FT:mat_peptide JQ341587_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQBPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKIGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEPPVCPGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341588_MHBs_P-B Product feature CHAIN JQ341588_MHBs_P-B of FT:mat_peptide JQ341588_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341589_MHBs_P-B Product feature CHAIN JQ341589_MHBs_P-B of FT:mat_peptide JQ341589_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341590_MHBs_P-B Product feature CHAIN JQ341590_MHBs_P-B of FT:mat_peptide JQ341590_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVPTTASSISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341591_MHBs_P-B Product feature CHAIN JQ341591_MHBs_P-B of FT:mat_peptide JQ341591_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
XTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341592_MHBs_P-B Product feature CHAIN JQ341592_MHBs_P-B of FT:mat_peptide JQ341592_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno44). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=282 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|JQ341593_MHBs_P-B Product feature CHAIN JQ341593_MHBs_P-B of FT:mat_peptide JQ341593_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341594_MHBs_P-B Product feature CHAIN JQ341594_MHBs_P-B of FT:mat_peptide JQ341594_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341595_MHBs_P-B Product feature CHAIN JQ341595_MHBs_P-B of FT:mat_peptide JQ341595_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPXXNMENIASGLLGPLLVLQAGFFLLTKI
LTXPQSLDSWWTSLSFLGGTXVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFXLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCXWVYI
>gnl|hbvpro|JQ341596_MHBs_P-B Product feature CHAIN JQ341596_MHBs_P-B of FT:mat_peptide JQ341596_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXKFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ341597_MHBs_P-B Product feature CHAIN JQ341597_MHBs_P-B of FT:mat_peptide JQ341597_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTXFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341598_MHBs_P-B Product feature CHAIN JQ341598_MHBs_P-B of FT:mat_peptide JQ341598_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ341599_MHBs_P-B Product feature CHAIN JQ341599_MHBs_P-B of FT:mat_peptide JQ341599_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTXFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341600_MHBs_P-B Product feature CHAIN JQ341600_MHBs_P-B of FT:mat_peptide JQ341600_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGPSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341601_MHBs_P-B Product feature CHAIN JQ341601_MHBs_P-B of FT:mat_peptide JQ341601_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341603_MHBs_P-B Product feature CHAIN JQ341603_MHBs_P-B of FT:mat_peptide JQ341603_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341604_MHBs_P-B Product feature CHAIN JQ341604_MHBs_P-B of FT:mat_peptide JQ341604_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNXXTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGXSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341605_MHBs_P-B Product feature CHAIN JQ341605_MHBs_P-B of FT:mat_peptide JQ341605_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno57). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSXTFLQTLQDPRVRALYFPAGGSSSGTVSPAQITASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341606_MHBs_P-B Product feature CHAIN JQ341606_MHBs_P-B of FT:mat_peptide JQ341606_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno58). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTXVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341607_MHBs_P-B Product feature CHAIN JQ341607_MHBs_P-B of FT:mat_peptide JQ341607_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno59). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
XTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGPSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341608_MHBs_P-B Product feature CHAIN JQ341608_MHBs_P-B of FT:mat_peptide JQ341608_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDXNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ341609_MHBs_P-B Product feature CHAIN JQ341609_MHBs_P-B of FT:mat_peptide JQ341609_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ412090_MHBs_P-B Product feature CHAIN JQ412090_MHBs_P-B of FT:mat_peptide JQ412090_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ412092_MHBs_P-B Product feature CHAIN JQ412092_MHBs_P-B of FT:mat_peptide JQ412092_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRVLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ429081_MHBs_P-B Product feature CHAIN JQ429081_MHBs_P-B of FT:mat_peptide JQ429081_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=282 residues).
VQWNSTTFHQTLQIDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTK
ILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGML
PVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFV
GLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFWVWAYI
>gnl|hbvpro|JQ429082_MHBs_P-B Product feature CHAIN JQ429082_MHBs_P-B of FT:mat_peptide JQ429082_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.41.591). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTVSSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JQ688405_MHBs_P-B Product feature CHAIN JQ688405_MHBs_P-B of FT:mat_peptide JQ688405_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ707734_MHBs_P-B Product feature CHAIN JQ707734_MHBs_P-B of FT:mat_peptide JQ707734_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707735_MHBs_P-B Product feature CHAIN JQ707735_MHBs_P-B of FT:mat_peptide JQ707735_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPNLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707737_MHBs_P-B Product feature CHAIN JQ707737_MHBs_P-B of FT:mat_peptide JQ707737_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707738_MHBs_P-B Product feature CHAIN JQ707738_MHBs_P-B of FT:mat_peptide JQ707738_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707739_MHBs_P-B Product feature CHAIN JQ707739_MHBs_P-B of FT:mat_peptide JQ707739_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMISYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707740_MHBs_P-B Product feature CHAIN JQ707740_MHBs_P-B of FT:mat_peptide JQ707740_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPESSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707742_MHBs_P-B Product feature CHAIN JQ707742_MHBs_P-B of FT:mat_peptide JQ707742_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707743_MHBs_P-B Product feature CHAIN JQ707743_MHBs_P-B of FT:mat_peptide JQ707743_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707744_MHBs_P-B Product feature CHAIN JQ707744_MHBs_P-B of FT:mat_peptide JQ707744_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707745_MHBs_P-B Product feature CHAIN JQ707745_MHBs_P-B of FT:mat_peptide JQ707745_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707746_MHBs_P-B Product feature CHAIN JQ707746_MHBs_P-B of FT:mat_peptide JQ707746_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_24-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707747_MHBs_P-B Product feature CHAIN JQ707747_MHBs_P-B of FT:mat_peptide JQ707747_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTNTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
PSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707749_MHBs_P-B Product feature CHAIN JQ707749_MHBs_P-B of FT:mat_peptide JQ707749_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707750_MHBs_P-B Product feature CHAIN JQ707750_MHBs_P-B of FT:mat_peptide JQ707750_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707753_MHBs_P-B Product feature CHAIN JQ707753_MHBs_P-B of FT:mat_peptide JQ707753_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707755_MHBs_P-B Product feature CHAIN JQ707755_MHBs_P-B of FT:mat_peptide JQ707755_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707758_MHBs_P-B Product feature CHAIN JQ707758_MHBs_P-B of FT:mat_peptide JQ707758_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707759_MHBs_P-B Product feature CHAIN JQ707759_MHBs_P-B of FT:mat_peptide JQ707759_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707762_MHBs_P-B Product feature CHAIN JQ707762_MHBs_P-B of FT:mat_peptide JQ707762_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707763_MHBs_P-B Product feature CHAIN JQ707763_MHBs_P-B of FT:mat_peptide JQ707763_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707764_MHBs_P-B Product feature CHAIN JQ707764_MHBs_P-B of FT:mat_peptide JQ707764_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707765_MHBs_P-B Product feature CHAIN JQ707765_MHBs_P-B of FT:mat_peptide JQ707765_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707766_MHBs_P-B Product feature CHAIN JQ707766_MHBs_P-B of FT:mat_peptide JQ707766_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707767_MHBs_P-B Product feature CHAIN JQ707767_MHBs_P-B of FT:mat_peptide JQ707767_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKTGDPVPNMENISSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ801471_MHBs_P-B Product feature CHAIN JQ801471_MHBs_P-B of FT:mat_peptide JQ801471_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801474_MHBs_P-B Product feature CHAIN JQ801474_MHBs_P-B of FT:mat_peptide JQ801474_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS16). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSATSSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801479_MHBs_P-B Product feature CHAIN JQ801479_MHBs_P-B of FT:mat_peptide JQ801479_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801485_MHBs_P-B Product feature CHAIN JQ801485_MHBs_P-B of FT:mat_peptide JQ801485_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ801494_MHBs_P-B Product feature CHAIN JQ801494_MHBs_P-B of FT:mat_peptide JQ801494_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSRTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEKTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801506_MHBs_P-B Product feature CHAIN JQ801506_MHBs_P-B of FT:mat_peptide JQ801506_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAPNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801507_MHBs_P-B Product feature CHAIN JQ801507_MHBs_P-B of FT:mat_peptide JQ801507_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801512_MHBs_P-B Product feature CHAIN JQ801512_MHBs_P-B of FT:mat_peptide JQ801512_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801514_MHBs_P-B Product feature CHAIN JQ801514_MHBs_P-B of FT:mat_peptide JQ801514_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JQ801516_MHBs_P-B Product feature CHAIN JQ801516_MHBs_P-B of FT:mat_peptide JQ801516_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ801524_MHBs_P-B Product feature CHAIN JQ801524_MHBs_P-B of FT:mat_peptide JQ801524_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX026879_MHBs_P-B Product feature CHAIN JX026879_MHBs_P-B of FT:mat_peptide JX026879_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVSNMENISSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGHCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX026881_MHBs_P-B Product feature CHAIN JX026881_MHBs_P-B of FT:mat_peptide JX026881_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLPAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTQPTDRNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX026883_MHBs_P-B Product feature CHAIN JX026883_MHBs_P-B of FT:mat_peptide JX026883_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-50). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFLCLWVYM
>gnl|hbvpro|JX026886_MHBs_P-B Product feature CHAIN JX026886_MHBs_P-B of FT:mat_peptide JX026886_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-73). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JX429897_MHBs_P-B Product feature CHAIN JX429897_MHBs_P-B of FT:mat_peptide JX429897_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQEGFFLLTKI
LTIPQSLDSWWTSLNFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTRTTPAQRTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429899_MHBs_P-B Product feature CHAIN JX429899_MHBs_P-B of FT:mat_peptide JX429899_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429900_MHBs_P-B Product feature CHAIN JX429900_MHBs_P-B of FT:mat_peptide JX429900_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429901_MHBs_P-B Product feature CHAIN JX429901_MHBs_P-B of FT:mat_peptide JX429901_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFMPLLPIFFGLWVYI
>gnl|hbvpro|JX429902_MHBs_P-B Product feature CHAIN JX429902_MHBs_P-B of FT:mat_peptide JX429902_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429908_MHBs_P-B Product feature CHAIN JX429908_MHBs_P-B of FT:mat_peptide JX429908_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|JX429910_MHBs_P-B Product feature CHAIN JX429910_MHBs_P-B of FT:mat_peptide JX429910_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-67). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWTCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX429911_MHBs_P-B Product feature CHAIN JX429911_MHBs_P-B of FT:mat_peptide JX429911_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-45). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX504531_MHBs_P-B Product feature CHAIN JX504531_MHBs_P-B of FT:mat_peptide JX504531_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VKWNPTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX504532_MHBs_P-B Product feature CHAIN JX504532_MHBs_P-B of FT:mat_peptide JX504532_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPALNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPKLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX504533_MHBs_P-B Product feature CHAIN JX504533_MHBs_P-B of FT:mat_peptide JX504533_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-16). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYIPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAVFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYS
>gnl|hbvpro|JX504538_MHBs_P-B Product feature CHAIN JX504538_MHBs_P-B of FT:mat_peptide JX504538_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-65). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|JX504543_MHBs_P-B Product feature CHAIN JX504543_MHBs_P-B of FT:mat_peptide JX504543_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NNJ-19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQGISITFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTRCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX507210_MHBs_P-B Product feature CHAIN JX507210_MHBs_P-B of FT:mat_peptide JX507210_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX507213_MHBs_P-B Product feature CHAIN JX507213_MHBs_P-B of FT:mat_peptide JX507213_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 82). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX507215_MHBs_P-B Product feature CHAIN JX507215_MHBs_P-B of FT:mat_peptide JX507215_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 310). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661470_MHBs_P-B Product feature CHAIN JX661470_MHBs_P-B of FT:mat_peptide JX661470_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1221-B12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661471_MHBs_P-B Product feature CHAIN JX661471_MHBs_P-B of FT:mat_peptide JX661471_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1202-B1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661472_MHBs_P-B Product feature CHAIN JX661472_MHBs_P-B of FT:mat_peptide JX661472_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1224-B13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661473_MHBs_P-B Product feature CHAIN JX661473_MHBs_P-B of FT:mat_peptide JX661473_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1220-B11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661474_MHBs_P-B Product feature CHAIN JX661474_MHBs_P-B of FT:mat_peptide JX661474_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1229-B15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661475_MHBs_P-B Product feature CHAIN JX661475_MHBs_P-B of FT:mat_peptide JX661475_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1216-B9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661476_MHBs_P-B Product feature CHAIN JX661476_MHBs_P-B of FT:mat_peptide JX661476_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1227-B14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661477_MHBs_P-B Product feature CHAIN JX661477_MHBs_P-B of FT:mat_peptide JX661477_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1209-B5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661478_MHBs_P-B Product feature CHAIN JX661478_MHBs_P-B of FT:mat_peptide JX661478_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1211-B7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX661479_MHBs_P-B Product feature CHAIN JX661479_MHBs_P-B of FT:mat_peptide JX661479_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1219-B10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661480_MHBs_P-B Product feature CHAIN JX661480_MHBs_P-B of FT:mat_peptide JX661480_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1210-B6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661481_MHBs_P-B Product feature CHAIN JX661481_MHBs_P-B of FT:mat_peptide JX661481_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1214-B8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661482_MHBs_P-B Product feature CHAIN JX661482_MHBs_P-B of FT:mat_peptide JX661482_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1204-B2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX661483_MHBs_P-B Product feature CHAIN JX661483_MHBs_P-B of FT:mat_peptide JX661483_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1205-B3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX661484_MHBs_P-B Product feature CHAIN JX661484_MHBs_P-B of FT:mat_peptide JX661484_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1206-B4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX869998_MHBs_P-B Product feature CHAIN JX869998_MHBs_P-B of FT:mat_peptide JX869998_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 317). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKIGDPVPNMENTASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX869999_MHBs_P-B Product feature CHAIN JX869999_MHBs_P-B of FT:mat_peptide JX869999_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|JX870001_MHBs_P-B Product feature CHAIN JX870001_MHBs_P-B of FT:mat_peptide JX870001_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 90). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPVQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX978431_MHBs_P-B Product feature CHAIN JX978431_MHBs_P-B of FT:mat_peptide JX978431_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate X02). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC492739_MHBs_P-B Product feature CHAIN KC492739_MHBs_P-B of FT:mat_peptide KC492739_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MT). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510641_MHBs_P-B Product feature CHAIN KC510641_MHBs_P-B of FT:mat_peptide KC510641_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510642_MHBs_P-B Product feature CHAIN KC510642_MHBs_P-B of FT:mat_peptide KC510642_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510643_MHBs_P-B Product feature CHAIN KC510643_MHBs_P-B of FT:mat_peptide KC510643_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510644_MHBs_P-B Product feature CHAIN KC510644_MHBs_P-B of FT:mat_peptide KC510644_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510646_MHBs_P-B Product feature CHAIN KC510646_MHBs_P-B of FT:mat_peptide KC510646_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDANCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510647_MHBs_P-B Product feature CHAIN KC510647_MHBs_P-B of FT:mat_peptide KC510647_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510648_MHBs_P-B Product feature CHAIN KC510648_MHBs_P-B of FT:mat_peptide KC510648_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510649_MHBs_P-B Product feature CHAIN KC510649_MHBs_P-B of FT:mat_peptide KC510649_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510650_MHBs_P-B Product feature CHAIN KC510650_MHBs_P-B of FT:mat_peptide KC510650_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510651_MHBs_P-B Product feature CHAIN KC510651_MHBs_P-B of FT:mat_peptide KC510651_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510652_MHBs_P-B Product feature CHAIN KC510652_MHBs_P-B of FT:mat_peptide KC510652_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510653_MHBs_P-B Product feature CHAIN KC510653_MHBs_P-B of FT:mat_peptide KC510653_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510654_MHBs_P-B Product feature CHAIN KC510654_MHBs_P-B of FT:mat_peptide KC510654_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510655_MHBs_P-B Product feature CHAIN KC510655_MHBs_P-B of FT:mat_peptide KC510655_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510656_MHBs_P-B Product feature CHAIN KC510656_MHBs_P-B of FT:mat_peptide KC510656_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510657_MHBs_P-B Product feature CHAIN KC510657_MHBs_P-B of FT:mat_peptide KC510657_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510658_MHBs_P-B Product feature CHAIN KC510658_MHBs_P-B of FT:mat_peptide KC510658_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510659_MHBs_P-B Product feature CHAIN KC510659_MHBs_P-B of FT:mat_peptide KC510659_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC510660_MHBs_P-B Product feature CHAIN KC510660_MHBs_P-B of FT:mat_peptide KC510660_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPLMPLLPIFFCLWVYI
>gnl|hbvpro|KC774362_MHBs_P-B Product feature CHAIN KC774362_MHBs_P-B of FT:mat_peptide KC774362_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz1107). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|KC774363_MHBs_P-B Product feature CHAIN KC774363_MHBs_P-B of FT:mat_peptide KC774363_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2022). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774365_MHBs_P-B Product feature CHAIN KC774365_MHBs_P-B of FT:mat_peptide KC774365_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2113). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774366_MHBs_P-B Product feature CHAIN KC774366_MHBs_P-B of FT:mat_peptide KC774366_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774367_MHBs_P-B Product feature CHAIN KC774367_MHBs_P-B of FT:mat_peptide KC774367_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2147). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774368_MHBs_P-B Product feature CHAIN KC774368_MHBs_P-B of FT:mat_peptide KC774368_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1012). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774369_MHBs_P-B Product feature CHAIN KC774369_MHBs_P-B of FT:mat_peptide KC774369_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1013). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774370_MHBs_P-B Product feature CHAIN KC774370_MHBs_P-B of FT:mat_peptide KC774370_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1014). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774371_MHBs_P-B Product feature CHAIN KC774371_MHBs_P-B of FT:mat_peptide KC774371_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1036). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774372_MHBs_P-B Product feature CHAIN KC774372_MHBs_P-B of FT:mat_peptide KC774372_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1040). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774373_MHBs_P-B Product feature CHAIN KC774373_MHBs_P-B of FT:mat_peptide KC774373_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1044). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774374_MHBs_P-B Product feature CHAIN KC774374_MHBs_P-B of FT:mat_peptide KC774374_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1053). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774375_MHBs_P-B Product feature CHAIN KC774375_MHBs_P-B of FT:mat_peptide KC774375_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1055). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSVISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774376_MHBs_P-B Product feature CHAIN KC774376_MHBs_P-B of FT:mat_peptide KC774376_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1056). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774377_MHBs_P-B Product feature CHAIN KC774377_MHBs_P-B of FT:mat_peptide KC774377_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1064). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774378_MHBs_P-B Product feature CHAIN KC774378_MHBs_P-B of FT:mat_peptide KC774378_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1015). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774379_MHBs_P-B Product feature CHAIN KC774379_MHBs_P-B of FT:mat_peptide KC774379_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1023). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774380_MHBs_P-B Product feature CHAIN KC774380_MHBs_P-B of FT:mat_peptide KC774380_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1033). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDANCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774381_MHBs_P-B Product feature CHAIN KC774381_MHBs_P-B of FT:mat_peptide KC774381_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1062). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774382_MHBs_P-B Product feature CHAIN KC774382_MHBs_P-B of FT:mat_peptide KC774382_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1063). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774383_MHBs_P-B Product feature CHAIN KC774383_MHBs_P-B of FT:mat_peptide KC774383_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1081). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774384_MHBs_P-B Product feature CHAIN KC774384_MHBs_P-B of FT:mat_peptide KC774384_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1091). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774385_MHBs_P-B Product feature CHAIN KC774385_MHBs_P-B of FT:mat_peptide KC774385_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1099). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774386_MHBs_P-B Product feature CHAIN KC774386_MHBs_P-B of FT:mat_peptide KC774386_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1101). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774387_MHBs_P-B Product feature CHAIN KC774387_MHBs_P-B of FT:mat_peptide KC774387_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1104). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774388_MHBs_P-B Product feature CHAIN KC774388_MHBs_P-B of FT:mat_peptide KC774388_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774389_MHBs_P-B Product feature CHAIN KC774389_MHBs_P-B of FT:mat_peptide KC774389_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1121). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774390_MHBs_P-B Product feature CHAIN KC774390_MHBs_P-B of FT:mat_peptide KC774390_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2158). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774391_MHBs_P-B Product feature CHAIN KC774391_MHBs_P-B of FT:mat_peptide KC774391_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2163). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774392_MHBs_P-B Product feature CHAIN KC774392_MHBs_P-B of FT:mat_peptide KC774392_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2169). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774393_MHBs_P-B Product feature CHAIN KC774393_MHBs_P-B of FT:mat_peptide KC774393_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1068). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774394_MHBs_P-B Product feature CHAIN KC774394_MHBs_P-B of FT:mat_peptide KC774394_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1070). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774395_MHBs_P-B Product feature CHAIN KC774395_MHBs_P-B of FT:mat_peptide KC774395_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1073). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774396_MHBs_P-B Product feature CHAIN KC774396_MHBs_P-B of FT:mat_peptide KC774396_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1182). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774397_MHBs_P-B Product feature CHAIN KC774397_MHBs_P-B of FT:mat_peptide KC774397_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1185). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPRVRALYHPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLVNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774398_MHBs_P-B Product feature CHAIN KC774398_MHBs_P-B of FT:mat_peptide KC774398_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1202). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774399_MHBs_P-B Product feature CHAIN KC774399_MHBs_P-B of FT:mat_peptide KC774399_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1556). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774400_MHBs_P-B Product feature CHAIN KC774400_MHBs_P-B of FT:mat_peptide KC774400_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1585). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774401_MHBs_P-B Product feature CHAIN KC774401_MHBs_P-B of FT:mat_peptide KC774401_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1663). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774402_MHBs_P-B Product feature CHAIN KC774402_MHBs_P-B of FT:mat_peptide KC774402_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1670). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774403_MHBs_P-B Product feature CHAIN KC774403_MHBs_P-B of FT:mat_peptide KC774403_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774404_MHBs_P-B Product feature CHAIN KC774404_MHBs_P-B of FT:mat_peptide KC774404_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774405_MHBs_P-B Product feature CHAIN KC774405_MHBs_P-B of FT:mat_peptide KC774405_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2005). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPARNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774406_MHBs_P-B Product feature CHAIN KC774406_MHBs_P-B of FT:mat_peptide KC774406_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774407_MHBs_P-B Product feature CHAIN KC774407_MHBs_P-B of FT:mat_peptide KC774407_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2011). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774408_MHBs_P-B Product feature CHAIN KC774408_MHBs_P-B of FT:mat_peptide KC774408_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2012). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774409_MHBs_P-B Product feature CHAIN KC774409_MHBs_P-B of FT:mat_peptide KC774409_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2013). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774410_MHBs_P-B Product feature CHAIN KC774410_MHBs_P-B of FT:mat_peptide KC774410_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2018). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774411_MHBs_P-B Product feature CHAIN KC774411_MHBs_P-B of FT:mat_peptide KC774411_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2025). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774412_MHBs_P-B Product feature CHAIN KC774412_MHBs_P-B of FT:mat_peptide KC774412_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2034). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWVWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774413_MHBs_P-B Product feature CHAIN KC774413_MHBs_P-B of FT:mat_peptide KC774413_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2037). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774415_MHBs_P-B Product feature CHAIN KC774415_MHBs_P-B of FT:mat_peptide KC774415_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2064). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774416_MHBs_P-B Product feature CHAIN KC774416_MHBs_P-B of FT:mat_peptide KC774416_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1016). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774417_MHBs_P-B Product feature CHAIN KC774417_MHBs_P-B of FT:mat_peptide KC774417_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1028). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC774418_MHBs_P-B Product feature CHAIN KC774418_MHBs_P-B of FT:mat_peptide KC774418_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1055). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQSTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC774419_MHBs_P-B Product feature CHAIN KC774419_MHBs_P-B of FT:mat_peptide KC774419_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1083). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792648_MHBs_P-B Product feature CHAIN KC792648_MHBs_P-B of FT:mat_peptide KC792648_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0001). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQSSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVFI
>gnl|hbvpro|KC792649_MHBs_P-B Product feature CHAIN KC792649_MHBs_P-B of FT:mat_peptide KC792649_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0002). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSXLGXTXVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792650_MHBs_P-B Product feature CHAIN KC792650_MHBs_P-B of FT:mat_peptide KC792650_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0003). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQBPXVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIXSGLLGPLLVLQAGFFSLIKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792651_MHBs_P-B Product feature CHAIN KC792651_MHBs_P-B of FT:mat_peptide KC792651_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0004). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGPVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCXGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792652_MHBs_P-B Product feature CHAIN KC792652_MHBs_P-B of FT:mat_peptide KC792652_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDXXGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSXLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|KC792654_MHBs_P-B Product feature CHAIN KC792654_MHBs_P-B of FT:mat_peptide KC792654_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0007). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTXHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVXQAGFFLLTKI
LTIPQSLDSWWTSLNXLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792657_MHBs_P-B Product feature CHAIN KC792657_MHBs_P-B of FT:mat_peptide KC792657_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0010). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFLCLWVYM
>gnl|hbvpro|KC792659_MHBs_P-B Product feature CHAIN KC792659_MHBs_P-B of FT:mat_peptide KC792659_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0012). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENITSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLXLLDYQGMLX
VCPLIPGSSTTSTGPCKTCTTPAQGTSMXPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLYXILSPFXPLXPIFFCLWVYI
>gnl|hbvpro|KC792660_MHBs_P-B Product feature CHAIN KC792660_MHBs_P-B of FT:mat_peptide KC792660_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0013). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNIWSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792661_MHBs_P-B Product feature CHAIN KC792661_MHBs_P-B of FT:mat_peptide KC792661_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0014). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPGCLGQNSQSQIXSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792662_MHBs_P-B Product feature CHAIN KC792662_MHBs_P-B of FT:mat_peptide KC792662_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0015). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IKWNSXTFHQTLQDPKVRXLYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGXLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSXIWMMWYWGQSLXXILSPFIPLLXIFFCLWVYI
>gnl|hbvpro|KC792663_MHBs_P-B Product feature CHAIN KC792663_MHBs_P-B of FT:mat_peptide KC792663_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0016). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MXWNXTTXHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLFPIFFCLWVYI
>gnl|hbvpro|KC792664_MHBs_P-B Product feature CHAIN KC792664_MHBs_P-B of FT:mat_peptide KC792664_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IKWNSPTFHKTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792665_MHBs_P-B Product feature CHAIN KC792665_MHBs_P-B of FT:mat_peptide KC792665_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0018). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXTXXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792666_MHBs_P-B Product feature CHAIN KC792666_MHBs_P-B of FT:mat_peptide KC792666_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0019). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMETIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792667_MHBs_P-B Product feature CHAIN KC792667_MHBs_P-B of FT:mat_peptide KC792667_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0020). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYHGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792668_MHBs_P-B Product feature CHAIN KC792668_MHBs_P-B of FT:mat_peptide KC792668_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0021). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792671_MHBs_P-B Product feature CHAIN KC792671_MHBs_P-B of FT:mat_peptide KC792671_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0024). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAVSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGEPPGCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFYWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792674_MHBs_P-B Product feature CHAIN KC792674_MHBs_P-B of FT:mat_peptide KC792674_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0027). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792675_MHBs_P-B Product feature CHAIN KC792675_MHBs_P-B of FT:mat_peptide KC792675_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0028). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSXXXXXSSXTGDPVPNMENIASGLLGPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILXPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792676_MHBs_P-B Product feature CHAIN KC792676_MHBs_P-B of FT:mat_peptide KC792676_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0029). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNXVSXXSSXSXTTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLXFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLXVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPXFLCLWVYI
>gnl|hbvpro|KC792677_MHBs_P-B Product feature CHAIN KC792677_MHBs_P-B of FT:mat_peptide KC792677_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0030). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPXMENIASGLLGPLLVLQAGFFLLTKI
LTIPXSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTXAXGTSMFPSCCCTKPTDGNCTCIPIPSSWXFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILXPFMPLLXIFFCLWVYI
>gnl|hbvpro|KC792678_MHBs_P-B Product feature CHAIN KC792678_MHBs_P-B of FT:mat_peptide KC792678_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0031). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQSSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVFI
>gnl|hbvpro|KC792681_MHBs_P-B Product feature CHAIN KC792681_MHBs_P-B of FT:mat_peptide KC792681_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792683_MHBs_P-B Product feature CHAIN KC792683_MHBs_P-B of FT:mat_peptide KC792683_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0036). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VXWNSXTFLQTLQDPRVRALXXPAGGSSSGTVSPAQXTVSTISSIXSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPXCLGQNSQSQISSHSPTCCPPICPGYRLMCLRRFIIXLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLXIFXCLWVYI
>gnl|hbvpro|KC792684_MHBs_P-B Product feature CHAIN KC792684_MHBs_P-B of FT:mat_peptide KC792684_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0037). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792685_MHBs_P-B Product feature CHAIN KC792685_MHBs_P-B of FT:mat_peptide KC792685_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0038). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792686_MHBs_P-B Product feature CHAIN KC792686_MHBs_P-B of FT:mat_peptide KC792686_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792687_MHBs_P-B Product feature CHAIN KC792687_MHBs_P-B of FT:mat_peptide KC792687_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0040). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792688_MHBs_P-B Product feature CHAIN KC792688_MHBs_P-B of FT:mat_peptide KC792688_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0041). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSVXSSTLSTTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792689_MHBs_P-B Product feature CHAIN KC792689_MHBs_P-B of FT:mat_peptide KC792689_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0042). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792692_MHBs_P-B Product feature CHAIN KC792692_MHBs_P-B of FT:mat_peptide KC792692_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0045). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDXRVRALYLPAGGSNSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWXSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLFPIFFCLWVYI
>gnl|hbvpro|KC792694_MHBs_P-B Product feature CHAIN KC792694_MHBs_P-B of FT:mat_peptide KC792694_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0047). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLXLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPRCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSTKPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPXXPLLPIFFCLWXYI
>gnl|hbvpro|KC792696_MHBs_P-B Product feature CHAIN KC792696_MHBs_P-B of FT:mat_peptide KC792696_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0049). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQSQICSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMXWYWGPSLYNILSPFMPLFSIFFCLWVYI
>gnl|hbvpro|KC792697_MHBs_P-B Product feature CHAIN KC792697_MHBs_P-B of FT:mat_peptide KC792697_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0050). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792698_MHBs_P-B Product feature CHAIN KC792698_MHBs_P-B of FT:mat_peptide KC792698_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0051). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
XTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792699_MHBs_P-B Product feature CHAIN KC792699_MHBs_P-B of FT:mat_peptide KC792699_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0052). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNSTTFQQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIAXGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISXHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792701_MHBs_P-B Product feature CHAIN KC792701_MHBs_P-B of FT:mat_peptide KC792701_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0054). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTXHQTLQDPRVRALXXPAGGSSSGTVSPAQNTVSAISSILXKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLEGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC792702_MHBs_P-B Product feature CHAIN KC792702_MHBs_P-B of FT:mat_peptide KC792702_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0055). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTTECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792703_MHBs_P-B Product feature CHAIN KC792703_MHBs_P-B of FT:mat_peptide KC792703_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0056). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASARFSWLSXLVPFVQWFVG
LSPTVWLSVIWMILYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792705_MHBs_P-B Product feature CHAIN KC792705_MHBs_P-B of FT:mat_peptide KC792705_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0058). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSXXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNXQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYXGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWCVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792709_MHBs_P-B Product feature CHAIN KC792709_MHBs_P-B of FT:mat_peptide KC792709_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0062). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMLPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792711_MHBs_P-B Product feature CHAIN KC792711_MHBs_P-B of FT:mat_peptide KC792711_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792712_MHBs_P-B Product feature CHAIN KC792712_MHBs_P-B of FT:mat_peptide KC792712_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0065). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSPTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQSSQSQISNHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDCQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792714_MHBs_P-B Product feature CHAIN KC792714_MHBs_P-B of FT:mat_peptide KC792714_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0067). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792715_MHBs_P-B Product feature CHAIN KC792715_MHBs_P-B of FT:mat_peptide KC792715_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0068). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCXGQNSQSQISSHLLTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792717_MHBs_P-B Product feature CHAIN KC792717_MHBs_P-B of FT:mat_peptide KC792717_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0070). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792718_MHBs_P-B Product feature CHAIN KC792718_MHBs_P-B of FT:mat_peptide KC792718_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0071). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVSAISSXXSTTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792719_MHBs_P-B Product feature CHAIN KC792719_MHBs_P-B of FT:mat_peptide KC792719_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0072). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792720_MHBs_P-B Product feature CHAIN KC792720_MHBs_P-B of FT:mat_peptide KC792720_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0073). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSXTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFPEGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792721_MHBs_P-B Product feature CHAIN KC792721_MHBs_P-B of FT:mat_peptide KC792721_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0074). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILXXTGDPVXNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPXXYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792722_MHBs_P-B Product feature CHAIN KC792722_MHBs_P-B of FT:mat_peptide KC792722_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0075). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWISLNFLGGTPVCLGQNSQSQISSHSPTCCPQTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792723_MHBs_P-B Product feature CHAIN KC792723_MHBs_P-B of FT:mat_peptide KC792723_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0076). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=282 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDXWWTSLSFLGXTPXCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRXIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEXASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYXILSPFMPLLXIFFCLWVYIX
>gnl|hbvpro|KC792724_MHBs_P-B Product feature CHAIN KC792724_MHBs_P-B of FT:mat_peptide KC792724_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0077). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHXTLQDPRVRALYXPAGGSSSGTVXPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGPSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|KC792725_MHBs_P-B Product feature CHAIN KC792725_MHBs_P-B of FT:mat_peptide KC792725_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0078). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTXHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLXGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792726_MHBs_P-B Product feature CHAIN KC792726_MHBs_P-B of FT:mat_peptide KC792726_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0079). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYXTLSPFMPLLPXFFCLWVYI
>gnl|hbvpro|KC792727_MHBs_P-B Product feature CHAIN KC792727_MHBs_P-B of FT:mat_peptide KC792727_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0080). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792728_MHBs_P-B Product feature CHAIN KC792728_MHBs_P-B of FT:mat_peptide KC792728_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0081). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSSLSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792729_MHBs_P-B Product feature CHAIN KC792729_MHBs_P-B of FT:mat_peptide KC792729_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0082). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792730_MHBs_P-B Product feature CHAIN KC792730_MHBs_P-B of FT:mat_peptide KC792730_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0083). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLXFLGXTXVCXGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792731_MHBs_P-B Product feature CHAIN KC792731_MHBs_P-B of FT:mat_peptide KC792731_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792733_MHBs_P-B Product feature CHAIN KC792733_MHBs_P-B of FT:mat_peptide KC792733_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0086). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSTLSTTGDLVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPQIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWGSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792735_MHBs_P-B Product feature CHAIN KC792735_MHBs_P-B of FT:mat_peptide KC792735_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792736_MHBs_P-B Product feature CHAIN KC792736_MHBs_P-B of FT:mat_peptide KC792736_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0089). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGEAPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792737_MHBs_P-B Product feature CHAIN KC792737_MHBs_P-B of FT:mat_peptide KC792737_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0090). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSPISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSXIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792738_MHBs_P-B Product feature CHAIN KC792738_MHBs_P-B of FT:mat_peptide KC792738_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0091). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTXFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792741_MHBs_P-B Product feature CHAIN KC792741_MHBs_P-B of FT:mat_peptide KC792741_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0094). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNTTTFHQTLQDXRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792742_MHBs_P-B Product feature CHAIN KC792742_MHBs_P-B of FT:mat_peptide KC792742_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0095). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792743_MHBs_P-B Product feature CHAIN KC792743_MHBs_P-B of FT:mat_peptide KC792743_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0096). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLP
XCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792744_MHBs_P-B Product feature CHAIN KC792744_MHBs_P-B of FT:mat_peptide KC792744_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSXAQNTVSAISSXLSXTGDPVPNMENITSGLLGPLLVLQAGFFLLTKX
LTIPQSLDSWWTSLXFLGXTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792745_MHBs_P-B Product feature CHAIN KC792745_MHBs_P-B of FT:mat_peptide KC792745_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VKWNSTTFHQTLQNPRVRALYXPAGGSSSXTVSPAQNTVSAISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792747_MHBs_P-B Product feature CHAIN KC792747_MHBs_P-B of FT:mat_peptide KC792747_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0100). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792748_MHBs_P-B Product feature CHAIN KC792748_MHBs_P-B of FT:mat_peptide KC792748_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0101). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSXXSXTGDPVXNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792749_MHBs_P-B Product feature CHAIN KC792749_MHBs_P-B of FT:mat_peptide KC792749_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792750_MHBs_P-B Product feature CHAIN KC792750_MHBs_P-B of FT:mat_peptide KC792750_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLWTKI
LTIPQSLDSWWTSLNFLGETPGCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792752_MHBs_P-B Product feature CHAIN KC792752_MHBs_P-B of FT:mat_peptide KC792752_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0105). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGAVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWYWGPNLYNXLXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792754_MHBs_P-B Product feature CHAIN KC792754_MHBs_P-B of FT:mat_peptide KC792754_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792755_MHBs_P-B Product feature CHAIN KC792755_MHBs_P-B of FT:mat_peptide KC792755_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0108). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPXPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792756_MHBs_P-B Product feature CHAIN KC792756_MHBs_P-B of FT:mat_peptide KC792756_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792758_MHBs_P-B Product feature CHAIN KC792758_MHBs_P-B of FT:mat_peptide KC792758_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0111). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPXGGSSSXTASPAQNTVSAISSXLSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792760_MHBs_P-B Product feature CHAIN KC792760_MHBs_P-B of FT:mat_peptide KC792760_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0113). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSXTVSPAQNTVSAISSILSXIGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792761_MHBs_P-B Product feature CHAIN KC792761_MHBs_P-B of FT:mat_peptide KC792761_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0114). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLXFXGETPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792763_MHBs_P-B Product feature CHAIN KC792763_MHBs_P-B of FT:mat_peptide KC792763_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0116). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSXIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792764_MHBs_P-B Product feature CHAIN KC792764_MHBs_P-B of FT:mat_peptide KC792764_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0117). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSLAQNTVSAISSILSTTGDPVPNMDNITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLEGTXGCRGQNSQSQIXSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792765_MHBs_P-B Product feature CHAIN KC792765_MHBs_P-B of FT:mat_peptide KC792765_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0118). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQXNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKTGDPVXNMENIXSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSTFPSCCCTKPTDGNCTCIPIPSSLAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792766_MHBs_P-B Product feature CHAIN KC792766_MHBs_P-B of FT:mat_peptide KC792766_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792767_MHBs_P-B Product feature CHAIN KC792767_MHBs_P-B of FT:mat_peptide KC792767_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0120). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLICLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792768_MHBs_P-B Product feature CHAIN KC792768_MHBs_P-B of FT:mat_peptide KC792768_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792769_MHBs_P-B Product feature CHAIN KC792769_MHBs_P-B of FT:mat_peptide KC792769_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0122). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFLQTLXDPRVRALYLPAGGSXSGTVSPAQNTVSAISSXFSXTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGXNSQSQISSHSPTCCPPICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792770_MHBs_P-B Product feature CHAIN KC792770_MHBs_P-B of FT:mat_peptide KC792770_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0123). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYSPAGGSSSGTVSPAQNTVSXXSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFGG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792772_MHBs_P-B Product feature CHAIN KC792772_MHBs_P-B of FT:mat_peptide KC792772_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0125). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDXAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792773_MHBs_P-B Product feature CHAIN KC792773_MHBs_P-B of FT:mat_peptide KC792773_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0126). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792774_MHBs_P-B Product feature CHAIN KC792774_MHBs_P-B of FT:mat_peptide KC792774_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0127). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGXTXVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792777_MHBs_P-B Product feature CHAIN KC792777_MHBs_P-B of FT:mat_peptide KC792777_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0130). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTTGDPVXNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWXSLNFRGGTPECLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWGWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792778_MHBs_P-B Product feature CHAIN KC792778_MHBs_P-B of FT:mat_peptide KC792778_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0131). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792780_MHBs_P-B Product feature CHAIN KC792780_MHBs_P-B of FT:mat_peptide KC792780_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0133). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSVISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792781_MHBs_P-B Product feature CHAIN KC792781_MHBs_P-B of FT:mat_peptide KC792781_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0134). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPXMPLLPIFFCLWVYI
>gnl|hbvpro|KC792782_MHBs_P-B Product feature CHAIN KC792782_MHBs_P-B of FT:mat_peptide KC792782_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0135). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXXLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRXIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792783_MHBs_P-B Product feature CHAIN KC792783_MHBs_P-B of FT:mat_peptide KC792783_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MRWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792784_MHBs_P-B Product feature CHAIN KC792784_MHBs_P-B of FT:mat_peptide KC792784_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0137). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792785_MHBs_P-B Product feature CHAIN KC792785_MHBs_P-B of FT:mat_peptide KC792785_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPLICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792786_MHBs_P-B Product feature CHAIN KC792786_MHBs_P-B of FT:mat_peptide KC792786_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0139). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQXLDXWWTSLXFLGGTXXCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792787_MHBs_P-B Product feature CHAIN KC792787_MHBs_P-B of FT:mat_peptide KC792787_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0140). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAXNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792788_MHBs_P-B Product feature CHAIN KC792788_MHBs_P-B of FT:mat_peptide KC792788_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0141). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792789_MHBs_P-B Product feature CHAIN KC792789_MHBs_P-B of FT:mat_peptide KC792789_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLICLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792791_MHBs_P-B Product feature CHAIN KC792791_MHBs_P-B of FT:mat_peptide KC792791_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0144). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASRLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRXFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792794_MHBs_P-B Product feature CHAIN KC792794_MHBs_P-B of FT:mat_peptide KC792794_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0147). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGPLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMIWFWGRSLCTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792795_MHBs_P-B Product feature CHAIN KC792795_MHBs_P-B of FT:mat_peptide KC792795_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0148). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792796_MHBs_P-B Product feature CHAIN KC792796_MHBs_P-B of FT:mat_peptide KC792796_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0149). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTXPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792797_MHBs_P-B Product feature CHAIN KC792797_MHBs_P-B of FT:mat_peptide KC792797_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0150). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792798_MHBs_P-B Product feature CHAIN KC792798_MHBs_P-B of FT:mat_peptide KC792798_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0151). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|KC792800_MHBs_P-B Product feature CHAIN KC792800_MHBs_P-B of FT:mat_peptide KC792800_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0153). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGXFLLTKI
LTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLXPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792802_MHBs_P-B Product feature CHAIN KC792802_MHBs_P-B of FT:mat_peptide KC792802_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0155). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQIXSHSPTCCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWTMWFWGPXLYNXLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792804_MHBs_P-B Product feature CHAIN KC792804_MHBs_P-B of FT:mat_peptide KC792804_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0157). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKXGDLVXNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQXSNHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVXWMMWFWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792805_MHBs_P-B Product feature CHAIN KC792805_MHBs_P-B of FT:mat_peptide KC792805_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0158). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTXFHQTLQDPRVRALYFXAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHXPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792807_MHBs_P-B Product feature CHAIN KC792807_MHBs_P-B of FT:mat_peptide KC792807_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0160). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC792808_MHBs_P-B Product feature CHAIN KC792808_MHBs_P-B of FT:mat_peptide KC792808_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0161). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSXTVXPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LXIPQSLDXWWTSLXFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792809_MHBs_P-B Product feature CHAIN KC792809_MHBs_P-B of FT:mat_peptide KC792809_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0162). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792810_MHBs_P-B Product feature CHAIN KC792810_MHBs_P-B of FT:mat_peptide KC792810_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0163). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IRWXNPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWFWGPRLCTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792811_MHBs_P-B Product feature CHAIN KC792811_MHBs_P-B of FT:mat_peptide KC792811_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|KC792812_MHBs_P-B Product feature CHAIN KC792812_MHBs_P-B of FT:mat_peptide KC792812_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0165). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTXFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDXWWTSLNFLGETPVCLGQNSQSXISXHXPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792813_MHBs_P-B Product feature CHAIN KC792813_MHBs_P-B of FT:mat_peptide KC792813_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0166). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792814_MHBs_P-B Product feature CHAIN KC792814_MHBs_P-B of FT:mat_peptide KC792814_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0167). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSXLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792815_MHBs_P-B Product feature CHAIN KC792815_MHBs_P-B of FT:mat_peptide KC792815_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792819_MHBs_P-B Product feature CHAIN KC792819_MHBs_P-B of FT:mat_peptide KC792819_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0172). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSRTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792820_MHBs_P-B Product feature CHAIN KC792820_MHBs_P-B of FT:mat_peptide KC792820_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVSPAQNTVSTISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792821_MHBs_P-B Product feature CHAIN KC792821_MHBs_P-B of FT:mat_peptide KC792821_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0174). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYVPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPRLCSILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792822_MHBs_P-B Product feature CHAIN KC792822_MHBs_P-B of FT:mat_peptide KC792822_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0175). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGGPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792823_MHBs_P-B Product feature CHAIN KC792823_MHBs_P-B of FT:mat_peptide KC792823_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0176). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792824_MHBs_P-B Product feature CHAIN KC792824_MHBs_P-B of FT:mat_peptide KC792824_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0177). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDXWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792825_MHBs_P-B Product feature CHAIN KC792825_MHBs_P-B of FT:mat_peptide KC792825_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0178). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSANSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLXVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWFWGPSLFSILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792827_MHBs_P-B Product feature CHAIN KC792827_MHBs_P-B of FT:mat_peptide KC792827_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0180). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFMSLLPIFFCLWVYI
>gnl|hbvpro|KC792828_MHBs_P-B Product feature CHAIN KC792828_MHBs_P-B of FT:mat_peptide KC792828_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0181). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792829_MHBs_P-B Product feature CHAIN KC792829_MHBs_P-B of FT:mat_peptide KC792829_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0182). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRTLYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792832_MHBs_P-B Product feature CHAIN KC792832_MHBs_P-B of FT:mat_peptide KC792832_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMXPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792835_MHBs_P-B Product feature CHAIN KC792835_MHBs_P-B of FT:mat_peptide KC792835_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0188). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSXLSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792836_MHBs_P-B Product feature CHAIN KC792836_MHBs_P-B of FT:mat_peptide KC792836_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0189). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
RTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792837_MHBs_P-B Product feature CHAIN KC792837_MHBs_P-B of FT:mat_peptide KC792837_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0190). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGTPVCPGQNSQSQISSHSPTCCPPICPGYRXMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILRPFMPLLPIFCCLWAYI
>gnl|hbvpro|KC792838_MHBs_P-B Product feature CHAIN KC792838_MHBs_P-B of FT:mat_peptide KC792838_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0191). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792839_MHBs_P-B Product feature CHAIN KC792839_MHBs_P-B of FT:mat_peptide KC792839_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0192). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792840_MHBs_P-B Product feature CHAIN KC792840_MHBs_P-B of FT:mat_peptide KC792840_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0193). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSXTVSPAQNTVSAISSILSXXGDPVPNMENIASGLLGPLLVLQAGFFXLTKX
LXIPQSLDSWWTSLNFXGGTPVCLGQNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|KC792841_MHBs_P-B Product feature CHAIN KC792841_MHBs_P-B of FT:mat_peptide KC792841_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0194). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792842_MHBs_P-B Product feature CHAIN KC792842_MHBs_P-B of FT:mat_peptide KC792842_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0195). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDTKVRALYLPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792843_MHBs_P-B Product feature CHAIN KC792843_MHBs_P-B of FT:mat_peptide KC792843_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0196). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLSFLXGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMXWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792844_MHBs_P-B Product feature CHAIN KC792844_MHBs_P-B of FT:mat_peptide KC792844_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0197). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDSRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNTLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792845_MHBs_P-B Product feature CHAIN KC792845_MHBs_P-B of FT:mat_peptide KC792845_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0198). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAXSSXXSXTGDPVPNMENIXSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCXGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIXLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYM
>gnl|hbvpro|KC792846_MHBs_P-B Product feature CHAIN KC792846_MHBs_P-B of FT:mat_peptide KC792846_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0199). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VXWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQXTVSAISSILSXXGDXVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792847_MHBs_P-B Product feature CHAIN KC792847_MHBs_P-B of FT:mat_peptide KC792847_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0200). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTPFHQTRQETPVRASHLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLALQAGFFLLTKI
LTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDXQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792848_MHBs_P-B Product feature CHAIN KC792848_MHBs_P-B of FT:mat_peptide KC792848_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0201). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VXWNSTTFHQTLQDPRVKALYLPAGGSSXGTVSPAQNTVSXISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792849_MHBs_P-B Product feature CHAIN KC792849_MHBs_P-B of FT:mat_peptide KC792849_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0202). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQDLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792850_MHBs_P-B Product feature CHAIN KC792850_MHBs_P-B of FT:mat_peptide KC792850_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0203). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQNLDSWWTSLNFLGETPVCPGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGXSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGXSLYNILSXFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792851_MHBs_P-B Product feature CHAIN KC792851_MHBs_P-B of FT:mat_peptide KC792851_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHKTLQDPRVRALYIPAGGSSSGTLSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792852_MHBs_P-B Product feature CHAIN KC792852_MHBs_P-B of FT:mat_peptide KC792852_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0205). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILKPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792854_MHBs_P-B Product feature CHAIN KC792854_MHBs_P-B of FT:mat_peptide KC792854_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792855_MHBs_P-B Product feature CHAIN KC792855_MHBs_P-B of FT:mat_peptide KC792855_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0208). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792856_MHBs_P-B Product feature CHAIN KC792856_MHBs_P-B of FT:mat_peptide KC792856_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0209). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792858_MHBs_P-B Product feature CHAIN KC792858_MHBs_P-B of FT:mat_peptide KC792858_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0211). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792859_MHBs_P-B Product feature CHAIN KC792859_MHBs_P-B of FT:mat_peptide KC792859_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0212). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENXASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXXPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWXSVIWMMWFWGPXLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792860_MHBs_P-B Product feature CHAIN KC792860_MHBs_P-B of FT:mat_peptide KC792860_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0213). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSRTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KC792861_MHBs_P-B Product feature CHAIN KC792861_MHBs_P-B of FT:mat_peptide KC792861_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0214). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCXGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792863_MHBs_P-B Product feature CHAIN KC792863_MHBs_P-B of FT:mat_peptide KC792863_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0216). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPXSLDSWWTSLXFLGXTPXCLGQNSQSQISNHSPTCCPPICPGYRWMCLRXFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMXWYWGPSLYNTLSPFIPQLPIFFCLWVYI
>gnl|hbvpro|KC792864_MHBs_P-B Product feature CHAIN KC792864_MHBs_P-B of FT:mat_peptide KC792864_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0217). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRAXYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792865_MHBs_P-B Product feature CHAIN KC792865_MHBs_P-B of FT:mat_peptide KC792865_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0218). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETXVCXGQNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792866_MHBs_P-B Product feature CHAIN KC792866_MHBs_P-B of FT:mat_peptide KC792866_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792867_MHBs_P-B Product feature CHAIN KC792867_MHBs_P-B of FT:mat_peptide KC792867_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0220). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792869_MHBs_P-B Product feature CHAIN KC792869_MHBs_P-B of FT:mat_peptide KC792869_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0222). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792870_MHBs_P-B Product feature CHAIN KC792870_MHBs_P-B of FT:mat_peptide KC792870_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0223). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XKWNSXTCHQTLQBPRVRALXLPAGGSSSGTVSPAQNTXSPISSXXSKTGDPVPNMENIASGLLGPLLXLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHLLTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792871_MHBs_P-B Product feature CHAIN KC792871_MHBs_P-B of FT:mat_peptide KC792871_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0224). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSXTFHQXLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792872_MHBs_P-B Product feature CHAIN KC792872_MHBs_P-B of FT:mat_peptide KC792872_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0225). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792874_MHBs_P-B Product feature CHAIN KC792874_MHBs_P-B of FT:mat_peptide KC792874_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792875_MHBs_P-B Product feature CHAIN KC792875_MHBs_P-B of FT:mat_peptide KC792875_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0228). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792877_MHBs_P-B Product feature CHAIN KC792877_MHBs_P-B of FT:mat_peptide KC792877_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0230). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVXPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792878_MHBs_P-B Product feature CHAIN KC792878_MHBs_P-B of FT:mat_peptide KC792878_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0231). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFLQTLHDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSRTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYXWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYXILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|KC792879_MHBs_P-B Product feature CHAIN KC792879_MHBs_P-B of FT:mat_peptide KC792879_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0232). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRTLYFPAGGSSSRTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792881_MHBs_P-B Product feature CHAIN KC792881_MHBs_P-B of FT:mat_peptide KC792881_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0234). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLALQAAFSLWTRI
LTIPQSLDSWWTSLSFLGGTPVCPGQNSQSQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWVSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792882_MHBs_P-B Product feature CHAIN KC792882_MHBs_P-B of FT:mat_peptide KC792882_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0235). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILXPFMPLLPIFXCLWVYX
>gnl|hbvpro|KC792883_MHBs_P-B Product feature CHAIN KC792883_MHBs_P-B of FT:mat_peptide KC792883_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQTTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792884_MHBs_P-B Product feature CHAIN KC792884_MHBs_P-B of FT:mat_peptide KC792884_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPGCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792885_MHBs_P-B Product feature CHAIN KC792885_MHBs_P-B of FT:mat_peptide KC792885_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0238). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQXNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSXISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792887_MHBs_P-B Product feature CHAIN KC792887_MHBs_P-B of FT:mat_peptide KC792887_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0240). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVTWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792888_MHBs_P-B Product feature CHAIN KC792888_MHBs_P-B of FT:mat_peptide KC792888_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0241). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFPEGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWYWGPNLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792889_MHBs_P-B Product feature CHAIN KC792889_MHBs_P-B of FT:mat_peptide KC792889_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0242). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMXP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792890_MHBs_P-B Product feature CHAIN KC792890_MHBs_P-B of FT:mat_peptide KC792890_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0243). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792892_MHBs_P-B Product feature CHAIN KC792892_MHBs_P-B of FT:mat_peptide KC792892_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0245). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKSLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792893_MHBs_P-B Product feature CHAIN KC792893_MHBs_P-B of FT:mat_peptide KC792893_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0246). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPVGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792894_MHBs_P-B Product feature CHAIN KC792894_MHBs_P-B of FT:mat_peptide KC792894_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQXNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792895_MHBs_P-B Product feature CHAIN KC792895_MHBs_P-B of FT:mat_peptide KC792895_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0248). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792896_MHBs_P-B Product feature CHAIN KC792896_MHBs_P-B of FT:mat_peptide KC792896_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0249). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XRWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSAXSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFXLWXYI
>gnl|hbvpro|KC792897_MHBs_P-B Product feature CHAIN KC792897_MHBs_P-B of FT:mat_peptide KC792897_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0250). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|KC792898_MHBs_P-B Product feature CHAIN KC792898_MHBs_P-B of FT:mat_peptide KC792898_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0251). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLXVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792899_MHBs_P-B Product feature CHAIN KC792899_MHBs_P-B of FT:mat_peptide KC792899_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0252). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792900_MHBs_P-B Product feature CHAIN KC792900_MHBs_P-B of FT:mat_peptide KC792900_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0253). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDANCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792901_MHBs_P-B Product feature CHAIN KC792901_MHBs_P-B of FT:mat_peptide KC792901_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0254). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTEGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792903_MHBs_P-B Product feature CHAIN KC792903_MHBs_P-B of FT:mat_peptide KC792903_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0256). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTSFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792904_MHBs_P-B Product feature CHAIN KC792904_MHBs_P-B of FT:mat_peptide KC792904_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0257). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKX
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792905_MHBs_P-B Product feature CHAIN KC792905_MHBs_P-B of FT:mat_peptide KC792905_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0258). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAXSSIXSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792906_MHBs_P-B Product feature CHAIN KC792906_MHBs_P-B of FT:mat_peptide KC792906_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792907_MHBs_P-B Product feature CHAIN KC792907_MHBs_P-B of FT:mat_peptide KC792907_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0260). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792908_MHBs_P-B Product feature CHAIN KC792908_MHBs_P-B of FT:mat_peptide KC792908_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0261). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLNPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792909_MHBs_P-B Product feature CHAIN KC792909_MHBs_P-B of FT:mat_peptide KC792909_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0262). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792910_MHBs_P-B Product feature CHAIN KC792910_MHBs_P-B of FT:mat_peptide KC792910_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSLGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792912_MHBs_P-B Product feature CHAIN KC792912_MHBs_P-B of FT:mat_peptide KC792912_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0265). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792913_MHBs_P-B Product feature CHAIN KC792913_MHBs_P-B of FT:mat_peptide KC792913_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0266). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792915_MHBs_P-B Product feature CHAIN KC792915_MHBs_P-B of FT:mat_peptide KC792915_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKIGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDSQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792916_MHBs_P-B Product feature CHAIN KC792916_MHBs_P-B of FT:mat_peptide KC792916_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0269). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYRGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYS
>gnl|hbvpro|KC792917_MHBs_P-B Product feature CHAIN KC792917_MHBs_P-B of FT:mat_peptide KC792917_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0270). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792918_MHBs_P-B Product feature CHAIN KC792918_MHBs_P-B of FT:mat_peptide KC792918_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0271). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNYATFHQTLQVHTVKGLNLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792919_MHBs_P-B Product feature CHAIN KC792919_MHBs_P-B of FT:mat_peptide KC792919_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0272). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTNTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792920_MHBs_P-B Product feature CHAIN KC792920_MHBs_P-B of FT:mat_peptide KC792920_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0273). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVXPAQNTVSXXSSILSXTGDPVPNMENIASGXLGPLLXLQAXFFLXTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIXLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVG
LSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWXYI
>gnl|hbvpro|KC792924_MHBs_P-B Product feature CHAIN KC792924_MHBs_P-B of FT:mat_peptide KC792924_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0277). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHHTLQDXRVRALYFPAGGSSSGTVSPAQNTVSATSSNSSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792925_MHBs_P-B Product feature CHAIN KC792925_MHBs_P-B of FT:mat_peptide KC792925_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0278). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWXSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792928_MHBs_P-B Product feature CHAIN KC792928_MHBs_P-B of FT:mat_peptide KC792928_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0281). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQXLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792930_MHBs_P-B Product feature CHAIN KC792930_MHBs_P-B of FT:mat_peptide KC792930_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792931_MHBs_P-B Product feature CHAIN KC792931_MHBs_P-B of FT:mat_peptide KC792931_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0284). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSHISSSSSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQFQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792932_MHBs_P-B Product feature CHAIN KC792932_MHBs_P-B of FT:mat_peptide KC792932_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0285). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMTWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792933_MHBs_P-B Product feature CHAIN KC792933_MHBs_P-B of FT:mat_peptide KC792933_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0286). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLEGTPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792934_MHBs_P-B Product feature CHAIN KC792934_MHBs_P-B of FT:mat_peptide KC792934_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0287). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792935_MHBs_P-B Product feature CHAIN KC792935_MHBs_P-B of FT:mat_peptide KC792935_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0288). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFLQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792936_MHBs_P-B Product feature CHAIN KC792936_MHBs_P-B of FT:mat_peptide KC792936_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0289). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMXLRXFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPXFFCLWVYI
>gnl|hbvpro|KC792937_MHBs_P-B Product feature CHAIN KC792937_MHBs_P-B of FT:mat_peptide KC792937_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0290). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNILRPFIPLLSIFFCLWVYI
>gnl|hbvpro|KC792938_MHBs_P-B Product feature CHAIN KC792938_MHBs_P-B of FT:mat_peptide KC792938_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQTTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792939_MHBs_P-B Product feature CHAIN KC792939_MHBs_P-B of FT:mat_peptide KC792939_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0292). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAXFFLLTKI
LTIPQSLDSWWTSLSFLGGTXXCLGQNSQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLSIFLCLWVYI
>gnl|hbvpro|KC792942_MHBs_P-B Product feature CHAIN KC792942_MHBs_P-B of FT:mat_peptide KC792942_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0295). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVXPAQNTVSXXSXXXSKTGXXVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|KC792943_MHBs_P-B Product feature CHAIN KC792943_MHBs_P-B of FT:mat_peptide KC792943_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALNFPAGGSSSETVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792944_MHBs_P-B Product feature CHAIN KC792944_MHBs_P-B of FT:mat_peptide KC792944_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0297). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MRWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792945_MHBs_P-B Product feature CHAIN KC792945_MHBs_P-B of FT:mat_peptide KC792945_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0298). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLXDYQGMLP
VCPLIPGSSTTSTGPCKTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792947_MHBs_P-B Product feature CHAIN KC792947_MHBs_P-B of FT:mat_peptide KC792947_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0300). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWXXAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLCTILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|KC792948_MHBs_P-B Product feature CHAIN KC792948_MHBs_P-B of FT:mat_peptide KC792948_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0301). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792949_MHBs_P-B Product feature CHAIN KC792949_MHBs_P-B of FT:mat_peptide KC792949_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0302). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGXSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792950_MHBs_P-B Product feature CHAIN KC792950_MHBs_P-B of FT:mat_peptide KC792950_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0303). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVXPXQNTXSAISSIXSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQXSSHXPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLCXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792952_MHBs_P-B Product feature CHAIN KC792952_MHBs_P-B of FT:mat_peptide KC792952_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0305). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792953_MHBs_P-B Product feature CHAIN KC792953_MHBs_P-B of FT:mat_peptide KC792953_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0306). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQNPKVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVSNMENIASGLLGPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792954_MHBs_P-B Product feature CHAIN KC792954_MHBs_P-B of FT:mat_peptide KC792954_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0307). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792955_MHBs_P-B Product feature CHAIN KC792955_MHBs_P-B of FT:mat_peptide KC792955_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTFCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792956_MHBs_P-B Product feature CHAIN KC792956_MHBs_P-B of FT:mat_peptide KC792956_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0309). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XKWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAPNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFXCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLRPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792957_MHBs_P-B Product feature CHAIN KC792957_MHBs_P-B of FT:mat_peptide KC792957_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0310). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWGSVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792958_MHBs_P-B Product feature CHAIN KC792958_MHBs_P-B of FT:mat_peptide KC792958_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0311). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDTRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGETPVCFGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792959_MHBs_P-B Product feature CHAIN KC792959_MHBs_P-B of FT:mat_peptide KC792959_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0312). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRIRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMSLLPIFFCLWVYI
>gnl|hbvpro|KC792960_MHBs_P-B Product feature CHAIN KC792960_MHBs_P-B of FT:mat_peptide KC792960_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0313). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792963_MHBs_P-B Product feature CHAIN KC792963_MHBs_P-B of FT:mat_peptide KC792963_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0316). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792964_MHBs_P-B Product feature CHAIN KC792964_MHBs_P-B of FT:mat_peptide KC792964_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0317). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALXLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTNTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792966_MHBs_P-B Product feature CHAIN KC792966_MHBs_P-B of FT:mat_peptide KC792966_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0319). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTXXPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQNLDLWWTSLSFLGGTPVCLGXDSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792967_MHBs_P-B Product feature CHAIN KC792967_MHBs_P-B of FT:mat_peptide KC792967_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0320). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYX
>gnl|hbvpro|KC792969_MHBs_P-B Product feature CHAIN KC792969_MHBs_P-B of FT:mat_peptide KC792969_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNTTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGVTPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792970_MHBs_P-B Product feature CHAIN KC792970_MHBs_P-B of FT:mat_peptide KC792970_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYXWMXLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792971_MHBs_P-B Product feature CHAIN KC792971_MHBs_P-B of FT:mat_peptide KC792971_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0324). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792972_MHBs_P-B Product feature CHAIN KC792972_MHBs_P-B of FT:mat_peptide KC792972_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0325). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792973_MHBs_P-B Product feature CHAIN KC792973_MHBs_P-B of FT:mat_peptide KC792973_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0326). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792974_MHBs_P-B Product feature CHAIN KC792974_MHBs_P-B of FT:mat_peptide KC792974_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0327). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSXTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792975_MHBs_P-B Product feature CHAIN KC792975_MHBs_P-B of FT:mat_peptide KC792975_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0328). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVFQAGFFLLTKI
LTIPMSLDSWWTSLSFLGGTTECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILTPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792976_MHBs_P-B Product feature CHAIN KC792976_MHBs_P-B of FT:mat_peptide KC792976_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0329). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNSVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792977_MHBs_P-B Product feature CHAIN KC792977_MHBs_P-B of FT:mat_peptide KC792977_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0330). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFXLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYHGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792978_MHBs_P-B Product feature CHAIN KC792978_MHBs_P-B of FT:mat_peptide KC792978_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0331). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792980_MHBs_P-B Product feature CHAIN KC792980_MHBs_P-B of FT:mat_peptide KC792980_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0333). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792981_MHBs_P-B Product feature CHAIN KC792981_MHBs_P-B of FT:mat_peptide KC792981_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0334). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792982_MHBs_P-B Product feature CHAIN KC792982_MHBs_P-B of FT:mat_peptide KC792982_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0335). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFSLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFGG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792983_MHBs_P-B Product feature CHAIN KC792983_MHBs_P-B of FT:mat_peptide KC792983_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0336). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGXTXVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXXIWMMWXWGPNLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792984_MHBs_P-B Product feature CHAIN KC792984_MHBs_P-B of FT:mat_peptide KC792984_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0337). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792985_MHBs_P-B Product feature CHAIN KC792985_MHBs_P-B of FT:mat_peptide KC792985_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0338). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETLVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC792986_MHBs_P-B Product feature CHAIN KC792986_MHBs_P-B of FT:mat_peptide KC792986_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDXWXTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPRLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792987_MHBs_P-B Product feature CHAIN KC792987_MHBs_P-B of FT:mat_peptide KC792987_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0340). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQXNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNXVSAXSSILXXTGDPVPNMENIXSGXLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNIXSPFMPLLPXFFCLWVYI
>gnl|hbvpro|KC792988_MHBs_P-B Product feature CHAIN KC792988_MHBs_P-B of FT:mat_peptide KC792988_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0341). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPNLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792990_MHBs_P-B Product feature CHAIN KC792990_MHBs_P-B of FT:mat_peptide KC792990_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0343). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGYFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792991_MHBs_P-B Product feature CHAIN KC792991_MHBs_P-B of FT:mat_peptide KC792991_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0344). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSXTGXPVXNMENIASGLLGPLLVLQAGFFLLTKI
LTIPRSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792992_MHBs_P-B Product feature CHAIN KC792992_MHBs_P-B of FT:mat_peptide KC792992_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0345). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=279 residues).
WNYTTFHQTLQNPRVRALYFPAGGSSSGTVSPAQNTXSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLTKILI
IPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLPVC
PLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS
PTVWLSVIWMMWFWGPXLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792993_MHBs_P-B Product feature CHAIN KC792993_MHBs_P-B of FT:mat_peptide KC792993_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0346). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792994_MHBs_P-B Product feature CHAIN KC792994_MHBs_P-B of FT:mat_peptide KC792994_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0347). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSXSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792996_MHBs_P-B Product feature CHAIN KC792996_MHBs_P-B of FT:mat_peptide KC792996_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0349). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIVSGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC792997_MHBs_P-B Product feature CHAIN KC792997_MHBs_P-B of FT:mat_peptide KC792997_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTXPRSLDSWWTSLNFLGETPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRHFIIFLFILLLCLIFXLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWTMWFWGPBLCNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792998_MHBs_P-B Product feature CHAIN KC792998_MHBs_P-B of FT:mat_peptide KC792998_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0351). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNYTNFHRTLQNPRVRALYFPAGGSSSETVSPAQNTVLPTSSILSTTGDPVLNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFPEGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KC793000_MHBs_P-B Product feature CHAIN KC793000_MHBs_P-B of FT:mat_peptide KC793000_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0353). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNXTTFLQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLXFLGEKPVCLGQNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793001_MHBs_P-B Product feature CHAIN KC793001_MHBs_P-B of FT:mat_peptide KC793001_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0354). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793002_MHBs_P-B Product feature CHAIN KC793002_MHBs_P-B of FT:mat_peptide KC793002_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0355). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSXGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793004_MHBs_P-B Product feature CHAIN KC793004_MHBs_P-B of FT:mat_peptide KC793004_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0357). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENXASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|KC793005_MHBs_P-B Product feature CHAIN KC793005_MHBs_P-B of FT:mat_peptide KC793005_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0358). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793006_MHBs_P-B Product feature CHAIN KC793006_MHBs_P-B of FT:mat_peptide KC793006_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793007_MHBs_P-B Product feature CHAIN KC793007_MHBs_P-B of FT:mat_peptide KC793007_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0360). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793008_MHBs_P-B Product feature CHAIN KC793008_MHBs_P-B of FT:mat_peptide KC793008_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0361). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHLTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDSWWTSLNFLGXTPXCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793009_MHBs_P-B Product feature CHAIN KC793009_MHBs_P-B of FT:mat_peptide KC793009_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0362). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSIXSKTGDPVPNMENIASGPLGPLLVLQAGFFLLTKI
LTIPQXLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793010_MHBs_P-B Product feature CHAIN KC793010_MHBs_P-B of FT:mat_peptide KC793010_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0363). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793011_MHBs_P-B Product feature CHAIN KC793011_MHBs_P-B of FT:mat_peptide KC793011_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0364). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLSFLGETXVCXGQNSQSQISSHXPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTXWLXVIWMMWYWGXXLYNTLSPFMPLLPXFXCLWVYI
>gnl|hbvpro|KC793012_MHBs_P-B Product feature CHAIN KC793012_MHBs_P-B of FT:mat_peptide KC793012_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0365). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNXTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSXISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793013_MHBs_P-B Product feature CHAIN KC793013_MHBs_P-B of FT:mat_peptide KC793013_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0366). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFLQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793014_MHBs_P-B Product feature CHAIN KC793014_MHBs_P-B of FT:mat_peptide KC793014_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0367). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALXFPAGGSSSGTVXPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVSQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCMKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793015_MHBs_P-B Product feature CHAIN KC793015_MHBs_P-B of FT:mat_peptide KC793015_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0368). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTXVCLGQNSQSQISSHSPTCCPXICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWXFAKXLWEWASVRFSWLSLLVPXVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793016_MHBs_P-B Product feature CHAIN KC793016_MHBs_P-B of FT:mat_peptide KC793016_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0369). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNATTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSXYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793017_MHBs_P-B Product feature CHAIN KC793017_MHBs_P-B of FT:mat_peptide KC793017_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0370). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXXKTGDPVPNMENIASGLLGPLLVLQAGYFSLTKI
LTIPQSLDSWWTSLSFLGDTPVCLGQNSQSXISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPKLCNILSPFMPLLPIFCCLWAYI
>gnl|hbvpro|KC793018_MHBs_P-B Product feature CHAIN KC793018_MHBs_P-B of FT:mat_peptide KC793018_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0371). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793020_MHBs_P-B Product feature CHAIN KC793020_MHBs_P-B of FT:mat_peptide KC793020_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0373). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSSLGGIPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793021_MHBs_P-B Product feature CHAIN KC793021_MHBs_P-B of FT:mat_peptide KC793021_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGXXWMCLRRFIIFLCILLLCLIFLLALLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASXRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793022_MHBs_P-B Product feature CHAIN KC793022_MHBs_P-B of FT:mat_peptide KC793022_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0375). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793023_MHBs_P-B Product feature CHAIN KC793023_MHBs_P-B of FT:mat_peptide KC793023_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0376). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPACLGQNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793025_MHBs_P-B Product feature CHAIN KC793025_MHBs_P-B of FT:mat_peptide KC793025_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0378). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793027_MHBs_P-B Product feature CHAIN KC793027_MHBs_P-B of FT:mat_peptide KC793027_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793028_MHBs_P-B Product feature CHAIN KC793028_MHBs_P-B of FT:mat_peptide KC793028_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0381). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MRWNSPTFHKTLQDPRVRALYFPAGGSSSGTVNPAQNSVSTTLLTSSTTGDPVLNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLXVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793029_MHBs_P-B Product feature CHAIN KC793029_MHBs_P-B of FT:mat_peptide KC793029_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0382). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793031_MHBs_P-B Product feature CHAIN KC793031_MHBs_P-B of FT:mat_peptide KC793031_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0384). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYHWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793032_MHBs_P-B Product feature CHAIN KC793032_MHBs_P-B of FT:mat_peptide KC793032_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0385). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNSTTFHQTLQDPXVRALYFPAGGSSSGTVSPAQXTVSAVSSILSTTGDPXPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQICSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793033_MHBs_P-B Product feature CHAIN KC793033_MHBs_P-B of FT:mat_peptide KC793033_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSALSKTGDPVPNMENIASGLLGPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGERLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793034_MHBs_P-B Product feature CHAIN KC793034_MHBs_P-B of FT:mat_peptide KC793034_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0387). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=282 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPXQNTVSXISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKX
LTIPQSLDSWWTSLXFLGXXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYXILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|KC793036_MHBs_P-B Product feature CHAIN KC793036_MHBs_P-B of FT:mat_peptide KC793036_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0389). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLWTKV
LTIPQSLDSWWTSLNFLGETPVCPGQNSQSQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYXTLTPFMPLLPIFFCXWVYI
>gnl|hbvpro|KC793038_MHBs_P-B Product feature CHAIN KC793038_MHBs_P-B of FT:mat_peptide KC793038_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0391). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSTTVNQTLQXPRVRAQNXPAGGSSSGTVSPAQNTVSAISLILSKIGDLVPNMENIASGLLGPLLALQAGFFXLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|KC793041_MHBs_P-B Product feature CHAIN KC793041_MHBs_P-B of FT:mat_peptide KC793041_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGAVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLXLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFLCLWVYM
>gnl|hbvpro|KC793042_MHBs_P-B Product feature CHAIN KC793042_MHBs_P-B of FT:mat_peptide KC793042_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0395). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIXLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793043_MHBs_P-B Product feature CHAIN KC793043_MHBs_P-B of FT:mat_peptide KC793043_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0396). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793044_MHBs_P-B Product feature CHAIN KC793044_MHBs_P-B of FT:mat_peptide KC793044_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0397). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGFSSGTVSPAQNTVSAISSILSKTGDPVPNMENXASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTXXCLGQNSQSQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWXMWYWGPSLXNILXPFXPLLXIFFCLWVYI
>gnl|hbvpro|KC793045_MHBs_P-B Product feature CHAIN KC793045_MHBs_P-B of FT:mat_peptide KC793045_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0398). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793047_MHBs_P-B Product feature CHAIN KC793047_MHBs_P-B of FT:mat_peptide KC793047_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0400). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPNLYNXLSPFMPLLPIFFCIWVYI
>gnl|hbvpro|KC793048_MHBs_P-B Product feature CHAIN KC793048_MHBs_P-B of FT:mat_peptide KC793048_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0401). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|KC793049_MHBs_P-B Product feature CHAIN KC793049_MHBs_P-B of FT:mat_peptide KC793049_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0402). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQXQISSHSPTCCPPICPGYRWMYLRRFIIFLXILLLXLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793052_MHBs_P-B Product feature CHAIN KC793052_MHBs_P-B of FT:mat_peptide KC793052_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0405). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTXCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793053_MHBs_P-B Product feature CHAIN KC793053_MHBs_P-B of FT:mat_peptide KC793053_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793054_MHBs_P-B Product feature CHAIN KC793054_MHBs_P-B of FT:mat_peptide KC793054_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0407). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHKTLQDPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPXCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|KC793055_MHBs_P-B Product feature CHAIN KC793055_MHBs_P-B of FT:mat_peptide KC793055_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0408). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMTWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793056_MHBs_P-B Product feature CHAIN KC793056_MHBs_P-B of FT:mat_peptide KC793056_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0409). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTSHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSXGPCKTCTAPAQGTSMXPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793057_MHBs_P-B Product feature CHAIN KC793057_MHBs_P-B of FT:mat_peptide KC793057_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0410). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLXFLLALLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVG
LSPTVWLLVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793058_MHBs_P-B Product feature CHAIN KC793058_MHBs_P-B of FT:mat_peptide KC793058_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0411). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSXLVPFVQWFVG
LSPIVWLSVIWMMWFWGPNLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|KC793059_MHBs_P-B Product feature CHAIN KC793059_MHBs_P-B of FT:mat_peptide KC793059_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0412). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793060_MHBs_P-B Product feature CHAIN KC793060_MHBs_P-B of FT:mat_peptide KC793060_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0413). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAXSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTTVCLGQNSQXQISNHSPTCCPPXCPGYRWMCLRRFIXFLFILLLCLXFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWXWGPXLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793061_MHBs_P-B Product feature CHAIN KC793061_MHBs_P-B of FT:mat_peptide KC793061_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDPRVRALYVPAGGSSSGTVSPAPNTVSPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793062_MHBs_P-B Product feature CHAIN KC793062_MHBs_P-B of FT:mat_peptide KC793062_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0415). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793063_MHBs_P-B Product feature CHAIN KC793063_MHBs_P-B of FT:mat_peptide KC793063_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRIRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC793064_MHBs_P-B Product feature CHAIN KC793064_MHBs_P-B of FT:mat_peptide KC793064_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0417). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793065_MHBs_P-B Product feature CHAIN KC793065_MHBs_P-B of FT:mat_peptide KC793065_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0418). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSXISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTXVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793067_MHBs_P-B Product feature CHAIN KC793067_MHBs_P-B of FT:mat_peptide KC793067_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0420). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793069_MHBs_P-B Product feature CHAIN KC793069_MHBs_P-B of FT:mat_peptide KC793069_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSRTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGDTPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793070_MHBs_P-B Product feature CHAIN KC793070_MHBs_P-B of FT:mat_peptide KC793070_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0423). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENTTSGLLGPLLVLQGGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793071_MHBs_P-B Product feature CHAIN KC793071_MHBs_P-B of FT:mat_peptide KC793071_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISXHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSXLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793072_MHBs_P-B Product feature CHAIN KC793072_MHBs_P-B of FT:mat_peptide KC793072_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0425). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILXPFMPLLPIFFCLWVXI
>gnl|hbvpro|KC793073_MHBs_P-B Product feature CHAIN KC793073_MHBs_P-B of FT:mat_peptide KC793073_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0426). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793075_MHBs_P-B Product feature CHAIN KC793075_MHBs_P-B of FT:mat_peptide KC793075_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0428). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLXTKI
LTIPQSLDXWWTSLSFLGGTPXCLGQNSQSQISSHSPTCCPXXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSXGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWXXWFWGPXLYXILXPFXPLLPIFXCLWVYI
>gnl|hbvpro|KC793077_MHBs_P-B Product feature CHAIN KC793077_MHBs_P-B of FT:mat_peptide KC793077_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0430). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793078_MHBs_P-B Product feature CHAIN KC793078_MHBs_P-B of FT:mat_peptide KC793078_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0431). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSNLSTTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWGFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793079_MHBs_P-B Product feature CHAIN KC793079_MHBs_P-B of FT:mat_peptide KC793079_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0432). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEPPKCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVG
LSPTVWLSVIWMMWYWGPTLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793080_MHBs_P-B Product feature CHAIN KC793080_MHBs_P-B of FT:mat_peptide KC793080_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0433). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQBPRVRALYFPAGGSSSETVSPAQNTVSAISSILXTTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYXWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|KC793081_MHBs_P-B Product feature CHAIN KC793081_MHBs_P-B of FT:mat_peptide KC793081_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0434). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVNPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLXYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793082_MHBs_P-B Product feature CHAIN KC793082_MHBs_P-B of FT:mat_peptide KC793082_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0435). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793083_MHBs_P-B Product feature CHAIN KC793083_MHBs_P-B of FT:mat_peptide KC793083_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0436). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
RTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRHFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLXXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793084_MHBs_P-B Product feature CHAIN KC793084_MHBs_P-B of FT:mat_peptide KC793084_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793085_MHBs_P-B Product feature CHAIN KC793085_MHBs_P-B of FT:mat_peptide KC793085_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0438). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793086_MHBs_P-B Product feature CHAIN KC793086_MHBs_P-B of FT:mat_peptide KC793086_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0439). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LIIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793087_MHBs_P-B Product feature CHAIN KC793087_MHBs_P-B of FT:mat_peptide KC793087_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0440). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGXSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793088_MHBs_P-B Product feature CHAIN KC793088_MHBs_P-B of FT:mat_peptide KC793088_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0441). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPXVRALXXTAGGSSSGTVSPAQNTVFTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPLICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793089_MHBs_P-B Product feature CHAIN KC793089_MHBs_P-B of FT:mat_peptide KC793089_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0442). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793090_MHBs_P-B Product feature CHAIN KC793090_MHBs_P-B of FT:mat_peptide KC793090_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0443). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTXCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793091_MHBs_P-B Product feature CHAIN KC793091_MHBs_P-B of FT:mat_peptide KC793091_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQDSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793092_MHBs_P-B Product feature CHAIN KC793092_MHBs_P-B of FT:mat_peptide KC793092_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWHLTTFYQTLQETSVRALNSPAGGSSSGTVSPAQNTVFAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793094_MHBs_P-B Product feature CHAIN KC793094_MHBs_P-B of FT:mat_peptide KC793094_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0447). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793095_MHBs_P-B Product feature CHAIN KC793095_MHBs_P-B of FT:mat_peptide KC793095_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLQDPRVRALXLPAGGSSSGTVSPAQNTVSAXSSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWXVG
LSPXVWLSVIWMMWFWGPXLYXILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793096_MHBs_P-B Product feature CHAIN KC793096_MHBs_P-B of FT:mat_peptide KC793096_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0449). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=282 residues).
MQRNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVXNMENXASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLXFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKXLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXLSPFXPLLPIFFCLWVYIX
>gnl|hbvpro|KC793098_MHBs_P-B Product feature CHAIN KC793098_MHBs_P-B of FT:mat_peptide KC793098_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0451). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVXI
>gnl|hbvpro|KC793099_MHBs_P-B Product feature CHAIN KC793099_MHBs_P-B of FT:mat_peptide KC793099_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0452). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTXMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793101_MHBs_P-B Product feature CHAIN KC793101_MHBs_P-B of FT:mat_peptide KC793101_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0454). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793102_MHBs_P-B Product feature CHAIN KC793102_MHBs_P-B of FT:mat_peptide KC793102_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793104_MHBs_P-B Product feature CHAIN KC793104_MHBs_P-B of FT:mat_peptide KC793104_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0457). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSITFLNTLQTPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
HTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793105_MHBs_P-B Product feature CHAIN KC793105_MHBs_P-B of FT:mat_peptide KC793105_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0458). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793106_MHBs_P-B Product feature CHAIN KC793106_MHBs_P-B of FT:mat_peptide KC793106_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSATSSSLSKTGDPVPNMENIASGLLGPLLGLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793109_MHBs_P-B Product feature CHAIN KC793109_MHBs_P-B of FT:mat_peptide KC793109_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSXISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMXPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMMWXWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793111_MHBs_P-B Product feature CHAIN KC793111_MHBs_P-B of FT:mat_peptide KC793111_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0464). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793113_MHBs_P-B Product feature CHAIN KC793113_MHBs_P-B of FT:mat_peptide KC793113_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC793114_MHBs_P-B Product feature CHAIN KC793114_MHBs_P-B of FT:mat_peptide KC793114_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0467). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTXTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793115_MHBs_P-B Product feature CHAIN KC793115_MHBs_P-B of FT:mat_peptide KC793115_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0468). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793116_MHBs_P-B Product feature CHAIN KC793116_MHBs_P-B of FT:mat_peptide KC793116_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0469). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MXWNXTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTXSSXLXTTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNXQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793117_MHBs_P-B Product feature CHAIN KC793117_MHBs_P-B of FT:mat_peptide KC793117_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0470). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPTCPGYRWMFLRRFIICLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILXPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793118_MHBs_P-B Product feature CHAIN KC793118_MHBs_P-B of FT:mat_peptide KC793118_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNSTTFXQTLQDPRVRTLYXPAGGSSSGTVSPAQNTVSXXSSXLSXTGDPVPNMENIASGLLGPLLXLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLLXFFCLWVYX
>gnl|hbvpro|KC793120_MHBs_P-B Product feature CHAIN KC793120_MHBs_P-B of FT:mat_peptide KC793120_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0473). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQTLQDXRVRAXYFPAGGSSSGTVSPAQNTVSAISSISSXTGDPVPNMENIASGLLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWXWASXRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793121_MHBs_P-B Product feature CHAIN KC793121_MHBs_P-B of FT:mat_peptide KC793121_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0474). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793122_MHBs_P-B Product feature CHAIN KC793122_MHBs_P-B of FT:mat_peptide KC793122_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0475). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793124_MHBs_P-B Product feature CHAIN KC793124_MHBs_P-B of FT:mat_peptide KC793124_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0477). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLSAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQNLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793125_MHBs_P-B Product feature CHAIN KC793125_MHBs_P-B of FT:mat_peptide KC793125_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0478). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNSTTFHQTLQDPRVRALYFPAGGSSSETVSPAQNTVSAISSILSXTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLXDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793126_MHBs_P-B Product feature CHAIN KC793126_MHBs_P-B of FT:mat_peptide KC793126_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0479). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=282 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSPISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLGLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYIX
>gnl|hbvpro|KC793127_MHBs_P-B Product feature CHAIN KC793127_MHBs_P-B of FT:mat_peptide KC793127_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0480). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSXTFHQTLQXPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGXRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793128_MHBs_P-B Product feature CHAIN KC793128_MHBs_P-B of FT:mat_peptide KC793128_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0481). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSRTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGPCKTCTTPAQGXSXXPSCCCTKPTDGNCTCIPIPSSWAFVKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFXCLWXYX
>gnl|hbvpro|KC793130_MHBs_P-B Product feature CHAIN KC793130_MHBs_P-B of FT:mat_peptide KC793130_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0483). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYX
>gnl|hbvpro|KC793131_MHBs_P-B Product feature CHAIN KC793131_MHBs_P-B of FT:mat_peptide KC793131_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0484). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793132_MHBs_P-B Product feature CHAIN KC793132_MHBs_P-B of FT:mat_peptide KC793132_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKXGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYXGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793134_MHBs_P-B Product feature CHAIN KC793134_MHBs_P-B of FT:mat_peptide KC793134_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0487). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNSITFHQTLXGPTVGALYLPAGGSSSGTVSPAQNTVSAISSISSTTGDPVQNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSSLVPFVQWXVG
LSPTVWLSVIWXMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793135_MHBs_P-B Product feature CHAIN KC793135_MHBs_P-B of FT:mat_peptide KC793135_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0488). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793136_MHBs_P-B Product feature CHAIN KC793136_MHBs_P-B of FT:mat_peptide KC793136_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQXTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQTSXHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPXLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC793137_MHBs_P-B Product feature CHAIN KC793137_MHBs_P-B of FT:mat_peptide KC793137_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTTACLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLXFLXVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLXIFXCLWVYI
>gnl|hbvpro|KC793138_MHBs_P-B Product feature CHAIN KC793138_MHBs_P-B of FT:mat_peptide KC793138_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0491). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVXQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793139_MHBs_P-B Product feature CHAIN KC793139_MHBs_P-B of FT:mat_peptide KC793139_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0492). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLXDPRVRALYLPAGGSXSRTVSPAQNTVSAISSILSKXGDXVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMXLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLXPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793140_MHBs_P-B Product feature CHAIN KC793140_MHBs_P-B of FT:mat_peptide KC793140_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0493). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793143_MHBs_P-B Product feature CHAIN KC793143_MHBs_P-B of FT:mat_peptide KC793143_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0496). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793144_MHBs_P-B Product feature CHAIN KC793144_MHBs_P-B of FT:mat_peptide KC793144_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0497). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793145_MHBs_P-B Product feature CHAIN KC793145_MHBs_P-B of FT:mat_peptide KC793145_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0498). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLWTKI
LTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLXVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPKLCTILSPFVPLFPIFFCLWVYI
>gnl|hbvpro|KC793146_MHBs_P-B Product feature CHAIN KC793146_MHBs_P-B of FT:mat_peptide KC793146_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793147_MHBs_P-B Product feature CHAIN KC793147_MHBs_P-B of FT:mat_peptide KC793147_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0500). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCXTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSLAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793148_MHBs_P-B Product feature CHAIN KC793148_MHBs_P-B of FT:mat_peptide KC793148_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0501). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGGTXVCXGQNSQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|KC793150_MHBs_P-B Product feature CHAIN KC793150_MHBs_P-B of FT:mat_peptide KC793150_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0503). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793151_MHBs_P-B Product feature CHAIN KC793151_MHBs_P-B of FT:mat_peptide KC793151_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0504). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALXFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIXSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGXXPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLNPFIPLFPIFFCLWVYI
>gnl|hbvpro|KC793152_MHBs_P-B Product feature CHAIN KC793152_MHBs_P-B of FT:mat_peptide KC793152_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0505). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLSFLGETTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793153_MHBs_P-B Product feature CHAIN KC793153_MHBs_P-B of FT:mat_peptide KC793153_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0506). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793154_MHBs_P-B Product feature CHAIN KC793154_MHBs_P-B of FT:mat_peptide KC793154_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0507). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAXNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNTLNPFTPLLPIFXCLWVYI
>gnl|hbvpro|KC793155_MHBs_P-B Product feature CHAIN KC793155_MHBs_P-B of FT:mat_peptide KC793155_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0508). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPXPNMENIASGLXGPLLVLXAGFFLLTKI
LTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPXIPGSSTTSTGXCKXCTTPAQGTSMFPSCCCTKPTDGNXTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC793156_MHBs_P-B Product feature CHAIN KC793156_MHBs_P-B of FT:mat_peptide KC793156_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0509). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|KC793157_MHBs_P-B Product feature CHAIN KC793157_MHBs_P-B of FT:mat_peptide KC793157_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0510). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793158_MHBs_P-B Product feature CHAIN KC793158_MHBs_P-B of FT:mat_peptide KC793158_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0511). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLTKI
LTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNXLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC793159_MHBs_P-B Product feature CHAIN KC793159_MHBs_P-B of FT:mat_peptide KC793159_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0512). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGYFLLTKI
LTIPQSLDSWWTSLNFLGAIPGCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793160_MHBs_P-B Product feature CHAIN KC793160_MHBs_P-B of FT:mat_peptide KC793160_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0513). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWGFAKYLWEWASVRFSWLSLLVPFVQWCVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793161_MHBs_P-B Product feature CHAIN KC793161_MHBs_P-B of FT:mat_peptide KC793161_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0514). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRAXYFPAGGSSSGTVSPAQNTVSAXSSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFLCLWVYX
>gnl|hbvpro|KC793163_MHBs_P-B Product feature CHAIN KC793163_MHBs_P-B of FT:mat_peptide KC793163_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0516). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHHTLQDPRVRALYFPAGGSSSGTVSPAQTTVSAISSILSTTGDPVPNMENITSGLLGPLLVLQAGFFLLTKI
LTIPLSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|KC793164_MHBs_P-B Product feature CHAIN KC793164_MHBs_P-B of FT:mat_peptide KC793164_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0517). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSXIWMMWFWGPXLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC793165_MHBs_P-B Product feature CHAIN KC793165_MHBs_P-B of FT:mat_peptide KC793165_MHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EP0518). Partial genome (Contains: HBe, HBc, HBx, LH