HBVdb

Dataset for protein Pol of genotype B

[Download (right click)] [Alignment] [Repertoires]

2189 sequence(s)

>gnl|hbvpro|AB010289_Pol_P-B Product feature CHAIN AB010289_Pol_P-B of FT:mat_peptide AB010289_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIIDRCKQFVGPLTVNENRRLKIIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRSQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTWPQDHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB010290_Pol_P-B Product feature CHAIN AB010290_Pol_P-B of FT:mat_peptide AB010290_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPPQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGRAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLCHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLVSLGIHVNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIRQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACISAKQAFTFSPTYKAFLSQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB010291_Pol_P-B Product feature CHAIN AB010291_Pol_P-B of FT:mat_peptide AB010291_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGRAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLVSLGIHVNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIRQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACISAKQAFTFSPTYKAFLSQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB010292_Pol_P-B Product feature CHAIN AB010292_Pol_P-B of FT:mat_peptide AB010292_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYFPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVERHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACISAKQAFTFSPTYKAFLSQQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014366_Pol_P-B Product feature CHAIN AB014366_Pol_P-B of FT:mat_peptide AB014366_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 07D07HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSERHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSDHAVEFHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLCHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB031267_Pol_P-B Product feature CHAIN AB031267_Pol_P-B of FT:mat_peptide AB031267_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILSRSSVGPCIQSQLRKSRLGPQSTQGQLAGRQQGGS
GSIRARVHSSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAMELRHFSSNSSRSQSQGSV
PSCWWLQFRNSEPCSEYCLSHIINLLDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVSRLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB033554_Pol_P-B Product feature CHAIN AB033554_Pol_P-B of FT:mat_peptide AB033554_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFP
DIHLQEDIIDKCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSKRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB033555_Pol_P-B Product feature CHAIN AB033555_Pol_P-B of FT:mat_peptide AB033555_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRPVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFP
DIHLQEDIINRCNQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSAGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073821_Pol_P-B Product feature CHAIN AB073821_Pol_P-B of FT:mat_peptide AB073821_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSTWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILPGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPXTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073822_Pol_P-B Product feature CHAIN AB073822_Pol_P-B of FT:mat_peptide AB073822_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073823_Pol_P-B Product feature CHAIN AB073823_Pol_P-B of FT:mat_peptide AB073823_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSCCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRLEGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB073824_Pol_P-B Product feature CHAIN AB073824_Pol_P-B of FT:mat_peptide AB073824_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLPHGRLVFQTSKRHGDKSFCPQSPGILPGSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LPCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
QHLETLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFR
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073825_Pol_P-B Product feature CHAIN AB073825_Pol_P-B of FT:mat_peptide AB073825_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPAFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGRLVFQTSQRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSSPWRTVGVEPSGSGHTHNCASNSSSCLHQSAVRKAAYAHISTSKGHSSSGHAVELHHFPPSSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNLHN
ACSRNLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAXSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKTCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRTGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPSTGRTSLYEDSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073826_Pol_P-B Product feature CHAIN AB073826_Pol_P-B of FT:mat_peptide AB073826_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLYLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073827_Pol_P-B Product feature CHAIN AB073827_Pol_P-B of FT:mat_peptide AB073827_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGSQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEXHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPNTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073828_Pol_P-B Product feature CHAIN AB073828_Pol_P-B of FT:mat_peptide AB073828_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLFKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRXRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073829_Pol_P-B Product feature CHAIN AB073829_Pol_P-B of FT:mat_peptide AB073829_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGXTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPRKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVHRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073830_Pol_P-B Product feature CHAIN AB073830_Pol_P-B of FT:mat_peptide AB073830_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQXFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHVPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLIDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
YCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLHADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB073831_Pol_P-B Product feature CHAIN AB073831_Pol_P-B of FT:mat_peptide AB073831_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCLQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLXDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYIARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073832_Pol_P-B Product feature CHAIN AB073832_Pol_P-B of FT:mat_peptide AB073832_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVNIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFP
DIHLQEDIVDRCXQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSSPRGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHEVELPHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESVYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLEYRPTTGRTSLYADSPSVPFHLPDRVHFDSPLHVAWRPP
>gnl|hbvpro|AB073833_Pol_P-B Product feature CHAIN AB073833_Pol_P-B of FT:mat_peptide AB073833_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAHSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073834_Pol_P-B Product feature CHAIN AB073834_Pol_P-B of FT:mat_peptide AB073834_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVHRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073835_Pol_P-B Product feature CHAIN AB073835_Pol_P-B of FT:mat_peptide AB073835_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
EXTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDGKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073836_Pol_P-B Product feature CHAIN AB073836_Pol_P-B of FT:mat_peptide AB073836_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWKTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGLLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHPSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSPNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSLTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPRPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073837_Pol_P-B Product feature CHAIN AB073837_Pol_P-B of FT:mat_peptide AB073837_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLREDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARIHPSPWGTVGVEPSRSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTLETPHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073838_Pol_P-B Product feature CHAIN AB073838_Pol_P-B of FT:mat_peptide AB073838_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLHEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRISRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGSV
LPCWWLQFRNSKPCSEYCLCHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073839_Pol_P-B Product feature CHAIN AB073839_Pol_P-B of FT:mat_peptide AB073839_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQHAQGQLAGRQQGGS
GSIRARVHPSPWGIVGVEPSGSGPAHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGDHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGPT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYSCIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073840_Pol_P-B Product feature CHAIN AB073840_Pol_P-B of FT:mat_peptide AB073840_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIXNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVXDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVXRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQNHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073841_Pol_P-B Product feature CHAIN AB073841_Pol_P-B of FT:mat_peptide AB073841_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRCVFQTSKRHGDKSCCPQSPGILPRSSVGPSIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQNHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073842_Pol_P-B Product feature CHAIN AB073842_Pol_P-B of FT:mat_peptide AB073842_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSLVSTSKGHSSSGHTVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LFRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073843_Pol_P-B Product feature CHAIN AB073843_Pol_P-B of FT:mat_peptide AB073843_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRPSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLVSTSKGHSSSGHAVEFHNFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHH
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKVCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB073844_Pol_P-B Product feature CHAIN AB073844_Pol_P-B of FT:mat_peptide AB073844_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVDHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHICASSSSSCLHQSAVRKAAYSLVSTFEGHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073845_Pol_P-B Product feature CHAIN AB073845_Pol_P-B of FT:mat_peptide AB073845_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPFCPQSTGILPRSSAGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHFCASSSSSCLHQSAVREAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB073846_Pol_P-B Product feature CHAIN AB073846_Pol_P-B of FT:mat_peptide AB073846_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHHVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLVMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTEAYSLISTSKGHSSSGHAVELHHFPPNSARSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIRLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073847_Pol_P-B Product feature CHAIN AB073847_Pol_P-B of FT:mat_peptide AB073847_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVTHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGNGGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHVPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLXLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARRRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073848_Pol_P-B Product feature CHAIN AB073848_Pol_P-B of FT:mat_peptide AB073848_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLSKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNA
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073849_Pol_P-B Product feature CHAIN AB073849_Pol_P-B of FT:mat_peptide AB073849_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLXLLDDEAGPLEEELPRLADEGLNXRVAEDLNLGNPNVXIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLXEDIVDRCQQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSLCPQSPGILPRSSVGPCIQSQLRKSRLGPKPTQGQLAGRPQGGS
GSIRARVHPSPWGTXGVEPSGSGHTHISASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLVDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSXDSRIINHQHGXMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSXTYKAFLRHQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073850_Pol_P-B Product feature CHAIN AB073850_Pol_P-B of FT:mat_peptide AB073850_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPTQGQLAERPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRDVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVIADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB073851_Pol_P-B Product feature CHAIN AB073851_Pol_P-B of FT:mat_peptide AB073851_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLEPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSARSQSQGSV
PSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHS
SCSRKLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073852_Pol_P-B Product feature CHAIN AB073852_Pol_P-B of FT:mat_peptide AB073852_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLKEDIVDRCEQFVGPLTVNEKRRLKLIMPARFFPKGTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFFGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILSRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSSWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSHISTSKGHASSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGAFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073853_Pol_P-B Product feature CHAIN AB073853_Pol_P-B of FT:mat_peptide AB073853_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVDIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCQQFVGPLTANETRRLKLIMPARFYPKVTKYLPLXKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDESFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHTSSGHAVELHHFPPNSSRSQSKGSV
LSCWWLQFRNSEPCSEYCLSHIVNLLEDWGPCTEHGEHRIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
RVPWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSPNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLMSLGIHINPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFX
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAMNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073854_Pol_P-B Product feature CHAIN AB073854_Pol_P-B of FT:mat_peptide AB073854_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVDIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNERRRLKLVMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVIQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSKPCSEYCLCHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGXHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073855_Pol_P-B Product feature CHAIN AB073855_Pol_P-B of FT:mat_peptide AB073855_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVLQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPYRPTTGRTSLYADSPSVPSRQPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073857_Pol_P-B Product feature CHAIN AB073857_Pol_P-B of FT:mat_peptide AB073857_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICTSSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHQFPSNSSRSQSQSSV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGEVFLVDKNPHNTTESRLVVDFSQFSRGNN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB073858_Pol_P-B Product feature CHAIN AB073858_Pol_P-B of FT:mat_peptide AB073858_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGSLTANENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVLQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRVRVHPSPWGTVGVEPSGSGHTHFCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEDGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLIGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKLCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLRHQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB100695_Pol_P-B Product feature CHAIN AB100695_Pol_P-B of FT:mat_peptide AB100695_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPPFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQYGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LPCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIGQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPLPQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFL
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHVPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB106884_Pol_P-B Product feature CHAIN AB106884_Pol_P-B of FT:mat_peptide AB106884_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQGVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTAGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
PSCWWLQFRNSKPCSEHCLYHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKKAFTFSPTYKAFLRQQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPFHLPDRVHFASPLHVTWRPP
>gnl|hbvpro|AB115551_Pol_P-B Product feature CHAIN AB115551_Pol_P-B of FT:mat_peptide AB115551_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTSSASFCGSPYSWEQELQHGRLVFQTSNRHGYKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGRQQGGS
GSIRARVHPSPWGSVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRDSEPCSKYCLCHIVNLLEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACKQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTILYADSPSVSSLLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB117759_Pol_P-B Product feature CHAIN AB117759_Pol_P-B of FT:mat_peptide AB117759_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILSRSSVGPCIQSQLRKSRLGPQSTQGHLAGRQQGGS
GSIRARVHSSPWGSVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLVSTSTGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSKPLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHITKRWGYSLNFMGYVIGGWGSLPQEHIVPKINLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAQQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195933_Pol_P-B Product feature CHAIN AB195933_Pol_P-B of FT:mat_peptide AB195933_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSQRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHTSPWGTVGVEPSGSGTTHNGASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195934_Pol_P-B Product feature CHAIN AB195934_Pol_P-B of FT:mat_peptide AB195934_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSQRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVRTSPWGTVGVEPSGSGTTHNGASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195935_Pol_P-B Product feature CHAIN AB195935_Pol_P-B of FT:mat_peptide AB195935_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSQRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVRTSPWGTVGVEPSGSGTTHNGASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205119_Pol_P-B Product feature CHAIN AB205119_Pol_P-B of FT:mat_peptide AB205119_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQISKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGHTHNSASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNARIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRTGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSAPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205120_Pol_P-B Product feature CHAIN AB205120_Pol_P-B of FT:mat_peptide AB205120_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRRQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLPWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRTGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205121_Pol_P-B Product feature CHAIN AB205121_Pol_P-B of FT:mat_peptide AB205121_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFFPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAASRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKIPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFSFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYPDSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB205122_Pol_P-B Product feature CHAIN AB205122_Pol_P-B of FT:mat_peptide AB205122_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIIDRCQQFVGPLTVNEIRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCPQSTGILPRPSVGPCIQSQLRKSRLGPQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLNSTSKGHSSSGRAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVSRLSSNSRIINHQHRTMQNLHD
SRSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSPGIHLNPHKTKRWGYSLNFMGYVIGGWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTLLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB212625_Pol_P-B Product feature CHAIN AB212625_Pol_P-B of FT:mat_peptide AB212625_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEQAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCSPSSGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGRQQGGS
GSIWARVHSSPWGPVGVEPAGSGHTRNCASSTSSCLHQSAVRKAAYSLISTPKGHSSSGHAVELHRFPSNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLPLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPFHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB212626_Pol_P-B Product feature CHAIN AB212626_Pol_P-B of FT:mat_peptide AB212626_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTANEIRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHTSIRHGDKSFCPQSTGILPRSSVGPSIQSQLRKSRLGPQSTQGQLAGRQQGGSGSIRAR
VHPSPWGPVGLEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSVPSCWWL
QFRNSEPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGKTRVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHDSCSRNL
YGSLMLLYKTYGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
YAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLRTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVSPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPY
RPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB219426_Pol_P-B Product feature CHAIN AB219426_Pol_P-B of FT:mat_peptide AB219426_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=844 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGGLVFQTSKRHGDESFCPQSAGILSRSPVGPCIQSQLRQSRLGPQPTQGLLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASISSSCLHQSAGSKAAYSPVSTSKGHSSSGHAVELPHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYMHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPPX
>gnl|hbvpro|AB219427_Pol_P-B Product feature CHAIN AB219427_Pol_P-B of FT:mat_peptide AB219427_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCPQSAGILSRSPVGPCIQSQLRQSRLGPQPTQGLLAGLQQGGS
GSIRAGIHSTPWGTVGVESSSSGHTHNCASSSSSCLHQSAGSKAAYSPVSTAKGHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGTKSV
QHLESVYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB219428_Pol_C-B Product feature CHAIN AB219428_Pol_C-B of FT:mat_peptide AB219428_Pol_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSAGIFSRSPVGPCIQSQLRQSRLGPQPAQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGYTYNCASSSSSCLHQSAGSKAAYSPVSTSKGYSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB219429_Pol_P-B Product feature CHAIN AB219429_Pol_P-B of FT:mat_peptide AB219429_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGYNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCPQSAGILSRSPVGPCIQSQLRQSRLGPQPTQGLLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSISGHTHNCASSSSSCLHQSAGSKAAYSPVSTSKGHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSTDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDHQHRTMQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLTKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB219430_Pol_P-B Product feature CHAIN AB219430_Pol_P-B of FT:mat_peptide AB219430_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLKTSTRHGDKSFRPQSSGILSRAPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB231909_Pol_P-B Product feature CHAIN AB231909_Pol_P-B of FT:mat_peptide AB231909_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKSYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSIQGQLAGCQQGGS
GSIRARVHPSPWGLVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSKSQGSV
LSCWWLQFRNSEPCSEYRLCHIVNLLEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLAGSSGLSRYVARLSSNSRIINHQHWTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRISGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPYRPSTGRTSLYAVSPFVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB241117_Pol_P-B Product feature CHAIN AB241117_Pol_P-B of FT:mat_peptide AB241117_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCPQSAGILSRSPVGPCIQSQLRQSRLGPQPTQGLLAGLQQGGS
GSIRAGIHSTPRGTVGVEPSSSGHTHNCASSSSSCLHQSAGSKAAYSPVSTSKGHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRTRRTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246339_Pol_P-B Product feature CHAIN AB246339_Pol_P-B of FT:mat_peptide AB246339_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFSPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPVILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSI
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246340_Pol_P-B Product feature CHAIN AB246340_Pol_P-B of FT:mat_peptide AB246340_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSAPWGTDGVEPSGSGHTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPDSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246341_Pol_P-B Product feature CHAIN AB246341_Pol_P-B of FT:mat_peptide AB246341_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKATNSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
FSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGIMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPSTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246342_Pol_P-B Product feature CHAIN AB246342_Pol_P-B of FT:mat_peptide AB246342_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLHEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIPSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNSHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB246343_Pol_P-B Product feature CHAIN AB246343_Pol_P-B of FT:mat_peptide AB246343_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLHEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIPSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSKPCSEYCLSHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB287314_Pol_P-B Product feature CHAIN AB287314_Pol_P-B of FT:mat_peptide AB287314_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLQQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSYLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
PSCWWLQFRSSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLAIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287315_Pol_P-B Product feature CHAIN AB287315_Pol_P-B of FT:mat_peptide AB287315_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLQQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSYLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
PSCWWLQFRSSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIMSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLAIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287316_Pol_P-B Product feature CHAIN AB287316_Pol_P-B of FT:mat_peptide AB287316_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDESGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLQQSRLGPQPTQGQLAGRQQGGR
GSIRAGIHSAPWGTIGVEPSGSGHTHISASSSSSYLHQSPGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
PSCWWLQFRSSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDNVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVTRQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLAIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287317_Pol_P-B Product feature CHAIN AB287317_Pol_P-B of FT:mat_peptide AB287317_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQYFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTANEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTTKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAADSPFSTSTRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRSSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFL
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287318_Pol_P-B Product feature CHAIN AB287318_Pol_P-B of FT:mat_peptide AB287318_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTANENRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTTKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAHSPFSTSKRHSSSSHTVELPHVPPNSSTSQSQGSV
LSCWWLQFRSSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFL
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287319_Pol_P-B Product feature CHAIN AB287319_Pol_P-B of FT:mat_peptide AB287319_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTANENRRLKLIMPARFYPNTTKYFPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTTKRHGDKSFCPQSSGILSRSPVGPCLQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRSSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSTNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFL
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASSLHVAWRPP
>gnl|hbvpro|AB287320_Pol_P-B Product feature CHAIN AB287320_Pol_P-B of FT:mat_peptide AB287320_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLARRQQGGS
GSIRAGIHSSPRGIIGVEPPGSGHTDIFASSSSSCLHQSAGGEAAYAHFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLFHIVNLIDDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLTLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287321_Pol_P-B Product feature CHAIN AB287321_Pol_P-B of FT:mat_peptide AB287321_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGALEEELPRLADPDLNHRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCTQFVGPLTPNENRRLKMIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVCQTSKRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLARRQQGGS
GSIRAGIHSSPWGIIGVEPSGSGHTHLSASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRSFPHCLAFSYMDDVVLGAKSV
QHLEALYTAVTNFLLSLGVHLNPHKTKRWGYSLNFMGYEIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287322_Pol_P-B Product feature CHAIN AB287322_Pol_P-B of FT:mat_peptide AB287322_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVCQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLARRQQGGS
GSIRAGIHSPPWGIIGVEPSGSGHTHLSASSSSSCLHQSSGRKAAYSPLSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287323_Pol_P-B Product feature CHAIN AB287323_Pol_P-B of FT:mat_peptide AB287323_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCEQFVGPLTVNEKRRLNLVMPARFYPNTTKYFPLEKGIKPHYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVCQTSKRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLARRQQGGS
GSIRAGIHSSPWGIIGVEPSGSGHTHLSASSSSSCLHQSAGRKAAHSPFSTSKRHSSSSHAMELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNA
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRSFPHCMAFSYMDDVVLGAKSV
QHLEAIYTAVTNFLMSLGIHLNPHKTQRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287325_Pol_P-B Product feature CHAIN AB287325_Pol_P-B of FT:mat_peptide AB287325_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWRAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVCQTSKRHGDKSFRPQSSGILSRPPVGPCIQSQLRQSRLGPQPTQGQSVRRQQGGS
GSIRAGIHSSPWGIIGVEPSGSGHTHLSASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRDLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
HHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLYKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB287326_Pol_P-B Product feature CHAIN AB287326_Pol_P-B of FT:mat_peptide AB287326_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSL
LSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHI
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB287327_Pol_P-B Product feature CHAIN AB287327_Pol_P-B of FT:mat_peptide AB287327_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADAGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
DIHLQEDIVDRCKNFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVKLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHINPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB287328_Pol_P-B Product feature CHAIN AB287328_Pol_P-B of FT:mat_peptide AB287328_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFSPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPVILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSI
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB287329_Pol_P-B Product feature CHAIN AB287329_Pol_P-B of FT:mat_peptide AB287329_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB300364_Pol_P-B Product feature CHAIN AB300364_Pol_P-B of FT:mat_peptide AB300364_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB300371_Pol_P-B Product feature CHAIN AB300371_Pol_P-B of FT:mat_peptide AB300371_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient13). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQLFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLDFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSPISTSKGHSSSGHAVELYHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLYHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGIFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVTRLSYDTRIINNQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPVILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKICFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB302095_Pol_P-B Product feature CHAIN AB302095_Pol_P-B of FT:mat_peptide AB302095_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIIDRCKNFVGPLTVNENRRLKLIMPARFYPNGTKYLPLDKGIKPYYPNQVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVCQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSSWGTVGAEPSGSGHTHICASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGREVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCIGHIVNLIDDWGPCDEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRKLFDSLMLLYKTYGWKLHLYSHPIVMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLHAAVTNFLMSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB302942_Pol_P-B Product feature CHAIN AB302942_Pol_P-B of FT:mat_peptide AB302942_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSTPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNETRRLKLIMPARFYPKGTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHILWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSDSGPTNNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINHQHRNMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPFTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB302943_Pol_P-B Product feature CHAIN AB302943_Pol_P-B of FT:mat_peptide AB302943_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSTPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNETRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHILWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSDSGPTNNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINHQHRNMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB302944_Pol_P-B Product feature CHAIN AB302944_Pol_P-B of FT:mat_peptide AB302944_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSTPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNETRRLKLIMPARFYPKGTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHILWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSDSGPTNNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINHQHRNMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPFTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB302945_Pol_P-B Product feature CHAIN AB302945_Pol_P-B of FT:mat_peptide AB302945_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSTPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNETRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHILWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSDSGPTNNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINHQHRNMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB362933_Pol_P-B Product feature CHAIN AB362933_Pol_P-B of FT:mat_peptide AB362933_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVERCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLPHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIPSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSSSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHKHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLMSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYSCIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYARSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB365445_Pol_P-B Product feature CHAIN AB365445_Pol_P-B of FT:mat_peptide AB365445_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLVMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLPHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPVQGQLAGRQQGGS
GSIRARVHPSPWGTVGVESSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHAVELNNFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHN
ACSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB368295_Pol_P-B Product feature CHAIN AB368295_Pol_P-B of FT:mat_peptide AB368295_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNSDWQAPSFP
DIHLQEDIVNRCKQFVGPLTKNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGRQQGGS
GSIWARVHSSPWGPVGVEPSGSGHTRNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSPSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB471854_Pol_P-B Product feature CHAIN AB471854_Pol_P-B of FT:mat_peptide AB471854_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFCPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSPSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTEARLVVEFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIEGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLWYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB471855_Pol_P-B Product feature CHAIN AB471855_Pol_P-B of FT:mat_peptide AB471855_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSPSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLWYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB493827_Pol_P-B Product feature CHAIN AB493827_Pol_P-B of FT:mat_peptide AB493827_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGIVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSPSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB493833_Pol_P-B Product feature CHAIN AB493833_Pol_P-B of FT:mat_peptide AB493833_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRAPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSDNAVELHHVPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEHCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB493835_Pol_P-B Product feature CHAIN AB493835_Pol_P-B of FT:mat_peptide AB493835_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPNWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSAGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNGANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB555498_Pol_P-B Product feature CHAIN AB555498_Pol_P-B of FT:mat_peptide AB555498_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DNHKQENIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ESTGSASFYGSPFFWEQDLQHGRLVFQTSKRHGDKSCCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARFRPSTWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSQPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGKT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAEVVAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB555499_Pol_P-B Product feature CHAIN AB555499_Pol_P-B of FT:mat_peptide AB555499_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSSVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTGHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDESFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGSMAGRQQGGS
GSIRARVHPSPWGIVGVEPSGSGPTLICVSSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPLSSWAQSQGPV
LSCWWLQFRNSEPCSDYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLWYRPTTGRTSLFADSPSVPSHLPDRQHFASPLHVAWRPP
>gnl|hbvpro|AB642093_Pol_P-B Product feature CHAIN AB642093_Pol_P-B of FT:mat_peptide AB642093_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNPNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGXLVXQTSKRHGDKSXCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHPSPWGXVGVEPSGSGHTHNCASSSSSCLHQSAVRTAAYSLISTSKGHXSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSXLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSXDSRIINHQHGTMQNXHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIXLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDXVLGAKXX
QHLESLYAAVTNFLXSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKXKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALXPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB642094_Pol_P-B Product feature CHAIN AB642094_Pol_P-B of FT:mat_peptide AB642094_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKSYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPGSSVGSCIQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELNHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHB
YCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSTLNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB642101_Pol_P-B Product feature CHAIN AB642101_Pol_P-B of FT:mat_peptide AB642101_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT2009-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHRVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQENIVDRCQQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFYGSPYSWEQDLQHGRFVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPKSAQGQLAGRPQGGS
GSIWARVHPSPWGTGGVEPSGSGHTHIGASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHNFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSTNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRIINHQHGTMQDLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPXRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB675676_Pol_P-B Product feature CHAIN AB675676_Pol_P-B of FT:mat_peptide AB675676_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASNSTSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPSSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB713527_Pol_P-B Product feature CHAIN AB713527_Pol_P-B of FT:mat_peptide AB713527_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVRQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPLSTSKRHSSSGHAVELHHVPPNSSRSPSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSWNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSLVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPERVHFASLLHVARRTP
>gnl|hbvpro|AB713528_Pol_P-B Product feature CHAIN AB713528_Pol_P-B of FT:mat_peptide AB713528_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSISGHTHNCASSSSSCLHQSAVRKEAYSPVSTSKRHSSSGHAVELPQVPPNSSRSPSQGSV
LPCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINHQHRTMQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTRRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFSFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB713531_Pol_P-B Product feature CHAIN AB713531_Pol_P-B of FT:mat_peptide AB713531_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSPSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGRHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRACPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLRYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB713532_Pol_P-B Product feature CHAIN AB713532_Pol_P-B of FT:mat_peptide AB713532_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv132). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVRQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHHCASSSSSCLHQSAVRKEAYSPLSTSKRHSSSGHAVELHHVPPNSSRSPSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMAQLLVGSSGQIRYVARLSSNSRIINHQHRTMQNLHD
SCSWNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB828708_Pol_P-B Product feature CHAIN AB828708_Pol_P-B of FT:mat_peptide AB828708_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HB12-0626). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNXRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCTQFVGPLTVNEKRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHNHIGASCSSSCLHQSAVRKAAYSLISTSKGHSSSGRAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLX
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AB900095_Pol_P-B Product feature CHAIN AB900095_Pol_P-B of FT:mat_peptide AB900095_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKEFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQRQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICTSCSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900096_Pol_P-B Product feature CHAIN AB900096_Pol_P-B of FT:mat_peptide AB900096_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVDHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQSTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHNHISASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
PPCWWLQFRNSKPCSDYCLSHIVNLIEDWGPCDEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSPNSRIINHQHGTMQDLHN
SCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLETLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLSLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVTWRPP
>gnl|hbvpro|AB900097_Pol_P-B Product feature CHAIN AB900097_Pol_P-B of FT:mat_peptide AB900097_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYFPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRPVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSXSGHTHICASSSSSCLHQSAVRKAANSLISTSEGHXSSGHAVELHHFPPNSARSQSQGSV
PSCWWLQFRNSKPCSEYCICHIVNLIZDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSXNSRIINHQHGTMQDLHN
SCSRNLXVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLMSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKXKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB900098_Pol_P-B Product feature CHAIN AB900098_Pol_P-B of FT:mat_peptide AB900098_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDESICPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTRTCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSQPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900102_Pol_P-B Product feature CHAIN AB900102_Pol_P-B of FT:mat_peptide AB900102_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVGIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLKEDIVDRCKQFVGPLTANENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASNSSSCLHQSAVRKAAHSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCXEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGXKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900103_Pol_P-B Product feature CHAIN AB900103_Pol_P-B of FT:mat_peptide AB900103_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLKEDIVDRCEQFVGPLTVNEKRRFKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQFRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHIXASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELDHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSPNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB900104_Pol_P-B Product feature CHAIN AB900104_Pol_P-B of FT:mat_peptide AB900104_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGGLVFQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900105_Pol_P-B Product feature CHAIN AB900105_Pol_P-B of FT:mat_peptide AB900105_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGN
RSIRTRVHPSPWGTIGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSLISTSKGHPSSGHAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLSHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHD
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900106_Pol_P-B Product feature CHAIN AB900106_Pol_P-B of FT:mat_peptide AB900106_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSLNSTAKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVFWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQDLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGALPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900107_Pol_P-B Product feature CHAIN AB900107_Pol_P-B of FT:mat_peptide AB900107_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGSCIQSQLRKSRLGPQPTQGQLAGRPKGGS
GSIRARVHSPPWGTVGVEPSGPGHTHNCASSSTSCLHQSAVRKAAYSPISTSKGHSSSGHAVELHHFPPNSSRPQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPNNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLCSLGIHINPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900108_Pol_P-B Product feature CHAIN AB900108_Pol_P-B of FT:mat_peptide AB900108_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPDVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRPSVGPSIQSQLRKSRLGPQPTQGQLARRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSASSCLHQSAVRKAAYSLVSTSKGHSSSSHAVEFHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB900110_Pol_P-B Product feature CHAIN AB900110_Pol_P-B of FT:mat_peptide AB900110_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKGTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPRGTVGVEPSRSGSTHNCASSSSSCLHQSAVKEAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900111_Pol_P-B Product feature CHAIN AB900111_Pol_P-B of FT:mat_peptide AB900111_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNHRVAEDLNLGIDPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSF
PDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYK
RESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGG
SGSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGS
VLSCWWLQFRNSKPCSEYCLCHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGN
TRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIBHQHGTMQDLH
NSCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKT
VHHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLRQQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTF
VSPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900112_Pol_P-B Product feature CHAIN AB900112_Pol_P-B of FT:mat_peptide AB900112_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPVCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAANSLISTSKGHASSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCXSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLGSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRXSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB931168_Pol_P-B Product feature CHAIN AB931168_Pol_P-B of FT:mat_peptide AB931168_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKEFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHEVELHHFPPNSSGSQSQGSV
LSCWWLQFRNSKPCSEYCISHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSPDSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB931169_Pol_P-B Product feature CHAIN AB931169_Pol_P-B of FT:mat_peptide AB931169_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKEFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHEVELHHFPPNSSGSQSQGSV
LSCWWLQFRNSKPCSEYCISHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSPDSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB976562_Pol_P-B Product feature CHAIN AB976562_Pol_P-B of FT:mat_peptide AB976562_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPNWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNETRRLKLIMPARFYPRVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVEFHHVPPNSSRSSSQGSV
LSCWWLQFRNCEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAGVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVLKIKQCFRKIPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFG
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF100308_Pol_P-B Product feature CHAIN AF100308_Pol_P-B of FT:mat_peptide AF100308_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLTMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLSKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSRSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYSALMPLYACIQAKQAFTFSPTYKAFLSKQYVNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF100309_Pol_P-B Product feature CHAIN AF100309_Pol_P-B of FT:mat_peptide AF100309_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKGQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRAGVHPSPWGTVGVEPSGSGPTHNCANSASSCLHQSAVRKAAYSLISTSKGHSSSGRAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFL
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121243_Pol_P-B Product feature CHAIN AF121243_Pol_P-B of FT:mat_peptide AF121243_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWEAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|AF121244_Pol_P-B Product feature CHAIN AF121244_Pol_P-B of FT:mat_peptide AF121244_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWEAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|AF121245_Pol_P-B Product feature CHAIN AF121245_Pol_P-B of FT:mat_peptide AF121245_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWEAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|AF121246_Pol_P-B Product feature CHAIN AF121246_Pol_P-B of FT:mat_peptide AF121246_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWEAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|AF121247_Pol_P-B Product feature CHAIN AF121247_Pol_P-B of FT:mat_peptide AF121247_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHILWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRQSRLGPQPAQGQLAERQQGGS
GSIRARVHPSTWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLDSTSKGYSSSGHAVELHHVPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHX
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121248_Pol_P-B Product feature CHAIN AF121248_Pol_P-B of FT:mat_peptide AF121248_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRQSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLVSTSKGYSSSGHEVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121249_Pol_P-B Product feature CHAIN AF121249_Pol_P-B of FT:mat_peptide AF121249_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRQSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLVSTSKGYSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121250_Pol_P-B Product feature CHAIN AF121250_Pol_P-B of FT:mat_peptide AF121250_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLKQSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLVSTSKGYSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIKTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121251_Pol_P-B Product feature CHAIN AF121251_Pol_P-B of FT:mat_peptide AF121251_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCQQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSCCPQSPGILSRSSVGPCIQSQLRQSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLVSTSKGYSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRANT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF282917_Pol_P-B Product feature CHAIN AF282917_Pol_P-B of FT:mat_peptide AF282917_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSVSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHWTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVVRQRPGLCQVFRDATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF282918_Pol_P-B Product feature CHAIN AF282918_Pol_P-B of FT:mat_peptide AF282918_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSRSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFRDATPTGWGLPIGHQRMRGTFV
ALLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF461360_Pol_P-B Product feature CHAIN AF461360_Pol_P-B of FT:mat_peptide AF461360_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=836 residues).
MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGSGSIRARV
HPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSARSQSQGPVLSCWWLQ
FRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDTRVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHDSCSRNLY
VSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLY
AAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVSPLPIHT
AELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLSFR
PTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF479684_Pol_P-B Product feature CHAIN AF479684_Pol_P-B of FT:mat_peptide AF479684_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDGEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQGQLRKSRLGPQPAQGQLAGCQQGGS
GSIRARVHPFPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQCLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627225_Pol_P-B Product feature CHAIN AJ627225_Pol_P-B of FT:mat_peptide AJ627225_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCNQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVINHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLEPQPAQGQLAGRQQGGS
GSIRARXHPSPWGTVGVEPSGSGHTCNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011084_Pol_P-B Product feature CHAIN AP011084_Pol_P-B of FT:mat_peptide AP011084_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFKNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011085_Pol_P-B Product feature CHAIN AP011085_Pol_P-B of FT:mat_peptide AP011085_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHFLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011086_Pol_P-B Product feature CHAIN AP011086_Pol_P-B of FT:mat_peptide AP011086_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHXVGNFTGLYSSTVPGFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTPKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKAAYSPVSTSKGHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCIFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPMHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYISLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011087_Pol_P-B Product feature CHAIN AP011087_Pol_P-B of FT:mat_peptide AP011087_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGRLVFQTPKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKAAYSPVSTSKGHSSSGHAVEFHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCIFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPMHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011088_Pol_P-B Product feature CHAIN AP011088_Pol_P-B of FT:mat_peptide AP011088_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVFKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHSAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFIYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011089_Pol_P-B Product feature CHAIN AP011089_Pol_P-B of FT:mat_peptide AP011089_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPBWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAVRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSGSQSQGSV
FSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPSTGRTSLYADSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|AP011090_Pol_P-B Product feature CHAIN AP011090_Pol_P-B of FT:mat_peptide AP011090_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLYQSAVRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIALKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011091_Pol_P-B Product feature CHAIN AP011091_Pol_P-B of FT:mat_peptide AP011091_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLYQSAVRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGXLPQEHITLKIXQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011092_Pol_P-B Product feature CHAIN AP011092_Pol_P-B of FT:mat_peptide AP011092_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFSPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLHQSAVRKEAYSPVSASKRHSPSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALVPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011093_Pol_P-B Product feature CHAIN AP011093_Pol_P-B of FT:mat_peptide AP011093_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQNSKRHGEKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHAHNCANSSSSCLHQSAVRKEAYSPVSTSKRFSSSGHAVELHHVPPNSSRPQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAIYSVVRRAFPHCLAFSSMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFG
SPLPIHTAELLAACFARSRSGAKLVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011094_Pol_P-B Product feature CHAIN AP011094_Pol_P-B of FT:mat_peptide AP011094_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRDGIHSTPWGTVGVEPSSSGYAHNCANSSSSCLHQSAVRKAAYSPVSTSKRLSSSGHAVELHHVPPNSSRPQSQGSV
PSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIQQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011095_Pol_P-B Product feature CHAIN AP011095_Pol_P-B of FT:mat_peptide AP011095_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRDGIHSTPWGTVGVEPSSSGHAHNCANSSSSCLRQSAVRKAAYSPVSTSKRLSSSGHAVELHHVPPNSSRPQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKXCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011096_Pol_P-B Product feature CHAIN AP011096_Pol_P-B of FT:mat_peptide AP011096_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFP
DIHLQEDIVDKCKQFVGTLTVNENRRLKLIMPARFYPNVTKYLPLDKGXKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGILSRSSVGSCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRDGIHSTPWGTVGVEPSSSGHAHNCANSSSSCLHQSAVRKAAYSPVSTSKRLSSSGHAVELHHVPPNSSRPQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYIIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLNKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY033072_Pol_P-B Product feature CHAIN AY033072_Pol_P-B of FT:mat_peptide AY033072_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIADRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSIQGQLAGCQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGFPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY033073_Pol_P-B Product feature CHAIN AY033073_Pol_P-B of FT:mat_peptide AY033073_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIADRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSIQGQLAGCQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
FSCWWLQFRNSKPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHMYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYSDDMVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGFPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY163869_Pol_P-B Product feature CHAIN AY163869_Pol_P-B of FT:mat_peptide AY163869_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNVSIPWTHKVGNFTELYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAANSLISTSKGHSSSGHAVELHHVPQNSSRSQSQGPV
PSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHGNMQNLHD
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAEHLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY163870_Pol_P-B Product feature CHAIN AY163870_Pol_P-B of FT:mat_peptide AY163870_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNVSIPWTHKVGNFTELYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAANSLISTSKGHSSSGHAVELHHVPQNSSRSQSQGPV
PSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHGNMQNLHD
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAEHLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167089_Pol_P-B Product feature CHAIN AY167089_Pol_P-B of FT:mat_peptide AY167089_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRIRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167093_Pol_P-B Product feature CHAIN AY167093_Pol_P-B of FT:mat_peptide AY167093_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLHHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLDGRQQGGS
GSIRARGHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQPAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEYGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLDSLYAAVTNFLLSLGIHLNPHKTKRWGYCLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRTQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167094_Pol_P-B Product feature CHAIN AY167094_Pol_P-B of FT:mat_peptide AY167094_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLXEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQHAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHX
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167097_Pol_P-B Product feature CHAIN AY167097_Pol_P-B of FT:mat_peptide AY167097_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAERQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAGRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTWWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167098_Pol_P-B Product feature CHAIN AY167098_Pol_P-B of FT:mat_peptide AY167098_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAERQQGGS
GSIRARVHPSPWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167100_Pol_P-B Product feature CHAIN AY167100_Pol_P-B of FT:mat_peptide AY167100_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVLQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQHAQGQLAGRQQGGS
GSIRARVHPSTWGIVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKRHSSSGHALELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPYNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167101_Pol_P-B Product feature CHAIN AY167101_Pol_P-B of FT:mat_peptide AY167101_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167102_Pol_P-B Product feature CHAIN AY167102_Pol_P-B of FT:mat_peptide AY167102_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLEKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFFGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQXQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAHSLISTSKGHSSTGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGKHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
ACSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKKAFTFSPTYKAFLRKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206373_Pol_P-B Product feature CHAIN AY206373_Pol_P-B of FT:mat_peptide AY206373_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=834 residues).
KLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIV
DRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFC
GSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGSGSIRARVHP
STWGTVGVEPPGSGPIHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGRAVELHHFPPNSSRSQSQGPVLSCWWLQFR
NSEPCSEYCLSHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTRVSWPKFAV
PNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSCGLSRYVARLSSNSRIINNQHRTMQNLHNSCSRNLYVS
LMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESVYAA
VTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQC
GYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVSPLPIHTAE
LLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLLYRPT
TGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206375_Pol_P-B Product feature CHAIN AY206375_Pol_P-B of FT:mat_peptide AY206375_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRAGVHPSPWGTVGVEPSGSGPTHNCARSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHNFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKPHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIRKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFVFSPTYKSFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206383_Pol_P-B Product feature CHAIN AY206383_Pol_P-B of FT:mat_peptide AY206383_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRRLLLLEQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQPPSFP
DIHLREDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHILWKAGILYKR
ESTRSASFCGSPYSWEHDLQHGRLDFPTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGKS
GSIRARVHPSPWGTVGVEPAGSGPTHNCASSSSSCLHQSAVRKAAYSPISTSKGHSSSGHAVELNHFPPHSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGPL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLALGHQRVRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206390_Pol_P-B Product feature CHAIN AY206390_Pol_P-B of FT:mat_peptide AY206390_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFP
DIHLKEDIVDRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFFGSPYSWEHDLQHGRLVLQTSKRHGDKSFCPQSPGILPRPSVGPCIQSQLRKSRLGLQPAQGQLAGRQPGGS
GSIRARVHSAPWGTVGMEPSGSGHTYNCASSSSSCLHQSAVRKAAYSLISTSKGDSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNMHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIRLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLSACMQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY206391_Pol_P-B Product feature CHAIN AY206391_Pol_P-B of FT:mat_peptide AY206391_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
NIHLQEDIVDRCNQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGVLYKR
ESTRSASFCGSPYSWEQDLQHGRLAFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRESGLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTCNSASSSSSCLHQSAVRKAAYSLNSTSEGHASSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRVRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLRKQYLHLYPVSRQRAGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY217355_Pol_P-B Product feature CHAIN AY217355_Pol_P-B of FT:mat_peptide AY217355_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A6-2). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFFPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGHLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSGPIHNRASSSSSCHHQSAVRKAAYSLISTSKGHSSSGHAVELPHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY217356_Pol_P-B Product feature CHAIN AY217356_Pol_P-B of FT:mat_peptide AY217356_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFFPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGHLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSGPIHNRASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELPHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY217357_Pol_P-B Product feature CHAIN AY217357_Pol_P-B of FT:mat_peptide AY217357_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGNSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY217358_Pol_P-B Product feature CHAIN AY217358_Pol_P-B of FT:mat_peptide AY217358_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGNSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY217359_Pol_P-B Product feature CHAIN AY217359_Pol_P-B of FT:mat_peptide AY217359_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVRVEPSGSGHTHNCASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSRGPV
FSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPACVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPNKTKRWGDSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY217360_Pol_P-B Product feature CHAIN AY217360_Pol_P-B of FT:mat_peptide AY217360_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRIAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
FSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY217361_Pol_P-B Product feature CHAIN AY217361_Pol_P-B of FT:mat_peptide AY217361_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-2). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEHVVNHYSQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSLRARVHPSPWGTVGLEPSSSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLALSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY217362_Pol_P-B Product feature CHAIN AY217362_Pol_P-B of FT:mat_peptide AY217362_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWAHKVGNFTGLYSSTVPCFNPQWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTYNCASSSSSCLHQSAVREAAYSLISTSKGHSSSGHAVELHHFPPNSARSQSQGPV
RSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY217368_Pol_P-B Product feature CHAIN AY217368_Pol_P-B of FT:mat_peptide AY217368_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21949). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=836 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGGSGSIRARV
HPSSWGTVGVEPSRSGPTHNCASSFSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPVLSCWWLQ
FRNSEPCSEYCLGHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTRVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSSYVARLSSNSRIINNQHRTMQNLHDSCSRNLY
VSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLY
TAVTNFLFSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGNFVSPLPIHT
AELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLFYR
PTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY220697_Pol_P-B Product feature CHAIN AY220697_Pol_P-B of FT:mat_peptide AY220697_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPVQGQLAGRQQGGS
GSIRARVHPSPWGTVGLEPSGSGSTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFIFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY220698_Pol_P-B Product feature CHAIN AY220698_Pol_P-B of FT:mat_peptide AY220698_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSKYCLCHIVNLIENWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKICFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFIFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY220703_Pol_P-B Product feature CHAIN AY220703_Pol_P-B of FT:mat_peptide AY220703_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSICPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGSQQGGS
GNIRARVHPSPWGAVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGDSSSGHEVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY220704_Pol_P-B Product feature CHAIN AY220704_Pol_P-B of FT:mat_peptide AY220704_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGAVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHEVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY293309_Pol_P-B Product feature CHAIN AY293309_Pol_P-B of FT:mat_peptide AY293309_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGHLAGRQQGGS
GSIRARVHPSPWGTVEVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY518556_Pol_P-B Product feature CHAIN AY518556_Pol_P-B of FT:mat_peptide AY518556_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKEAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
ACSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY596102_Pol_P-B Product feature CHAIN AY596102_Pol_P-B of FT:mat_peptide AY596102_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVGKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY596103_Pol_P-B Product feature CHAIN AY596103_Pol_P-B of FT:mat_peptide AY596103_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASNSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY596104_Pol_P-B Product feature CHAIN AY596104_Pol_P-B of FT:mat_peptide AY596104_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQHAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY596105_Pol_P-B Product feature CHAIN AY596105_Pol_P-B of FT:mat_peptide AY596105_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIQARVHPSPWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY596106_Pol_P-B Product feature CHAIN AY596106_Pol_P-B of FT:mat_peptide AY596106_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRRASLCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY596109_Pol_P-B Product feature CHAIN AY596109_Pol_P-B of FT:mat_peptide AY596109_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
FCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRIRGTFV
SPLPIHTAELLAVCFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY596110_Pol_P-B Product feature CHAIN AY596110_Pol_P-B of FT:mat_peptide AY596110_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRPPVGPCIQSQLRKSRLGPQPAQGQLAGLQQGGN
RSIRARVRPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKATYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKTCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMQGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY596111_Pol_P-B Product feature CHAIN AY596111_Pol_P-B of FT:mat_peptide AY596111_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVELSDSGPTHNWSSSSSCLHQPGVRKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRSQSQGPVL
SCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHNF
CSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQ
HLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVS
PLPIHTAELLAVCFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY596112_Pol_P-B Product feature CHAIN AY596112_Pol_P-B of FT:mat_peptide AY596112_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLHHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLDGRQQGGS
GSIRARGHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQPAVRKATYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKTCFKKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY766463_Pol_P-B Product feature CHAIN AY766463_Pol_P-B of FT:mat_peptide AY766463_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
HIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVGKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGTI
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPITLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHRLAFSYMDDVVLGTKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLGKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYQPTTGRTSPYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY800389_Pol_P-B Product feature CHAIN AY800389_Pol_P-B of FT:mat_peptide AY800389_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQPFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
SVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVQGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY800391_Pol_P-B Product feature CHAIN AY800391_Pol_P-B of FT:mat_peptide AY800391_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLHEDIINRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFFGSPYSWEQELQHGRLVFKTSKRHGDESFCPQSSGILSRSPVGPCIQSQLRQSRLGSQPTQGQLAGLQQGGS
GSIRAGIHSTPRGTVGVEPSSSGHTHNCASCASSCLHQSAVRKAAYSPDSASKRHSSSGHAVELHHVPPNSSRSQGQGSV
LSCWWLQFRNCEPCSEHCLFQIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
ACSRKLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLYKQYVNLYPVARQRPGLCQVFADATPTGWGLAIGYQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY800392_Pol_P-B Product feature CHAIN AY800392_Pol_P-B of FT:mat_peptide AY800392_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLHEDIINRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFFGSPYSWEQELQHGRLVFKTSKRHGDESFCPQSSGILSRSPVGPCIQSQLRQSRLGSQPTQGQLAGLQQGGS
GSIRAGIHSTPRGTVGVEPSSSGHTHNCASCASSCLHQSAVRKAAYSPDSASKRHSSSGHAVELHHVPPNSSRSQGQGSV
LSCWWLQFRNCEPCSEHCLFQIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
ACSRKLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLYKQYVNLYPVARQRPGLCQVFADATPTGWGLAIGYQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|D00329_Pol_P-B Product feature CHAIN D00329_Pol_P-B of FT:mat_peptide D00329_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARIHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRTAAYSPISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTWPQDHIVQNFKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D00330_Pol_P-B Product feature CHAIN D00330_Pol_P-B of FT:mat_peptide D00330_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSSGILPRSSVGPCIQSQLRKSRLGPQPEQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLIPTSKGHSSSGHAVELHHFPPNSSRSRSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMWFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLTKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D00331_Pol_C-B Product feature CHAIN D00331_Pol_C-B of FT:mat_peptide D00331_Pol_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFP
DIHLQEDIINKCKQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIDDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTVELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D23678_Pol_P-B Product feature CHAIN D23678_Pol_P-B of FT:mat_peptide D23678_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKPFCPQSPGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGRPQGGS
GSIRARVHPSPWGIVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCDEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D23679_Pol_P-B Product feature CHAIN D23679_Pol_P-B of FT:mat_peptide D23679_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPTVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHSSSGRAVELRHFPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGAMQDLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D50521_Pol_P-B Product feature CHAIN D50521_Pol_P-B of FT:mat_peptide D50521_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDLIDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLEKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRSVFQTSKRHGDKSFCPQSPGILPRSSVGPCVQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCAEHGEHRIRIPRTPARVTGGVFLVDQNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVGRLSSNSRIINHQHGTMQDLHN
SCSKHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVPKIKLCFRKLPVNRPIDWKVCPRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D50522_Pol_P-B Product feature CHAIN D50522_Pol_P-B of FT:mat_peptide D50522_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDLIDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLEKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRSVFQTSKRHGDKSFCPQSPGILPRSSVGPCVQSQLRKSRLGPQPTQGQLAGRPQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCAEHGEHRIRIPRTPARVTGGVFLVDQNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVGRLSPNSRIINHQHGTMQDLHN
SCSRHLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVPKIKLCFRKLPVNRPIDWKVCPRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ377158_Pol_P-B Product feature CHAIN DQ377158_Pol_P-B of FT:mat_peptide DQ377158_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTNNCASNSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448619_Pol_P-B Product feature CHAIN DQ448619_Pol_P-B of FT:mat_peptide DQ448619_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GCIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPL
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448620_Pol_P-B Product feature CHAIN DQ448620_Pol_P-B of FT:mat_peptide DQ448620_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPGTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448621_Pol_P-B Product feature CHAIN DQ448621_Pol_P-B of FT:mat_peptide DQ448621_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448622_Pol_P-B Product feature CHAIN DQ448622_Pol_P-B of FT:mat_peptide DQ448622_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGLCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGSFM
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448623_Pol_P-B Product feature CHAIN DQ448623_Pol_P-B of FT:mat_peptide DQ448623_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQPGGS
GSIRARVHPSPWGTVGVESSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKICFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448624_Pol_P-B Product feature CHAIN DQ448624_Pol_P-B of FT:mat_peptide DQ448624_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448625_Pol_P-B Product feature CHAIN DQ448625_Pol_P-B of FT:mat_peptide DQ448625_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLRHGSLAFPTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFIYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448626_Pol_P-B Product feature CHAIN DQ448626_Pol_P-B of FT:mat_peptide DQ448626_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPGTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHKCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448627_Pol_P-B Product feature CHAIN DQ448627_Pol_P-B of FT:mat_peptide DQ448627_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQLAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQYRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFIYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ448628_Pol_P-B Product feature CHAIN DQ448628_Pol_P-B of FT:mat_peptide DQ448628_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGKLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSKSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463787_Pol_P-B Product feature CHAIN DQ463787_Pol_P-B of FT:mat_peptide DQ463787_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSVCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPVSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLMSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463788_Pol_P-B Product feature CHAIN DQ463788_Pol_P-B of FT:mat_peptide DQ463788_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCQQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSHAMELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463789_Pol_P-B Product feature CHAIN DQ463789_Pol_P-B of FT:mat_peptide DQ463789_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNVSIPWTHKVGNFAGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQQLHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHSHICASSSSSCLHQSAGRKAAYSSFSASKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSKYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463790_Pol_P-B Product feature CHAIN DQ463790_Pol_P-B of FT:mat_peptide DQ463790_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCEQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSEGRKAAYSPFSASKRHSSSSHAMELHHVPPNSSRSQSQGSV
PSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHPLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKFTSFPWLLGCAANWILRGTSFVYVPSKLNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463791_Pol_P-B Product feature CHAIN DQ463791_Pol_P-B of FT:mat_peptide DQ463791_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQPPAFP
NIHLQENIIDRCEQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSSFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIIDHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSPLNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463792_Pol_P-B Product feature CHAIN DQ463792_Pol_P-B of FT:mat_peptide DQ463792_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDTDAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCQQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGTPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSHFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYSNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSPLNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463793_Pol_P-B Product feature CHAIN DQ463793_Pol_P-B of FT:mat_peptide DQ463793_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCQQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHPHISASSSSSCLRQSAGRKAAYSPFSTAKRHSSSSRAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLSHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKLYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463794_Pol_P-B Product feature CHAIN DQ463794_Pol_P-B of FT:mat_peptide DQ463794_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQQLHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPFSTSKRLSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRDSEPCSKYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGTT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVAKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463795_Pol_P-B Product feature CHAIN DQ463795_Pol_P-B of FT:mat_peptide DQ463795_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNETRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDESVCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQRQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPVSTSKRHSSSSHAVEFHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTVQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLCTAVSNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWIRRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463796_Pol_P-B Product feature CHAIN DQ463796_Pol_P-B of FT:mat_peptide DQ463796_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCQQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASNSSSCLHQSAGRKAAYSHFSTSKRHSSSSHAMELHHVPPNSSRSQSQGSV
PSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSKLNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463797_Pol_P-B Product feature CHAIN DQ463797_Pol_P-B of FT:mat_peptide DQ463797_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNVSIPWTHKVGNFAGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQQLHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHSHICASSSSSCLHQSAGRKAAYSSFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAIPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSA
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463798_Pol_P-B Product feature CHAIN DQ463798_Pol_P-B of FT:mat_peptide DQ463798_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCEQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPSVQSQLRQSRLGPQPTQRQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSACLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYSSFPWLLGCAANWILRGMSFVYVPSALNPADDPSRGRLGLYRP
ILRQPFRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463799_Pol_P-B Product feature CHAIN DQ463799_Pol_P-B of FT:mat_peptide DQ463799_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCTQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTNISASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTHFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPLHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSPLNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463800_Pol_P-B Product feature CHAIN DQ463800_Pol_P-B of FT:mat_peptide DQ463800_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGTPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYSNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463801_Pol_P-B Product feature CHAIN DQ463801_Pol_P-B of FT:mat_peptide DQ463801_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCQQFVGPLTVNENRRLKMIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHPHISASSSSSCLRQSAGRKAAYSPFSTAKRHSSSSRAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLSHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKLYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ463802_Pol_P-B Product feature CHAIN DQ463802_Pol_P-B of FT:mat_peptide DQ463802_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCQQFVGPLTVNETRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGVLYKR
ESTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPKSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPFSTSKRLSSSSHAVEFHHVPPNSSRFHSQDSE
PSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVAKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ904357_Pol_P-B Product feature CHAIN DQ904357_Pol_P-B of FT:mat_peptide DQ904357_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPEILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNASRSQSQGPV
PSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYTAVTNFLLSLGVHINPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ975271_Pol_P-B Product feature CHAIN DQ975271_Pol_P-B of FT:mat_peptide DQ975271_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASGSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPDSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLNVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGPL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSSPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993680_Pol_P-B Product feature CHAIN DQ993680_Pol_P-B of FT:mat_peptide DQ993680_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYEDFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
EXTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993681_Pol_P-B Product feature CHAIN DQ993681_Pol_P-B of FT:mat_peptide DQ993681_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGDFAGLYSSMVPNFNPDWQTPSFP
DIHLQEDIVDRCKHFVGPLTVNEIRRLKLIMPARFYPDVTKYLPLDRGIQPYYPGHVGDHYFQTRHHLHTLWEVGILYKR
EXTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993683_Pol_P-B Product feature CHAIN DQ993683_Pol_P-B of FT:mat_peptide DQ993683_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDLVDRCKQFVGPLTVNENRRIKLIMPARFYPSVTKYLPLDKGINPYYPERVVNHYFQTRHYLHTLWKAGILYKR
EXTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSVGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993684_Pol_P-B Product feature CHAIN DQ993684_Pol_P-B of FT:mat_peptide DQ993684_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDGCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGHLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
FSCWWLQFRNSESCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKIPHNTTESRLVVDFSQFSRGNT
RVSWPKFPVPNLQSLTNLLSSRLSWLSPDVSAGFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGSLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993685_Pol_P-B Product feature CHAIN DQ993685_Pol_P-B of FT:mat_peptide DQ993685_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
EXTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993686_Pol_P-B Product feature CHAIN DQ993686_Pol_P-B of FT:mat_peptide DQ993686_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEEIVDRCKQFVGPLTVNEIRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
EXTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQDLHN
SCSKPLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGSLPQEHIVQKIKTCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993697_Pol_P-B Product feature CHAIN DQ993697_Pol_P-B of FT:mat_peptide DQ993697_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLFKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993698_Pol_P-B Product feature CHAIN DQ993698_Pol_P-B of FT:mat_peptide DQ993698_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQKLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTSV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993699_Pol_P-B Product feature CHAIN DQ993699_Pol_P-B of FT:mat_peptide DQ993699_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQKLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIPAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993700_Pol_P-B Product feature CHAIN DQ993700_Pol_P-B of FT:mat_peptide DQ993700_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQYVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVEDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ993701_Pol_P-B Product feature CHAIN DQ993701_Pol_P-B of FT:mat_peptide DQ993701_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQYVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWEAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYTAVTNFLVSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993702_Pol_P-B Product feature CHAIN DQ993702_Pol_P-B of FT:mat_peptide DQ993702_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWEAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHGMELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAEFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFHHCLAFSYVDDVVLGAKSV
QHLESLYTAVTNFLVSLGIPLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSMSGAKLIGTDNSVVLSRKYTSFLWLLGCAANWILRGTSFVYVPSALNPPYYPSRGSLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993703_Pol_P-B Product feature CHAIN DQ993703_Pol_P-B of FT:mat_peptide DQ993703_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASNSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993704_Pol_P-B Product feature CHAIN DQ993704_Pol_P-B of FT:mat_peptide DQ993704_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLYYQHFRKLLLLDEQAGPLEKELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARRQQGGS
GSIRARVHPSPWGIVGMEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGNFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSTLNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993705_Pol_P-B Product feature CHAIN DQ993705_Pol_P-B of FT:mat_peptide DQ993705_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARRQQGGS
GSIRARVHPSPWGIVGMEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPYLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGNFV
SPLPIHTAELLAACFARSKSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993706_Pol_P-B Product feature CHAIN DQ993706_Pol_P-B of FT:mat_peptide DQ993706_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARRQQGGS
GSIRARVHPSPWGIVGMEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGNFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993707_Pol_P-B Product feature CHAIN DQ993707_Pol_P-B of FT:mat_peptide DQ993707_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLEEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARRQQGGS
GSIRARVHPSPWGIVGMEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGNFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993708_Pol_P-B Product feature CHAIN DQ993708_Pol_P-B of FT:mat_peptide DQ993708_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYFPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHERLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARIHPSPWGPVGVEPSGSGPTPNCASSSSSCLHQSAVRKATYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIAGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSNQYLNLYPVVRQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993709_Pol_P-B Product feature CHAIN DQ993709_Pol_P-B of FT:mat_peptide DQ993709_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGAVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIAGLL
GFAAPFTQCGYPALMPLYVCIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993710_Pol_P-B Product feature CHAIN DQ993710_Pol_P-B of FT:mat_peptide DQ993710_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHILWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIAHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ993711_Pol_P-B Product feature CHAIN DQ993711_Pol_P-B of FT:mat_peptide DQ993711_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGTLNVRIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLXEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSADMKEGYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMTHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
TPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLMYQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ995801_Pol_P-B Product feature CHAIN DQ995801_Pol_P-B of FT:mat_peptide DQ995801_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLEKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGCQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAANSLISTSKGHSSSGHAVELHHFPPNSPRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLPSNSRIINNQHRTMQDLHS
SCSRNLYVSLMLLCKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPTLMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFVSPLHVAWRPP
>gnl|hbvpro|DQ995802_Pol_P-B Product feature CHAIN DQ995802_Pol_P-B of FT:mat_peptide DQ995802_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQPPSFL
DIHLREDIVDRCKQFVGPLTLNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPENVVNHYFQTRHYLQILWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQHAQGQLAGSQQGGS
GSIWARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSPDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSSICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLREQYLNLYPVVRQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLHRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ995803_Pol_P-B Product feature CHAIN DQ995803_Pol_P-B of FT:mat_peptide DQ995803_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C265-15). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPAGFYPNGTKYFPLDKGIKPHYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARGHSSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRRAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIAGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLTPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLCRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ995804_Pol_P-B Product feature CHAIN DQ995804_Pol_P-B of FT:mat_peptide DQ995804_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
NIHLQEDIVDRCEQFVGPLAVNEKGRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHSSPWGTVGGEPSGPGHIHHCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHQVPPNSSRSQSQGPV
HSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSRFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTHSLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF134945_Pol_P-B Product feature CHAIN EF134945_Pol_P-B of FT:mat_peptide EF134945_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTAKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARFHPSPWGTVGVEPSGSGHTHNCASSSSSCLYQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSKNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFIYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF134946_Pol_P-B Product feature CHAIN EF134946_Pol_P-B of FT:mat_peptide EF134946_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTAKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARFHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSKNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNLMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFIYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF473971_Pol_P-B Product feature CHAIN EF473971_Pol_P-B of FT:mat_peptide EF473971_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVESSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHILLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYEDSPAVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF473972_Pol_P-B Product feature CHAIN EF473972_Pol_P-B of FT:mat_peptide EF473972_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGRLVLQTSTRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHKCANSSSSCLHQSAVRKEAYSPVSASKRHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF473973_Pol_P-B Product feature CHAIN EF473973_Pol_P-B of FT:mat_peptide EF473973_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRPVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRAGIHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKRHSSSGHAMELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPVDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF473974_Pol_P-B Product feature CHAIN EF473974_Pol_P-B of FT:mat_peptide EF473974_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVLQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARIHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RGSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYAVVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACLARIRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF473975_Pol_P-B Product feature CHAIN EF473975_Pol_P-B of FT:mat_peptide EF473975_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSKVPCFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRAGIHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSDPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF473976_Pol_P-B Product feature CHAIN EF473976_Pol_P-B of FT:mat_peptide EF473976_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLHQSAVRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAEFYHLPLHPAAMPHVLVGSSGLSRYVARLSSNSRIIHHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIALKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF473977_Pol_P-B Product feature CHAIN EF473977_Pol_P-B of FT:mat_peptide EF473977_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQFRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVFKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF494380_Pol_P-B Product feature CHAIN EF494380_Pol_P-B of FT:mat_peptide EF494380_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSKVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRSVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGMEPSGSGHTHNCASSSSSCLHQSTVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
FSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLRLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF494381_Pol_P-B Product feature CHAIN EF494381_Pol_P-B of FT:mat_peptide EF494381_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFAGLYSSTVPCFNPEWQTPSFP
NIHLQEDIVDGCKQFVGPLTVNENRRLKLIMPARFYPKVTKYFPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRVVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGHLAGRQRGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRETAYSRISTSKGNSSSGHTVELNHFPPNSSRSQSQGPV
LSCWWLQFRNSKPCSEYCLCHIVNLIDDWGPCTEHGEHSIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRELHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU139543_Pol_P-B Product feature CHAIN EU139543_Pol_P-B of FT:mat_peptide EU139543_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSCSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYHPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU158262_Pol_P-B Product feature CHAIN EU158262_Pol_P-B of FT:mat_peptide EU158262_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G116). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFFGSPYSWEQDLQHGRLVVQTSKRHGDKSLCPQSPGILPRSSVGPRIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGPV
LSCWWLQFRNSKPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
XPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPXRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU158263_Pol_P-B Product feature CHAIN EU158263_Pol_P-B of FT:mat_peptide EU158263_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFP
DIHLQEDIVDRCSQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGSQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU305547_Pol_P-B Product feature CHAIN EU305547_Pol_P-B of FT:mat_peptide EU305547_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSRRHGDKSFCPQSSGILPRSSVGPCIQSQLKKSRLGPQPAQGQLAGRQQGGS
GRIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLRFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDDQHRTMQNLHN
SCSRNLYVSLMLLCKTYERKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLSSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU305548_Pol_P-B Product feature CHAIN EU305548_Pol_P-B of FT:mat_peptide EU305548_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306677_Pol_P-B Product feature CHAIN EU306677_Pol_P-B of FT:mat_peptide EU306677_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPAHNCASSPSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVPAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHI
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306678_Pol_P-B Product feature CHAIN EU306678_Pol_P-B of FT:mat_peptide EU306678_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPAHNCASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHI
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306679_Pol_P-B Product feature CHAIN EU306679_Pol_P-B of FT:mat_peptide EU306679_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPAHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIRLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLDLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306680_Pol_P-B Product feature CHAIN EU306680_Pol_P-B of FT:mat_peptide EU306680_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPAHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIRLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLDLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306681_Pol_P-B Product feature CHAIN EU306681_Pol_P-B of FT:mat_peptide EU306681_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPAHNCASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHI
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMYFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTGNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306695_Pol_P-B Product feature CHAIN EU306695_Pol_P-B of FT:mat_peptide EU306695_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTNNCASNSSSCLHQSAVRKAAYSHISTFKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU306696_Pol_P-B Product feature CHAIN EU306696_Pol_P-B of FT:mat_peptide EU306696_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTNNCASNSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGEGLSPFLLAQFTSAIRSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU306697_Pol_P-B Product feature CHAIN EU306697_Pol_P-B of FT:mat_peptide EU306697_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTNNCASNSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU306699_Pol_P-B Product feature CHAIN EU306699_Pol_P-B of FT:mat_peptide EU306699_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNQHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLARFTSAICSVVRRAFPHCLAPSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306700_Pol_P-B Product feature CHAIN EU306700_Pol_P-B of FT:mat_peptide EU306700_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWAHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRTRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306701_Pol_P-B Product feature CHAIN EU306701_Pol_P-B of FT:mat_peptide EU306701_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306702_Pol_P-B Product feature CHAIN EU306702_Pol_P-B of FT:mat_peptide EU306702_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKRIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKTCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306703_Pol_P-B Product feature CHAIN EU306703_Pol_P-B of FT:mat_peptide EU306703_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVAGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLVVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306704_Pol_P-B Product feature CHAIN EU306704_Pol_P-B of FT:mat_peptide EU306704_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRRYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIRSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYPLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKMPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQELIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306705_Pol_P-B Product feature CHAIN EU306705_Pol_P-B of FT:mat_peptide EU306705_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPRCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306706_Pol_P-B Product feature CHAIN EU306706_Pol_P-B of FT:mat_peptide EU306706_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306707_Pol_P-B Product feature CHAIN EU306707_Pol_P-B of FT:mat_peptide EU306707_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRAAEDLNLGNLNVSIPWTHKVGNFTGLHSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQVLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKMPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306708_Pol_P-B Product feature CHAIN EU306708_Pol_P-B of FT:mat_peptide EU306708_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFGYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306709_Pol_P-B Product feature CHAIN EU306709_Pol_P-B of FT:mat_peptide EU306709_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSRGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVVRQRPGLCQVFADATPTGWGSAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306710_Pol_P-B Product feature CHAIN EU306710_Pol_P-B of FT:mat_peptide EU306710_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNGEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306711_Pol_P-B Product feature CHAIN EU306711_Pol_P-B of FT:mat_peptide EU306711_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNREPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRINNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306712_Pol_P-B Product feature CHAIN EU306712_Pol_P-B of FT:mat_peptide EU306712_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU330989_Pol_P-B Product feature CHAIN EU330989_Pol_P-B of FT:mat_peptide EU330989_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVINHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFETSKRHGDKSFCPQSSGIPSRSPVGPCIQSQLRQSRLGPQPIQGYLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHAHNCANSSSSCLHQSAGRKAAYSPVSTSKRYSSAGHAVELHHVPPNSSRSKSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIISHQHRTMQNLHD
SCSRNLYVSLVLLYKTYGRKLHLYSHPIILGFRKTPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGGWGTLPQEHIVWKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU330990_Pol_P-B Product feature CHAIN EU330990_Pol_P-B of FT:mat_peptide EU330990_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVINHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFETSKRHGDKSFCPQSSGIPSRSPVGPCIQSQLRQSRLGPQPIQGYLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHAHNCANSSSSCLHQSAGRKAAYSPVSTSKRYSSAGHAVELHHVPPNSSRSKSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIISHQHRTMQNLHD
SCSRNLYVSLVLLYKTYGRKLHLYSHPIILGFRKTPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGGWGTLPQEHIVWKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU330995_Pol_P-B Product feature CHAIN EU330995_Pol_P-B of FT:mat_peptide EU330995_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFETSKRHGDKSFCPQSSGIPSRSPVGPCIQSQLRQSRLGPQPIQGYLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAGRKAAYSPVSTSKRYSSAGHAVELHHVPPNSSRSKSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDRNPHNTTEPRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYVDDMVLGAKSV
QHLESLYAAVANFLLSLGIHLNPHKTKRWGYSLNFMGYIIGGWGTLPQEHIVWKIKQCFRKLPTNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU330996_Pol_P-B Product feature CHAIN EU330996_Pol_P-B of FT:mat_peptide EU330996_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFETSKRHGDKSFCPQSSGIPSRSPVGPCIQSQLRQSRLGPQPIQGYLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAGRKAAYSPVSTSKRYSSAGHAVELHHVPPNSSRSKSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGGWGTLPQEHIVWKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU330997_Pol_P-B Product feature CHAIN EU330997_Pol_P-B of FT:mat_peptide EU330997_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFP
DIHLQEDIVNRCQQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFETSKRHGDKSFCPQSSGIPSRSPVGPCIQSQLRQSRLGPQPIQGYLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAGRKAAYSPVSTSKRYSSAGHAVELHHVPPNSSRSKSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGGWGTLPQEHIVWKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAVGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPPHVAWRPP
>gnl|hbvpro|EU439018_Pol_P-B Product feature CHAIN EU439018_Pol_P-B of FT:mat_peptide EU439018_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPIWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLGKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU439020_Pol_P-B Product feature CHAIN EU439020_Pol_P-B of FT:mat_peptide EU439020_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPIWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGINPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GGIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHRFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYSLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFGYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU439021_Pol_P-B Product feature CHAIN EU439021_Pol_P-B of FT:mat_peptide EU439021_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNASIPWTHKVGNFTGLYSSTVPCFNPMWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGGKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVKPSGSGPTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNSLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLCACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU439022_Pol_P-B Product feature CHAIN EU439022_Pol_P-B of FT:mat_peptide EU439022_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPMWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFHHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKPHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGYAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU439023_Pol_P-B Product feature CHAIN EU439023_Pol_P-B of FT:mat_peptide EU439023_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPIWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCRSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYAARLSSNSRTINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGMAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU487256_Pol_P-B Product feature CHAIN EU487256_Pol_P-B of FT:mat_peptide EU487256_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVLQTAKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARGHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSEGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
YCSRNLFVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU487257_Pol_P-B Product feature CHAIN EU487257_Pol_P-B of FT:mat_peptide EU487257_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKRHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU522067_Pol_P-B Product feature CHAIN EU522067_Pol_P-B of FT:mat_peptide EU522067_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQIPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAIRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSI
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU522072_Pol_P-B Product feature CHAIN EU522072_Pol_P-B of FT:mat_peptide EU522072_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFP
DIHLQEDIVDRCKQFVGPLTENETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSSGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKEHSSSDHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRDSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGVHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLREQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU522074_Pol_P-B Product feature CHAIN EU522074_Pol_P-B of FT:mat_peptide EU522074_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLAKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSSGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRDSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGVHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU547563_Pol_P-B Product feature CHAIN EU547563_Pol_P-B of FT:mat_peptide EU547563_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GCIRARVHPSPWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVERHHVPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU564822_Pol_P-B Product feature CHAIN EU564822_Pol_P-B of FT:mat_peptide EU564822_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCAISSSSCLHQSAVRKAAYSLNSTSKGNSSSGHAVERHHFPPNSSRSQSQGPV
LSCWWLQFRNSKPCSEYCLSHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU564823_Pol_P-B Product feature CHAIN EU564823_Pol_P-B of FT:mat_peptide EU564823_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCAISSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYQPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU564824_Pol_P-B Product feature CHAIN EU564824_Pol_P-B of FT:mat_peptide EU564824_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCAISSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYQPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU564826_Pol_P-B Product feature CHAIN EU564826_Pol_P-B of FT:mat_peptide EU564826_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFP
DIHLKEDIVDRCEQFVGPLTVNERRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVRPSPWGTVGAEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPQNSSRSQSQGPE
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLMYRPTTGRTSLYADSPSVPSHLPARVHFASPLHVAWKPP
>gnl|hbvpro|EU570069_Pol_P-B Product feature CHAIN EU570069_Pol_P-B of FT:mat_peptide EU570069_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKLYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVREAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRELHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLSIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQVKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALYPADDPSRGRLGLYRP
LLRLLYRPTSGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU570070_Pol_P-B Product feature CHAIN EU570070_Pol_P-B of FT:mat_peptide EU570070_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVREAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQVKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVNVPSALNPADDPSRGRLGLYRP
LLRLLYRPTSGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU570071_Pol_P-B Product feature CHAIN EU570071_Pol_P-B of FT:mat_peptide EU570071_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVREAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQVKQAFTFSPTYKAFLSKQYPNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTSGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU570075_Pol_P-B Product feature CHAIN EU570075_Pol_P-B of FT:mat_peptide EU570075_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARFYPKATKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSRRHGDKSFCPQSPGILPLSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPAHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHSVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVDNEHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIRMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLHLYPAARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTPLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU579441_Pol_P-B Product feature CHAIN EU579441_Pol_P-B of FT:mat_peptide EU579441_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRKLRLIMPARFYPNATKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSRRHGDKSFCPQSPGILPLSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHSVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLPVGSSGLSRYVARLSSNSRIVDNEHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
HHLESLYAAVTTFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU589335_Pol_P-B Product feature CHAIN EU589335_Pol_P-B of FT:mat_peptide EU589335_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEKRRLNLIMPARFYPNDTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPLSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHSVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVDNEHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
HHLESLYAAVTTFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU595031_Pol_P-B Product feature CHAIN EU595031_Pol_P-B of FT:mat_peptide EU595031_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISASKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQYRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLFSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAASWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU796066_Pol_P-B Product feature CHAIN EU796066_Pol_P-B of FT:mat_peptide EU796066_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIWARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLALGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHAAWKPP
>gnl|hbvpro|EU796067_Pol_P-B Product feature CHAIN EU796067_Pol_P-B of FT:mat_peptide EU796067_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIWARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIGDWGPCTEHGEHRIRTPRTPARVTGGAFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVAWQRPGLCQVFADATPTGWGLALGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWVLRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU796068_Pol_P-B Product feature CHAIN EU796068_Pol_P-B of FT:mat_peptide EU796068_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQENIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHIHNCASSSSSCLHQSAVRKAAYSLVSTSKGHSSSGHAVELHHFPPNSSRSQSQGTV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPAGDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU881997_Pol_P-B Product feature CHAIN EU881997_Pol_P-B of FT:mat_peptide EU881997_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNESRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLDFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCRHQSAVRKAAYSLISTSKGHSSSGHAVELHRFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU881998_Pol_P-B Product feature CHAIN EU881998_Pol_P-B of FT:mat_peptide EU881998_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNESRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLDFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCRHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU882002_Pol_P-B Product feature CHAIN EU882002_Pol_P-B of FT:mat_peptide EU882002_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU882004_Pol_P-B Product feature CHAIN EU882004_Pol_P-B of FT:mat_peptide EU882004_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRSVFQTSKRHGDKSCCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGPLAGRLEGGS
GSIRARVRPSTWGTVGMEPSGSGHTHNCASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQGLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU919171_Pol_P-B Product feature CHAIN EU919171_Pol_P-B of FT:mat_peptide EU919171_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLDVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFP
DIHLKEDIIDRCEQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQSAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLDSTSKRHSSSGHAVEFHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU919172_Pol_P-B Product feature CHAIN EU919172_Pol_P-B of FT:mat_peptide EU919172_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKTAYSLISTSKGHSSSGHAVELPHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRTIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGSDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU919173_Pol_P-B Product feature CHAIN EU919173_Pol_P-B of FT:mat_peptide EU919173_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKTAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU919175_Pol_P-B Product feature CHAIN EU919175_Pol_P-B of FT:mat_peptide EU919175_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGPPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQSAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTYKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU919176_Pol_P-B Product feature CHAIN EU919176_Pol_P-B of FT:mat_peptide EU919176_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQSAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939559_Pol_P-B Product feature CHAIN EU939559_Pol_P-B of FT:mat_peptide EU939559_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSKVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQNIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939633_Pol_P-B Product feature CHAIN EU939633_Pol_P-B of FT:mat_peptide EU939633_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFFGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVRPSPWGTVGREPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGREVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAITNFLWSLGIHVNPHKTKRWGYSLNFMGYVIGCWGTLPQAHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939634_Pol_P-B Product feature CHAIN EU939634_Pol_P-B of FT:mat_peptide EU939634_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFFGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVRPSPWGTVGREPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGREVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAITNFLXSLGIHVNPHKTKRWGYSLNFMGYVIGCWGTLPQAHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939636_Pol_P-B Product feature CHAIN EU939636_Pol_P-B of FT:mat_peptide EU939636_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGSFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPRGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPI
LPCWWLQFRDSEPCSEYCLCHIVNLIEDWGPCTEYGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGSKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939638_Pol_P-B Product feature CHAIN EU939638_Pol_P-B of FT:mat_peptide EU939638_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHN
SCSRNLYISLMLLYKTYGRQLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939639_Pol_P-B Product feature CHAIN EU939639_Pol_P-B of FT:mat_peptide EU939639_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCRQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRVRVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFSPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRNINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939661_Pol_P-B Product feature CHAIN EU939661_Pol_P-B of FT:mat_peptide EU939661_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVADELNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTKNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLDGLQQGGS
RSIRARVHPSSRGTVGVEPSGSGHTHSCASSSSSCLHQSAVRTAAYSHISTSKGHSSSGHAVELHHFPPNSARSQSQGPV
PSCWWLQFRNSEPCSEYCIGHIVNLIEDWGPCTEHGEHRIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SLLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLVGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939663_Pol_P-B Product feature CHAIN EU939663_Pol_P-B of FT:mat_peptide EU939663_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYAVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPSIQSQLRKSRLGPQPTQGQLAGRQQGGS
GIIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHEVELPHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU939664_Pol_P-B Product feature CHAIN EU939664_Pol_P-B of FT:mat_peptide EU939664_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAANSLISSSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGXT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939665_Pol_P-B Product feature CHAIN EU939665_Pol_P-B of FT:mat_peptide EU939665_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTKNENRRLKLIMPVRFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPRGTVGVEPSGSGPTHNCASSSSSCLHQSAAREAAYSLISTSKGHASSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLXHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLXGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939666_Pol_P-B Product feature CHAIN EU939666_Pol_P-B of FT:mat_peptide EU939666_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939667_Pol_P-B Product feature CHAIN EU939667_Pol_P-B of FT:mat_peptide EU939667_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTAGVEPSSSGHTHNCASNSSSCLHQSAVRKAAYSHISTSKGHPSTGHAVELHHFPPSSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939669_Pol_P-B Product feature CHAIN EU939669_Pol_P-B of FT:mat_peptide EU939669_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNYASSSSSCLHQSAVRKAAYSLISTSKGNSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939670_Pol_P-B Product feature CHAIN EU939670_Pol_P-B of FT:mat_peptide EU939670_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGRAVELHHFPPNSSRSQSQGPV
HSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKSPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRNINNQHGTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939671_Pol_P-B Product feature CHAIN EU939671_Pol_P-B of FT:mat_peptide EU939671_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C201). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEDVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEHDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGRAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLFDSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939672_Pol_P-B Product feature CHAIN EU939672_Pol_P-B of FT:mat_peptide EU939672_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPSVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRVRVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939673_Pol_P-B Product feature CHAIN EU939673_Pol_P-B of FT:mat_peptide EU939673_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAERQQGGS
GSIRARVHPAPWGTVGVEPSGSRPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHVPPNSSRSQSQGPV
FSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDMHI
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939674_Pol_P-B Product feature CHAIN EU939674_Pol_P-B of FT:mat_peptide EU939674_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFP
DIHLKEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPRGIVGVEPSSSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNCEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGNFM
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939675_Pol_P-B Product feature CHAIN EU939675_Pol_P-B of FT:mat_peptide EU939675_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRSVLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLKEDIVDRCEQFVGPLTVNERRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGIPPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHTSPWGTVGVEPSSSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRSFPHCLAFSYMDDVVLGAKSV
HHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLRDQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939676_Pol_P-B Product feature CHAIN EU939676_Pol_P-B of FT:mat_peptide EU939676_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQFRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHASSGHAVELHHFPPNSARSQSQGPV
SSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINYQHRTMQNLHN
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939677_Pol_P-B Product feature CHAIN EU939677_Pol_P-B of FT:mat_peptide EU939677_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPASWGTVGVEPSGSGHTYNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIHNQHGTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939678_Pol_P-B Product feature CHAIN EU939678_Pol_P-B of FT:mat_peptide EU939678_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCQQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVTHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAANSLISTSKGHSSSSHAVELHHFPPNSSGSQSQGPV
SSCWWLQFRNSEPCSEYCLSHIVNLLDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLHAAVTHFLVSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939679_Pol_P-B Product feature CHAIN EU939679_Pol_P-B of FT:mat_peptide EU939679_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D134). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRLVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRQSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSSSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDHQHRTMQNLHN
SCSRNLYDSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023631_Pol_P-B Product feature CHAIN FJ023631_Pol_P-B of FT:mat_peptide FJ023631_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASNSSSCLHQSAVRKAAYSHISTSKGNSSSGHAVELHHFPPSSSNSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVKLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSFHSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSTVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVSNFLVSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023632_Pol_P-B Product feature CHAIN FJ023632_Pol_P-B of FT:mat_peptide FJ023632_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPGWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGCQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLLSTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLLDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKTFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023633_Pol_P-B Product feature CHAIN FJ023633_Pol_P-B of FT:mat_peptide FJ023633_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSERHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQPIQGQLAGCQQGGS
GSIRARVHPSPWGLVGVEPSGSGPTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSKSQGSV
LSCWWLQFRNREPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPPVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023634_Pol_P-B Product feature CHAIN FJ023634_Pol_P-B of FT:mat_peptide FJ023634_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSLCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGRQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPSNSSRSQSQGSI
LSCWWLQFRNSEPCSEYCLCHIINLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQNHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023635_Pol_P-B Product feature CHAIN FJ023635_Pol_P-B of FT:mat_peptide FJ023635_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCQQFVGPLTVNENRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSIQGQLAGCQQGGS
GSIRARVHPSPWGLVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHYFPSNSSRSKSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023636_Pol_P-B Product feature CHAIN FJ023636_Pol_P-B of FT:mat_peptide FJ023636_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGCQQGGS
GSIRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLCHIVNLLEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNS
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRITNHQHRTMQNLHD
SCSRNLYISLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
FPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023637_Pol_P-B Product feature CHAIN FJ023637_Pol_P-B of FT:mat_peptide FJ023637_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLREDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGIPSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNXANXSTSCLHQSAGRKAAYSPVSTSKRHSSSGHAVELHHVPPNSSRSKSQGAV
LSCWWLQFRNTEPCSEHCLFHIVNLIEDWGPCTEHGEHXIXTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023638_Pol_P-B Product feature CHAIN FJ023638_Pol_P-B of FT:mat_peptide FJ023638_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLREDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGIPSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTVGVESSSSGHTHNCANSSTSCLHQSAGRKAAYSPVSTSKRHSSSGHAVELHHVPPNSSRSKSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGGWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032342_Pol_P-B Product feature CHAIN FJ032342_Pol_P-B of FT:mat_peptide FJ032342_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSGLGPQPTQGQLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSEHIHNCASSSSSCLHQSAVRKAAYSRNSTSKGHSSSGHAVELHHFPPNSSRSQSQGTV
LSCWWLQFRNTEPCSEHCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRKLFVTLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLHAAVTNFLVSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKTFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ032344_Pol_P-B Product feature CHAIN FJ032344_Pol_P-B of FT:mat_peptide FJ032344_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARFYPKATKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSRRHGDKSFCPQSPGILPLSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPAHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHSVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRKLFASLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLHAAVTNFLVSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKTFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ032352_Pol_P-B Product feature CHAIN FJ032352_Pol_P-B of FT:mat_peptide FJ032352_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIIDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHASSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIVLGFRKISMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLTPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032353_Pol_P-B Product feature CHAIN FJ032353_Pol_P-B of FT:mat_peptide FJ032353_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIIDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNRASSSSSCLHQSAVRKAAYSLISTSKGHASSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYASLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLTPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032354_Pol_P-B Product feature CHAIN FJ032354_Pol_P-B of FT:mat_peptide FJ032354_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIIDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHASSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLTPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032357_Pol_P-B Product feature CHAIN FJ032357_Pol_P-B of FT:mat_peptide FJ032357_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCVQSQFRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELPHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQYRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTTFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAEPLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032358_Pol_P-B Product feature CHAIN FJ032358_Pol_P-B of FT:mat_peptide FJ032358_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCVQSQFRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELPHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVGKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQYRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGATSV
QHLESLYAAVTNFLVSLGIHVNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349236_Pol_P-B Product feature CHAIN FJ349236_Pol_P-B of FT:mat_peptide FJ349236_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFFPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGCQQGGS
GSIRARVHPSPWGLVGVEPSGSGHTHNCASSTSFCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKLKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFL
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386582_Pol_P-B Product feature CHAIN FJ386582_Pol_P-B of FT:mat_peptide FJ386582_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPPNSSRSQSQGTV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIMQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386583_Pol_P-B Product feature CHAIN FJ386583_Pol_P-B of FT:mat_peptide FJ386583_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNYASSSSSCLHQSAVRKAAYSLVSTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCSEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386584_Pol_P-B Product feature CHAIN FJ386584_Pol_P-B of FT:mat_peptide FJ386584_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386600_Pol_P-B Product feature CHAIN FJ386600_Pol_P-B of FT:mat_peptide FJ386600_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPIHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYPLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386608_Pol_P-B Product feature CHAIN FJ386608_Pol_P-B of FT:mat_peptide FJ386608_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ETSHSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSDSGPTHNCASSSSSCLHQSAVRKAADSLLSTSKGHSSSGHSVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIKDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHWTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGTKSV
QHREAIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386610_Pol_P-B Product feature CHAIN FJ386610_Pol_P-B of FT:mat_peptide FJ386610_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGLEPSGSGPTHNCASSSSSCLHQSEVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386615_Pol_P-B Product feature CHAIN FJ386615_Pol_P-B of FT:mat_peptide FJ386615_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSVPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNETRRLNLIMPARFYPNVTKYFPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFFGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARLQQGGS
GSIRARVHPSPWGNVGVEPSGSGPTHNCASSSSSCLHQSAGRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386634_Pol_P-B Product feature CHAIN FJ386634_Pol_P-B of FT:mat_peptide FJ386634_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNAKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHTSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSAKSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINYQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386636_Pol_P-B Product feature CHAIN FJ386636_Pol_P-B of FT:mat_peptide FJ386636_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGHLAGRQQGGS
GGIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELCQFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYPLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSLTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386642_Pol_P-B Product feature CHAIN FJ386642_Pol_P-B of FT:mat_peptide FJ386642_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNSKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVGKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSXSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386648_Pol_P-B Product feature CHAIN FJ386648_Pol_P-B of FT:mat_peptide FJ386648_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGILNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKTYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARXHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNINYQHGTLQNLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLNPFLFAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFASVTNFLLSLGIHLTPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLAVYTPFDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLXLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386654_Pol_P-B Product feature CHAIN FJ386654_Pol_P-B of FT:mat_peptide FJ386654_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPAPWGTVGVEPSGSRPTHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRAMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386655_Pol_P-B Product feature CHAIN FJ386655_Pol_P-B of FT:mat_peptide FJ386655_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCLQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNPSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386656_Pol_P-B Product feature CHAIN FJ386656_Pol_P-B of FT:mat_peptide FJ386656_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEKRRLNLIMPARFYPNDTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSXRHGDKSFCPQSPGILPLSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHSVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVDNEHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSV
HHLESLYAAVTTFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLHLYPVARQRPGLCQVFADATPTGWGLAXGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386658_Pol_P-B Product feature CHAIN FJ386658_Pol_P-B of FT:mat_peptide FJ386658_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKNFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGSTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHVPPNSSRPQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386660_Pol_P-B Product feature CHAIN FJ386660_Pol_P-B of FT:mat_peptide FJ386660_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKHFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVREAAYSHISTSKGLSSSGHAVELHHFPPNSSRSQSQGPV
XSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYQNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386666_Pol_P-B Product feature CHAIN FJ386666_Pol_P-B of FT:mat_peptide FJ386666_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGIFPRSSVGPCIQSQLRKSRLGPQPAQGHLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYISLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386668_Pol_P-B Product feature CHAIN FJ386668_Pol_P-B of FT:mat_peptide FJ386668_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGHLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386669_Pol_P-B Product feature CHAIN FJ386669_Pol_P-B of FT:mat_peptide FJ386669_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLLSTSKGHSSSGHDPELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386675_Pol_P-B Product feature CHAIN FJ386675_Pol_P-B of FT:mat_peptide FJ386675_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPAFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRITNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|FJ386676_Pol_P-B Product feature CHAIN FJ386676_Pol_P-B of FT:mat_peptide FJ386676_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPXQGQLAGRQQGGS
GSIRARVHPSTWGTVGVEPSRSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVSRLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386680_Pol_P-B Product feature CHAIN FJ386680_Pol_P-B of FT:mat_peptide FJ386680_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1244). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLDVSIPWTHKVGNFTGLYSSKVPCFNPEWQTPSFP
DIHLQEDIIDRCERFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQASKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHVPPNSSRSQSQGPI
LPCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESVYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIRMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386681_Pol_P-B Product feature CHAIN FJ386681_Pol_P-B of FT:mat_peptide FJ386681_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVCQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GIIRARVHPSPWGTVGVEPSRSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIHTAVTNFLLSLGIHLTPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386682_Pol_P-B Product feature CHAIN FJ386682_Pol_P-B of FT:mat_peptide FJ386682_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLREDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLSSASIGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLALGHQRVRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386683_Pol_P-B Product feature CHAIN FJ386683_Pol_P-B of FT:mat_peptide FJ386683_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSRSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVDLHHCPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRNINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386684_Pol_P-B Product feature CHAIN FJ386684_Pol_P-B of FT:mat_peptide FJ386684_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ386688_Pol_P-B Product feature CHAIN FJ386688_Pol_P-B of FT:mat_peptide FJ386688_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEDVVPHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRQSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGNVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAFSHLSTSKRQSSSGHAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNSTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSPSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ518812_Pol_P-B Product feature CHAIN FJ518812_Pol_P-B of FT:mat_peptide FJ518812_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYRR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSSGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGCQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVGKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLSQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLTPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562219_Pol_P-B Product feature CHAIN FJ562219_Pol_P-B of FT:mat_peptide FJ562219_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHPSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562222_Pol_P-B Product feature CHAIN FJ562222_Pol_P-B of FT:mat_peptide FJ562222_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTPKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562224_Pol_P-B Product feature CHAIN FJ562224_Pol_P-B of FT:mat_peptide FJ562224_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRAGVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYPLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLFYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562231_Pol_P-B Product feature CHAIN FJ562231_Pol_P-B of FT:mat_peptide FJ562231_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVYPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562234_Pol_P-B Product feature CHAIN FJ562234_Pol_P-B of FT:mat_peptide FJ562234_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562236_Pol_P-B Product feature CHAIN FJ562236_Pol_P-B of FT:mat_peptide FJ562236_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEHRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGTV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562237_Pol_P-B Product feature CHAIN FJ562237_Pol_P-B of FT:mat_peptide FJ562237_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQLAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQGLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLALGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|FJ562240_Pol_P-B Product feature CHAIN FJ562240_Pol_P-B of FT:mat_peptide FJ562240_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSARSQSQGPV
SSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDYQHRTMQNLHN
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNSHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562246_Pol_P-B Product feature CHAIN FJ562246_Pol_P-B of FT:mat_peptide FJ562246_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASNSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPSSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562253_Pol_P-B Product feature CHAIN FJ562253_Pol_P-B of FT:mat_peptide FJ562253_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQPGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASNSSSCFHQSEVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRTGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562254_Pol_P-B Product feature CHAIN FJ562254_Pol_P-B of FT:mat_peptide FJ562254_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHRFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562257_Pol_P-B Product feature CHAIN FJ562257_Pol_P-B of FT:mat_peptide FJ562257_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGSTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCSEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562259_Pol_P-B Product feature CHAIN FJ562259_Pol_P-B of FT:mat_peptide FJ562259_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562260_Pol_P-B Product feature CHAIN FJ562260_Pol_P-B of FT:mat_peptide FJ562260_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTKNETRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTGGVEPSGSGPTHNCASSSSSCLHQSAVRTAAYSLISTSKGHSSTGHAVEFHHIPPNSTRSQSQGPV
PSCWWLQFRNSEPCSEYCLSHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIRMCFRKLPVNRPIDWKVCQQIESLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562289_Pol_P-B Product feature CHAIN FJ562289_Pol_P-B of FT:mat_peptide FJ562289_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFSPNSSRSQSQGPV
XSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCSEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562296_Pol_P-B Product feature CHAIN FJ562296_Pol_P-B of FT:mat_peptide FJ562296_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQRQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQYRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562303_Pol_P-B Product feature CHAIN FJ562303_Pol_P-B of FT:mat_peptide FJ562303_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPTQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNYASSSSSCLPQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYPLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLFVSIMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562311_Pol_P-B Product feature CHAIN FJ562311_Pol_P-B of FT:mat_peptide FJ562311_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEGDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCLQSQLXKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSAPWGTVGVEPSGSGHTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFXPNSSXSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFKKLPVNRTIDWKVCQQIVGLL
GFAAPFTQCGYPALMALYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562312_Pol_P-B Product feature CHAIN FJ562312_Pol_P-B of FT:mat_peptide FJ562312_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLRLIMPARFYPNVTKYLPLDKGIKPYYPEDVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGNAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHI
SCSRNLYVSLMLLYKTYGRKLHLYSHPVILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562316_Pol_P-B Product feature CHAIN FJ562316_Pol_P-B of FT:mat_peptide FJ562316_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVHHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSNRHGDKSFCPQSPGILPRSSLGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGNVGVEPSGSGPTHNCASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHFPPISSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYPLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562321_Pol_P-B Product feature CHAIN FJ562321_Pol_P-B of FT:mat_peptide FJ562321_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I214). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKSYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRPSVGSCIQSQLRKSRLGPQPAQRQLAGRQQGGS
GSIRARVHPSPWGIVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562322_Pol_P-B Product feature CHAIN FJ562322_Pol_P-B of FT:mat_peptide FJ562322_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787444_Pol_P-B Product feature CHAIN FJ787444_Pol_P-B of FT:mat_peptide FJ787444_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEHRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQPRKSRLGPQPAQGQLAGRQQGGR
GSIRARVHPSPWGTVGVEPSRSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYAARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787475_Pol_P-B Product feature CHAIN FJ787475_Pol_P-B of FT:mat_peptide FJ787475_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPARSGHTHNCASSSSSCLHQSAVRKAADSLISTSKGHSSSGHAMELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRAPARVTGGVFLVDKNPHNTTESRLVVDLSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
ACSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESVYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDRKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787476_Pol_P-B Product feature CHAIN FJ787476_Pol_P-B of FT:mat_peptide FJ787476_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-3). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPARSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSKSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLTWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQRRTMQNLHD
ACSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESVYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLELYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787477_Pol_P-B Product feature CHAIN FJ787477_Pol_P-B of FT:mat_peptide FJ787477_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSCCPQSPGILPRSSVGPCIQSQLRKSRLGPQSAQGPLAGRLEGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHPPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEPLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVSRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLTKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899779_Pol_P-B Product feature CHAIN FJ899779_Pol_P-B of FT:mat_peptide FJ899779_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIADRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNYASSSSSCLHQSAVRKAAYSLISTSKGNSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAASYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ899784_Pol_P-B Product feature CHAIN FJ899784_Pol_P-B of FT:mat_peptide FJ899784_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPSVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRVRVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
RLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899785_Pol_P-B Product feature CHAIN FJ899785_Pol_P-B of FT:mat_peptide FJ899785_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPSVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRVRVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVDLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GIAAPFTQCGYPALVPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFAPPLHVAWKPP
>gnl|hbvpro|FJ899787_Pol_P-B Product feature CHAIN FJ899787_Pol_P-B of FT:mat_peptide FJ899787_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLSLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPSVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGHLAGRQQGGS
GSIRVRVHPFPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVLSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899790_Pol_P-B Product feature CHAIN FJ899790_Pol_P-B of FT:mat_peptide FJ899790_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFP
DIHLKEDIVDRCEQFVGPLTVSENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPRGIVGVEPSSSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNCEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGNFM
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ899791_Pol_P-B Product feature CHAIN FJ899791_Pol_P-B of FT:mat_peptide FJ899791_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFP
DIHLKEDIVDRCEQFVGPLTVSENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPRGIVGVEPSSSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
PSCWWLQFRNCEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGNFM
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ358136_Pol_P-B Product feature CHAIN GQ358136_Pol_P-B of FT:mat_peptide GQ358136_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVGNHYFQTRHYLHTLCKGGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIHHQHRTMQNLHD
SCSRNLYVPLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIMLKIKQCFRKLPVNRPIDWKLCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPVHVAWRPP
>gnl|hbvpro|GQ358137_Pol_P-B Product feature CHAIN GQ358137_Pol_P-B of FT:mat_peptide GQ358137_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGINRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSKRHGDKSFSPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCANSSSSCLYQSAVRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSDHCLFHIDNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIALKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358138_Pol_P-B Product feature CHAIN GQ358138_Pol_P-B of FT:mat_peptide GQ358138_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLYQSAVRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIALKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358139_Pol_P-B Product feature CHAIN GQ358139_Pol_P-B of FT:mat_peptide GQ358139_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT032). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDFNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSLRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPRGNVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
FSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIALKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYPP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358140_Pol_P-B Product feature CHAIN GQ358140_Pol_P-B of FT:mat_peptide GQ358140_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRSDLQTSTRHGDKSFRPQSAGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSLRAGIHSPTWGTVGVEPSSSGHTHNCANSSSSCLHQSAGRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
FSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRIMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLTLSPVARHRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACLARTRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358141_Pol_P-B Product feature CHAIN GQ358141_Pol_P-B of FT:mat_peptide GQ358141_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLYQSAVRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIALKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358142_Pol_P-B Product feature CHAIN GQ358142_Pol_P-B of FT:mat_peptide GQ358142_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYRHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCTQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDLQTSTRHGDKSFRPQSAGLLSRSPVGPCIQSQLRPSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIHHQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVFKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAASFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358143_Pol_P-B Product feature CHAIN GQ358143_Pol_P-B of FT:mat_peptide GQ358143_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVDRCKHFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKKAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVFKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358144_Pol_P-B Product feature CHAIN GQ358144_Pol_P-B of FT:mat_peptide GQ358144_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNETRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAELQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRYSSSGHAVELHHIPPNSSRSESQGSV
LSCWWLPFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRITTPTTPARVTGGVFLVDKNPHNTTKSRLVVDFSQFSKGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPKGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358145_Pol_P-B Product feature CHAIN GQ358145_Pol_P-B of FT:mat_peptide GQ358145_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFP
DIHLQEDIVNRCKQFVGPLTVNETRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSERHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGSQPTQGQLAGLQQGGS
GSIRVGIHSTPWGTVGVEPSSSGHTHNYASSSSFCLHQSAGRKAAYSPVSTSKRHSSSGHAVELHHIPPNSSRSESQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358146_Pol_P-B Product feature CHAIN GQ358146_Pol_P-B of FT:mat_peptide GQ358146_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFP
DIHLKEDIVNRCTQFVGPLTVNETRRLKLIMPARFYPKITKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSERHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRVGIYSTPWGTVGVEPSGSGHTHNYASSSSFCLHQSAVREAAYSPVSTSKRHASSGHAVELHHIPPNSSRSESQGSV
LSCWWLRFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRAPLGLYRP
LLRLPYRPTTGRTSLYADSPFVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358147_Pol_P-B Product feature CHAIN GQ358147_Pol_P-B of FT:mat_peptide GQ358147_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFP
DIHLKEDIVNRCKQFVGPLTVNETRRLKLIMPARFYPKITKYLPLVKGIKPYYPEHVVNHYFQTKHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSERHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRVGIHSTPWGTVGVEPSSSGHTHNYASSSSFCLHQSAVREAAYSPVSTSKRHSSSGHAVELHHIPPNSSRSESQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKIPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358148_Pol_P-B Product feature CHAIN GQ358148_Pol_P-B of FT:mat_peptide GQ358148_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLFYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPDFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPIQGQLAGLQQGGS
GSIRDGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAVRKASYSPVSTSKRLSSSGHAVELHHVPPNSSRPQSQGAV
LSCWWLQFRNSKPCSEHCIFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358149_Pol_P-B Product feature CHAIN GQ358149_Pol_P-B of FT:mat_peptide GQ358149_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPDFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRDGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAVRKAAYSPVSTSKRLSSSGHAVELHHVPPNSSRPQSQGSV
LSCWWLQFRNSKPCSEHCIFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKKAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358150_Pol_P-B Product feature CHAIN GQ358150_Pol_P-B of FT:mat_peptide GQ358150_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPDFNPEWQTPSFP
DIHLREDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLQTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRDGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAVRKAAYSPVSTSKRLSSSGHAVELHHVPPNSSRPQSQGSV
LSCWWLQFRNSKPCSEHCIFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358151_Pol_P-B Product feature CHAIN GQ358151_Pol_P-B of FT:mat_peptide GQ358151_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPDFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLQTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRDGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAVRKAAYSPLSTSKRLSSSGHAVELHHVPPNSSRPQSQGSV
LSCWWLQFRNSKPCSEHCIFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358152_Pol_P-B Product feature CHAIN GQ358152_Pol_P-B of FT:mat_peptide GQ358152_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPDFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSKRHGDKSFCPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRDGIHSTPWGTVGVEPSSSGHAHNCASSSSSCLHQSAVRKAAYSPVSTSKRLSSSGHAVELHHVPPNSSRPQSQGSV
LSCWWLQFRNSKPCSEHCIFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPANRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377519_Pol_P-B Product feature CHAIN GQ377519_Pol_P-B of FT:mat_peptide GQ377519_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCLQSQLRKPRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVDPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELQHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377525_Pol_P-B Product feature CHAIN GQ377525_Pol_P-B of FT:mat_peptide GQ377525_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSPISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377537_Pol_P-B Product feature CHAIN GQ377537_Pol_P-B of FT:mat_peptide GQ377537_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIWARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLWAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377542_Pol_P-B Product feature CHAIN GQ377542_Pol_P-B of FT:mat_peptide GQ377542_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIQMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377547_Pol_P-B Product feature CHAIN GQ377547_Pol_P-B of FT:mat_peptide GQ377547_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKITMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377550_Pol_P-B Product feature CHAIN GQ377550_Pol_P-B of FT:mat_peptide GQ377550_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J81). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSQRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNGASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAEELHHFPPNSARSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVTAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINYQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKVKMCFRKLPVNRPIDWKVCQRIVGLL
GFVAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377558_Pol_P-B Product feature CHAIN GQ377558_Pol_P-B of FT:mat_peptide GQ377558_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKRHSSTGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSI
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377561_Pol_P-B Product feature CHAIN GQ377561_Pol_P-B of FT:mat_peptide GQ377561_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSIGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELQHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKITMCFTKLPVNRPIDWKVCQQIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377566_Pol_P-B Product feature CHAIN GQ377566_Pol_P-B of FT:mat_peptide GQ377566_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRPQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377567_Pol_P-B Product feature CHAIN GQ377567_Pol_P-B of FT:mat_peptide GQ377567_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCSEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNHHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLMYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377568_Pol_P-B Product feature CHAIN GQ377568_Pol_P-B of FT:mat_peptide GQ377568_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQENIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377569_Pol_P-B Product feature CHAIN GQ377569_Pol_P-B of FT:mat_peptide GQ377569_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRDRVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKRHSSTGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKRCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377582_Pol_P-B Product feature CHAIN GQ377582_Pol_P-B of FT:mat_peptide GQ377582_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSTSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFSPNSSRSQSQGPV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377587_Pol_P-B Product feature CHAIN GQ377587_Pol_P-B of FT:mat_peptide GQ377587_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPSRFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRPSVGPCIQSQLRISRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377588_Pol_P-B Product feature CHAIN GQ377588_Pol_P-B of FT:mat_peptide GQ377588_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSIGPGIQSQLRKSRLGPQPAQGHLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIRMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377606_Pol_P-B Product feature CHAIN GQ377606_Pol_P-B of FT:mat_peptide GQ377606_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCLQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHIYNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHTEELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377610_Pol_P-B Product feature CHAIN GQ377610_Pol_P-B of FT:mat_peptide GQ377610_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNS
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377612_Pol_P-B Product feature CHAIN GQ377612_Pol_P-B of FT:mat_peptide GQ377612_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377622_Pol_P-B Product feature CHAIN GQ377622_Pol_P-B of FT:mat_peptide GQ377622_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFRTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHKCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELQHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
YCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377625_Pol_P-B Product feature CHAIN GQ377625_Pol_P-B of FT:mat_peptide GQ377625_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNITKYLPLDKGIKPYYPEYVFNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVGKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLTLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377629_Pol_P-B Product feature CHAIN GQ377629_Pol_P-B of FT:mat_peptide GQ377629_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCXEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRAMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTQRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLWYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377638_Pol_P-B Product feature CHAIN GQ377638_Pol_P-B of FT:mat_peptide GQ377638_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPIHNRASSSSSCLHQSAVRKAADSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPVYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377639_Pol_P-B Product feature CHAIN GQ377639_Pol_P-B of FT:mat_peptide GQ377639_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKMCFRKLPVNRTIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCHVFADATPTGWGLAIGHQRVRGTFV
SPLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377641_Pol_P-B Product feature CHAIN GQ377641_Pol_P-B of FT:mat_peptide GQ377641_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHTSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCXEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377643_Pol_P-B Product feature CHAIN GQ377643_Pol_P-B of FT:mat_peptide GQ377643_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGSTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCXEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKINMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377644_Pol_P-B Product feature CHAIN GQ377644_Pol_P-B of FT:mat_peptide GQ377644_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEDAGPLEEELHHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLREDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQSAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTAKGHSPSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ475340_Pol_P-B Product feature CHAIN GQ475340_Pol_P-B of FT:mat_peptide GQ475340_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924603_Pol_P-B Product feature CHAIN GQ924603_Pol_P-B of FT:mat_peptide GQ924603_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLHEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKEAYSLISTSKGHSSSGHAVELHHFPPNTSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924605_Pol_P-B Product feature CHAIN GQ924605_Pol_P-B of FT:mat_peptide GQ924605_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPXLAXEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYXSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCXVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924606_Pol_P-B Product feature CHAIN GQ924606_Pol_P-B of FT:mat_peptide GQ924606_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDLVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSCCPQSPGILPRSSVGPFFQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTLNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHVPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924607_Pol_P-B Product feature CHAIN GQ924607_Pol_P-B of FT:mat_peptide GQ924607_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNGRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKCFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIWARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTHRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924608_Pol_P-B Product feature CHAIN GQ924608_Pol_P-B of FT:mat_peptide GQ924608_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQSAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFAFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924610_Pol_P-B Product feature CHAIN GQ924610_Pol_P-B of FT:mat_peptide GQ924610_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924611_Pol_P-B Product feature CHAIN GQ924611_Pol_P-B of FT:mat_peptide GQ924611_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPFFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924617_Pol_P-B Product feature CHAIN GQ924617_Pol_P-B of FT:mat_peptide GQ924617_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLHVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHNLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPYIQSQLRQSRLGPQPTQGQLAELQQGGS
GSIRAGIHSTPWGTIGVESSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRLSSSGNAVELRQVPPNSSRYQSQGSV
LSCWWLQFRNSKPCSEHCLSHIVNLIEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
ACSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924621_Pol_P-B Product feature CHAIN GQ924621_Pol_P-B of FT:mat_peptide GQ924621_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFP
NIHLQEDIVNRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQEIQHGRLVFQTSKRHGDKSFCPQSSGILPRAPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRVGIHSTPWGTIGVEPSSSGHTHNCASSSSSCLHQSAGRKAAYTPVSTSKRHSSSGHAVELHNVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSLVRRAFPHCLAFTYMDDMVLGAKSV
QHLESLYPAVSNFLLSLGIHLNPHKPKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLDLYPVARQRPGMCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924624_Pol_P-B Product feature CHAIN GQ924624_Pol_P-B of FT:mat_peptide GQ924624_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPLFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHMQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELRHGRSVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNGASSSSSCLHQSAGSEAANSPVSTSKGHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRIMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ924625_Pol_P-B Product feature CHAIN GQ924625_Pol_P-B of FT:mat_peptide GQ924625_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVHRCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPLSTSKRHSSSGHTVELHHVPPNSSRSPSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924626_Pol_P-B Product feature CHAIN GQ924626_Pol_P-B of FT:mat_peptide GQ924626_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKRFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSKQGQLAGGQQGGS
GSIRARVHPSSWGLVGVEPSGPGNTHNYASSTSSCLHQSAVRKAAYSLVSTSKGHSPSGHAVELHHFPSNSSRSKSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRNMQNMHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924627_Pol_P-B Product feature CHAIN GQ924627_Pol_P-B of FT:mat_peptide GQ924627_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLYHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924628_Pol_P-B Product feature CHAIN GQ924628_Pol_P-B of FT:mat_peptide GQ924628_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDESFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSPSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCLRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLTKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924630_Pol_P-B Product feature CHAIN GQ924630_Pol_P-B of FT:mat_peptide GQ924630_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLSKSRLGPQPAQGQLAGRQQGGS
GSIRVRVHPSPWGTVGVEPSGSGRTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQAPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924631_Pol_P-B Product feature CHAIN GQ924631_Pol_P-B of FT:mat_peptide GQ924631_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSXTVPCFNPKWQTPSFP
DIHLQEDIVDRCNQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTYNRASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924632_Pol_P-B Product feature CHAIN GQ924632_Pol_P-B of FT:mat_peptide GQ924632_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYFPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGLEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFG
SPLPIHTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924634_Pol_P-B Product feature CHAIN GQ924634_Pol_P-B of FT:mat_peptide GQ924634_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKTYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRPSVGPCIQSQLRKSRLGPQPAQGQLAERQQGGS
GSIRARVHPSPWGTVGVEPSGSGHAHNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEYGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRAMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYASIQAKQAFTFSPTYKAFLRKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924635_Pol_P-B Product feature CHAIN GQ924635_Pol_P-B of FT:mat_peptide GQ924635_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDFNVGNVNVSILWRHKGRNFTGLYSSTVPIFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPSRFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQEIQQNSKRHGDKSFCPQSSGILSRSPVGPCIQSQHRQSRLGSQPTQGQLAGLQQGGSGSIRVG
IHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKAAYSPVSTSKRHSSSGHAVELHHVPPNSSRSKSQSSVLSCWWL
QFRNSEPCSEHCLFHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTRVSWPK
FAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHDSCSRNL
YVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESI
YAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVMKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVSPLPIH
TAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPY
RPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924637_Pol_P-B Product feature CHAIN GQ924637_Pol_P-B of FT:mat_peptide GQ924637_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPNWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSKRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTTWGTVGVEPSSSGHTHTCASSSSSCLHQSAGRKEAYSPDSTSKRHPSSGHAVELHQVPPNSSRSSSQGSV
LSCWWLQFRNSEPCSEHCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTLQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNEQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLRYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924638_Pol_P-B Product feature CHAIN GQ924638_Pol_P-B of FT:mat_peptide GQ924638_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLEDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHTCASSSSSCLHQSAGRKEAYSPVSTSKRHPSSGHAVELHHVPPNSSGSSSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGNWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLQYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924639_Pol_P-B Product feature CHAIN GQ924639_Pol_P-B of FT:mat_peptide GQ924639_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVKEHRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFCPQSSGILSRSPVGPCIQSQFRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHTCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSGSSSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGNWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLRYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924640_Pol_P-B Product feature CHAIN GQ924640_Pol_P-B of FT:mat_peptide GQ924640_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
DIHLQEDIVDRCRQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQFRQSGLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAVREAAYSPLSTSKGHSSSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924641_Pol_P-B Product feature CHAIN GQ924641_Pol_P-B of FT:mat_peptide GQ924641_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M76). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRSVLLLVEGAGPLEEELPRLADEGLNRRVAEDLNVGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGINPHYPEHVVEHYFQTTHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQGQLRQSRLGPQPSQGQLAGLQQGGS
GSIRAGTHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSHISTSKRHSSSGREVELPHVPPNSSRSSSQGSV
PSCWWLQFRNCDPCSEHCLSHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSPNSRIIDHQHRTMQNLHD
SCSRKLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSFGTLPHEHIVLKTKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPSTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924644_Pol_P-B Product feature CHAIN GQ924644_Pol_P-B of FT:mat_peptide GQ924644_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M79). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924645_Pol_P-B Product feature CHAIN GQ924645_Pol_P-B of FT:mat_peptide GQ924645_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFP
NIHLQEDIVDRCKQFEGPLTIKENRRLKLMMPARFDPKVPKYEPLDKGITPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCPQSAGLLSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGSKAAYSPISTSKGHSSSGYAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIHHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKKAFTFSPTYKAFLNKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924646_Pol_P-B Product feature CHAIN GQ924646_Pol_P-B of FT:mat_peptide GQ924646_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGLEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSARSQSQGPV
PSCWWLQFRNSKPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
TCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
HHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924647_Pol_P-B Product feature CHAIN GQ924647_Pol_P-B of FT:mat_peptide GQ924647_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHEVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGCSGLSRYVARLSSNSRIINNQHRTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGAFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ924648_Pol_P-B Product feature CHAIN GQ924648_Pol_P-B of FT:mat_peptide GQ924648_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNFASSSSSCLHQPAVRKAAYSLISTSKGYSSSGHAVELHHFSPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQDLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924651_Pol_P-B Product feature CHAIN GQ924651_Pol_P-B of FT:mat_peptide GQ924651_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPIQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGIFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLHFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924653_Pol_P-B Product feature CHAIN GQ924653_Pol_P-B of FT:mat_peptide GQ924653_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELQHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924654_Pol_P-B Product feature CHAIN GQ924654_Pol_P-B of FT:mat_peptide GQ924654_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPIQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGIFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924656_Pol_P-B Product feature CHAIN GQ924656_Pol_P-B of FT:mat_peptide GQ924656_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKPFCPQSAGIFSRSPVGPCIQSQLRQSRLGLQPTQGQLAGLQQGGS
GSIRAGTHSTPWGTIGVEPSSSGHTHNCASNSSSCLHQSAVRKAAYSPISTSKRHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRDSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU332695_Pol_P-B Product feature CHAIN GU332695_Pol_P-B of FT:mat_peptide GU332695_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMD74). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIGDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTIGVEPSGSGPTHNCASSSSPCLHQSAVRKAAYSLISTSKGHSSSGHAVELHNFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRNMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU357842_Pol_P-B Product feature CHAIN GU357842_Pol_P-B of FT:mat_peptide GU357842_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNTNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTKHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHEDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRRAAYSLISTAKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNIIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRKLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIQLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPVDDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU434372_Pol_P-B Product feature CHAIN GU434372_Pol_P-B of FT:mat_peptide GU434372_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASGSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRRLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLHRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU434373_Pol_P-B Product feature CHAIN GU434373_Pol_P-B of FT:mat_peptide GU434373_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASGSSSCLHQSAVRKTAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU451682_Pol_P-B Product feature CHAIN GU451682_Pol_P-B of FT:mat_peptide GU451682_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHIHNCASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYTLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGNFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815548_Pol_P-B Product feature CHAIN GU815548_Pol_P-B of FT:mat_peptide GU815548_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815549_Pol_P-B Product feature CHAIN GU815549_Pol_P-B of FT:mat_peptide GU815549_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLASSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815550_Pol_P-B Product feature CHAIN GU815550_Pol_P-B of FT:mat_peptide GU815550_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNPGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815551_Pol_P-B Product feature CHAIN GU815551_Pol_P-B of FT:mat_peptide GU815551_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSAPFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNSMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815552_Pol_P-B Product feature CHAIN GU815552_Pol_P-B of FT:mat_peptide GU815552_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLGKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815553_Pol_P-B Product feature CHAIN GU815553_Pol_P-B of FT:mat_peptide GU815553_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSAPFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNSMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815554_Pol_P-B Product feature CHAIN GU815554_Pol_P-B of FT:mat_peptide GU815554_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRLQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCYIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARSSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMCGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815555_Pol_P-B Product feature CHAIN GU815555_Pol_P-B of FT:mat_peptide GU815555_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASSCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815556_Pol_P-B Product feature CHAIN GU815556_Pol_P-B of FT:mat_peptide GU815556_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSAPFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNSMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815557_Pol_P-B Product feature CHAIN GU815557_Pol_P-B of FT:mat_peptide GU815557_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPAWMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815558_Pol_P-B Product feature CHAIN GU815558_Pol_P-B of FT:mat_peptide GU815558_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815559_Pol_P-B Product feature CHAIN GU815559_Pol_P-B of FT:mat_peptide GU815559_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815560_Pol_P-B Product feature CHAIN GU815560_Pol_P-B of FT:mat_peptide GU815560_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYQFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815561_Pol_P-B Product feature CHAIN GU815561_Pol_P-B of FT:mat_peptide GU815561_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815562_Pol_P-B Product feature CHAIN GU815562_Pol_P-B of FT:mat_peptide GU815562_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815563_Pol_P-B Product feature CHAIN GU815563_Pol_P-B of FT:mat_peptide GU815563_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815564_Pol_P-B Product feature CHAIN GU815564_Pol_P-B of FT:mat_peptide GU815564_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLGKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815565_Pol_P-B Product feature CHAIN GU815565_Pol_P-B of FT:mat_peptide GU815565_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWPQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815566_Pol_P-B Product feature CHAIN GU815566_Pol_P-B of FT:mat_peptide GU815566_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815567_Pol_P-B Product feature CHAIN GU815567_Pol_P-B of FT:mat_peptide GU815567_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWPQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815568_Pol_P-B Product feature CHAIN GU815568_Pol_P-B of FT:mat_peptide GU815568_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815569_Pol_P-B Product feature CHAIN GU815569_Pol_P-B of FT:mat_peptide GU815569_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815570_Pol_P-B Product feature CHAIN GU815570_Pol_P-B of FT:mat_peptide GU815570_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEDRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815571_Pol_P-B Product feature CHAIN GU815571_Pol_P-B of FT:mat_peptide GU815571_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTTELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815572_Pol_P-B Product feature CHAIN GU815572_Pol_P-B of FT:mat_peptide GU815572_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815573_Pol_P-B Product feature CHAIN GU815573_Pol_P-B of FT:mat_peptide GU815573_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSSILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815574_Pol_P-B Product feature CHAIN GU815574_Pol_P-B of FT:mat_peptide GU815574_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQDLHN
SCSRNLHVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSIVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815575_Pol_P-B Product feature CHAIN GU815575_Pol_P-B of FT:mat_peptide GU815575_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815576_Pol_P-B Product feature CHAIN GU815576_Pol_P-B of FT:mat_peptide GU815576_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWPQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815577_Pol_P-B Product feature CHAIN GU815577_Pol_P-B of FT:mat_peptide GU815577_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQDLHN
SCSRNLHVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSIVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815578_Pol_P-B Product feature CHAIN GU815578_Pol_P-B of FT:mat_peptide GU815578_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELYHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815579_Pol_P-B Product feature CHAIN GU815579_Pol_P-B of FT:mat_peptide GU815579_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815581_Pol_P-B Product feature CHAIN GU815581_Pol_P-B of FT:mat_peptide GU815581_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGIFPRSSVGPCIQSQLSKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRFQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815583_Pol_P-B Product feature CHAIN GU815583_Pol_P-B of FT:mat_peptide GU815583_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815584_Pol_P-B Product feature CHAIN GU815584_Pol_P-B of FT:mat_peptide GU815584_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815585_Pol_P-B Product feature CHAIN GU815585_Pol_P-B of FT:mat_peptide GU815585_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815586_Pol_P-B Product feature CHAIN GU815586_Pol_P-B of FT:mat_peptide GU815586_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSFISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815587_Pol_P-B Product feature CHAIN GU815587_Pol_P-B of FT:mat_peptide GU815587_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVADFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815588_Pol_P-B Product feature CHAIN GU815588_Pol_P-B of FT:mat_peptide GU815588_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTHKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815589_Pol_P-B Product feature CHAIN GU815589_Pol_P-B of FT:mat_peptide GU815589_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815590_Pol_P-B Product feature CHAIN GU815590_Pol_P-B of FT:mat_peptide GU815590_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815591_Pol_P-B Product feature CHAIN GU815591_Pol_P-B of FT:mat_peptide GU815591_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815593_Pol_P-B Product feature CHAIN GU815593_Pol_P-B of FT:mat_peptide GU815593_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815594_Pol_P-B Product feature CHAIN GU815594_Pol_P-B of FT:mat_peptide GU815594_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGHLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815595_Pol_P-B Product feature CHAIN GU815595_Pol_P-B of FT:mat_peptide GU815595_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815596_Pol_P-B Product feature CHAIN GU815596_Pol_P-B of FT:mat_peptide GU815596_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMSHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815597_Pol_P-B Product feature CHAIN GU815597_Pol_P-B of FT:mat_peptide GU815597_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815598_Pol_P-B Product feature CHAIN GU815598_Pol_P-B of FT:mat_peptide GU815598_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNRASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPLEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815599_Pol_P-B Product feature CHAIN GU815599_Pol_P-B of FT:mat_peptide GU815599_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815601_Pol_P-B Product feature CHAIN GU815601_Pol_P-B of FT:mat_peptide GU815601_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYANSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815602_Pol_P-B Product feature CHAIN GU815602_Pol_P-B of FT:mat_peptide GU815602_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQGDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYPNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815603_Pol_P-B Product feature CHAIN GU815603_Pol_P-B of FT:mat_peptide GU815603_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815604_Pol_P-B Product feature CHAIN GU815604_Pol_P-B of FT:mat_peptide GU815604_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFAEATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815605_Pol_P-B Product feature CHAIN GU815605_Pol_P-B of FT:mat_peptide GU815605_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815606_Pol_P-B Product feature CHAIN GU815606_Pol_P-B of FT:mat_peptide GU815606_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815607_Pol_P-B Product feature CHAIN GU815607_Pol_P-B of FT:mat_peptide GU815607_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKTPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKIKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815608_Pol_P-B Product feature CHAIN GU815608_Pol_P-B of FT:mat_peptide GU815608_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAKLLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPPHVAWRPP
>gnl|hbvpro|GU815609_Pol_P-B Product feature CHAIN GU815609_Pol_P-B of FT:mat_peptide GU815609_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815610_Pol_P-B Product feature CHAIN GU815610_Pol_P-B of FT:mat_peptide GU815610_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIKTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815611_Pol_P-B Product feature CHAIN GU815611_Pol_P-B of FT:mat_peptide GU815611_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-6). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815612_Pol_P-B Product feature CHAIN GU815612_Pol_P-B of FT:mat_peptide GU815612_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815613_Pol_P-B Product feature CHAIN GU815613_Pol_P-B of FT:mat_peptide GU815613_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815614_Pol_P-B Product feature CHAIN GU815614_Pol_P-B of FT:mat_peptide GU815614_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSLGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
RSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHLPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815616_Pol_P-B Product feature CHAIN GU815616_Pol_P-B of FT:mat_peptide GU815616_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHVVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADGPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815617_Pol_P-B Product feature CHAIN GU815617_Pol_P-B of FT:mat_peptide GU815617_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPQNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTHKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSRAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815618_Pol_P-B Product feature CHAIN GU815618_Pol_P-B of FT:mat_peptide GU815618_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815619_Pol_P-B Product feature CHAIN GU815619_Pol_P-B of FT:mat_peptide GU815619_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQDPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTPFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815620_Pol_P-B Product feature CHAIN GU815620_Pol_P-B of FT:mat_peptide GU815620_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815621_Pol_P-B Product feature CHAIN GU815621_Pol_P-B of FT:mat_peptide GU815621_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815622_Pol_P-B Product feature CHAIN GU815622_Pol_P-B of FT:mat_peptide GU815622_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPQNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTHKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSRAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815623_Pol_P-B Product feature CHAIN GU815623_Pol_P-B of FT:mat_peptide GU815623_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYTLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815624_Pol_P-B Product feature CHAIN GU815624_Pol_P-B of FT:mat_peptide GU815624_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQARHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLTGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815625_Pol_P-B Product feature CHAIN GU815625_Pol_P-B of FT:mat_peptide GU815625_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSQFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQALTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGSAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815626_Pol_P-B Product feature CHAIN GU815626_Pol_P-B of FT:mat_peptide GU815626_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815627_Pol_P-B Product feature CHAIN GU815627_Pol_P-B of FT:mat_peptide GU815627_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815628_Pol_P-B Product feature CHAIN GU815628_Pol_P-B of FT:mat_peptide GU815628_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815629_Pol_P-B Product feature CHAIN GU815629_Pol_P-B of FT:mat_peptide GU815629_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815630_Pol_P-B Product feature CHAIN GU815630_Pol_P-B of FT:mat_peptide GU815630_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815631_Pol_P-B Product feature CHAIN GU815631_Pol_P-B of FT:mat_peptide GU815631_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815632_Pol_P-B Product feature CHAIN GU815632_Pol_P-B of FT:mat_peptide GU815632_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815633_Pol_P-B Product feature CHAIN GU815633_Pol_P-B of FT:mat_peptide GU815633_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815634_Pol_P-B Product feature CHAIN GU815634_Pol_P-B of FT:mat_peptide GU815634_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-10). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLTFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTHKAFLSKQYLNLYPVARQRPGLCQVFAGATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWTLRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815635_Pol_P-B Product feature CHAIN GU815635_Pol_P-B of FT:mat_peptide GU815635_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPVQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKALLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815636_Pol_P-B Product feature CHAIN GU815636_Pol_P-B of FT:mat_peptide GU815636_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815637_Pol_P-B Product feature CHAIN GU815637_Pol_P-B of FT:mat_peptide GU815637_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815638_Pol_P-B Product feature CHAIN GU815638_Pol_P-B of FT:mat_peptide GU815638_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDRGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815639_Pol_P-B Product feature CHAIN GU815639_Pol_P-B of FT:mat_peptide GU815639_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGAFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GU815640_Pol_P-B Product feature CHAIN GU815640_Pol_P-B of FT:mat_peptide GU815640_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQMAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815641_Pol_P-B Product feature CHAIN GU815641_Pol_P-B of FT:mat_peptide GU815641_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815642_Pol_P-B Product feature CHAIN GU815642_Pol_P-B of FT:mat_peptide GU815642_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGRLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISNSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPYCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815643_Pol_P-B Product feature CHAIN GU815643_Pol_P-B of FT:mat_peptide GU815643_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815644_Pol_P-B Product feature CHAIN GU815644_Pol_P-B of FT:mat_peptide GU815644_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815645_Pol_P-B Product feature CHAIN GU815645_Pol_P-B of FT:mat_peptide GU815645_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815646_Pol_P-B Product feature CHAIN GU815646_Pol_P-B of FT:mat_peptide GU815646_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815647_Pol_P-B Product feature CHAIN GU815647_Pol_P-B of FT:mat_peptide GU815647_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815648_Pol_P-B Product feature CHAIN GU815648_Pol_P-B of FT:mat_peptide GU815648_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GGIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815649_Pol_P-B Product feature CHAIN GU815649_Pol_P-B of FT:mat_peptide GU815649_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815650_Pol_P-B Product feature CHAIN GU815650_Pol_P-B of FT:mat_peptide GU815650_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
ACSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSVLNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815651_Pol_P-B Product feature CHAIN GU815651_Pol_P-B of FT:mat_peptide GU815651_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGRSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815652_Pol_P-B Product feature CHAIN GU815652_Pol_P-B of FT:mat_peptide GU815652_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815653_Pol_P-B Product feature CHAIN GU815653_Pol_P-B of FT:mat_peptide GU815653_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815654_Pol_P-B Product feature CHAIN GU815654_Pol_P-B of FT:mat_peptide GU815654_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815656_Pol_P-B Product feature CHAIN GU815656_Pol_P-B of FT:mat_peptide GU815656_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSAVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815657_Pol_P-B Product feature CHAIN GU815657_Pol_P-B of FT:mat_peptide GU815657_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHPPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815658_Pol_P-B Product feature CHAIN GU815658_Pol_P-B of FT:mat_peptide GU815658_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFPLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815659_Pol_P-B Product feature CHAIN GU815659_Pol_P-B of FT:mat_peptide GU815659_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815660_Pol_P-B Product feature CHAIN GU815660_Pol_P-B of FT:mat_peptide GU815660_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815661_Pol_P-B Product feature CHAIN GU815661_Pol_P-B of FT:mat_peptide GU815661_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPPHVAWRPP
>gnl|hbvpro|GU815662_Pol_P-B Product feature CHAIN GU815662_Pol_P-B of FT:mat_peptide GU815662_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKRHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815663_Pol_P-B Product feature CHAIN GU815663_Pol_P-B of FT:mat_peptide GU815663_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPTAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815664_Pol_P-B Product feature CHAIN GU815664_Pol_P-B of FT:mat_peptide GU815664_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815665_Pol_P-B Product feature CHAIN GU815665_Pol_P-B of FT:mat_peptide GU815665_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815666_Pol_P-B Product feature CHAIN GU815666_Pol_P-B of FT:mat_peptide GU815666_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815667_Pol_P-B Product feature CHAIN GU815667_Pol_P-B of FT:mat_peptide GU815667_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLTIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815668_Pol_P-B Product feature CHAIN GU815668_Pol_P-B of FT:mat_peptide GU815668_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815669_Pol_P-B Product feature CHAIN GU815669_Pol_P-B of FT:mat_peptide GU815669_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815670_Pol_P-B Product feature CHAIN GU815670_Pol_P-B of FT:mat_peptide GU815670_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVDSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LPRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815672_Pol_P-B Product feature CHAIN GU815672_Pol_P-B of FT:mat_peptide GU815672_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHPSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815673_Pol_P-B Product feature CHAIN GU815673_Pol_P-B of FT:mat_peptide GU815673_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLGEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815674_Pol_P-B Product feature CHAIN GU815674_Pol_P-B of FT:mat_peptide GU815674_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815675_Pol_P-B Product feature CHAIN GU815675_Pol_P-B of FT:mat_peptide GU815675_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815676_Pol_P-B Product feature CHAIN GU815676_Pol_P-B of FT:mat_peptide GU815676_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815677_Pol_P-B Product feature CHAIN GU815677_Pol_P-B of FT:mat_peptide GU815677_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSRGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815678_Pol_P-B Product feature CHAIN GU815678_Pol_P-B of FT:mat_peptide GU815678_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVTENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815679_Pol_P-B Product feature CHAIN GU815679_Pol_P-B of FT:mat_peptide GU815679_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815680_Pol_P-B Product feature CHAIN GU815680_Pol_P-B of FT:mat_peptide GU815680_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815681_Pol_P-B Product feature CHAIN GU815681_Pol_P-B of FT:mat_peptide GU815681_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815683_Pol_P-B Product feature CHAIN GU815683_Pol_P-B of FT:mat_peptide GU815683_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKVFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815684_Pol_P-B Product feature CHAIN GU815684_Pol_P-B of FT:mat_peptide GU815684_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815685_Pol_P-B Product feature CHAIN GU815685_Pol_P-B of FT:mat_peptide GU815685_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815686_Pol_P-B Product feature CHAIN GU815686_Pol_P-B of FT:mat_peptide GU815686_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815687_Pol_P-B Product feature CHAIN GU815687_Pol_P-B of FT:mat_peptide GU815687_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815688_Pol_P-B Product feature CHAIN GU815688_Pol_P-B of FT:mat_peptide GU815688_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815689_Pol_P-B Product feature CHAIN GU815689_Pol_P-B of FT:mat_peptide GU815689_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815691_Pol_P-B Product feature CHAIN GU815691_Pol_P-B of FT:mat_peptide GU815691_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815692_Pol_P-B Product feature CHAIN GU815692_Pol_P-B of FT:mat_peptide GU815692_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815693_Pol_P-B Product feature CHAIN GU815693_Pol_P-B of FT:mat_peptide GU815693_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815694_Pol_P-B Product feature CHAIN GU815694_Pol_P-B of FT:mat_peptide GU815694_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815695_Pol_P-B Product feature CHAIN GU815695_Pol_P-B of FT:mat_peptide GU815695_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815696_Pol_P-B Product feature CHAIN GU815696_Pol_P-B of FT:mat_peptide GU815696_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815697_Pol_P-B Product feature CHAIN GU815697_Pol_P-B of FT:mat_peptide GU815697_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815698_Pol_P-B Product feature CHAIN GU815698_Pol_P-B of FT:mat_peptide GU815698_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815699_Pol_P-B Product feature CHAIN GU815699_Pol_P-B of FT:mat_peptide GU815699_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815700_Pol_P-B Product feature CHAIN GU815700_Pol_P-B of FT:mat_peptide GU815700_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815701_Pol_P-B Product feature CHAIN GU815701_Pol_P-B of FT:mat_peptide GU815701_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815702_Pol_P-B Product feature CHAIN GU815702_Pol_P-B of FT:mat_peptide GU815702_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815703_Pol_P-B Product feature CHAIN GU815703_Pol_P-B of FT:mat_peptide GU815703_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSFISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKKAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815704_Pol_P-B Product feature CHAIN GU815704_Pol_P-B of FT:mat_peptide GU815704_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCTSSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815705_Pol_P-B Product feature CHAIN GU815705_Pol_P-B of FT:mat_peptide GU815705_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815706_Pol_P-B Product feature CHAIN GU815706_Pol_P-B of FT:mat_peptide GU815706_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVMLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815707_Pol_P-B Product feature CHAIN GU815707_Pol_P-B of FT:mat_peptide GU815707_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGSQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815708_Pol_P-B Product feature CHAIN GU815708_Pol_P-B of FT:mat_peptide GU815708_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815709_Pol_P-B Product feature CHAIN GU815709_Pol_P-B of FT:mat_peptide GU815709_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815710_Pol_P-B Product feature CHAIN GU815710_Pol_P-B of FT:mat_peptide GU815710_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSRHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815711_Pol_P-B Product feature CHAIN GU815711_Pol_P-B of FT:mat_peptide GU815711_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFTVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYVAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSRPPDRVHFASPPHVAWRPP
>gnl|hbvpro|GU815712_Pol_P-B Product feature CHAIN GU815712_Pol_P-B of FT:mat_peptide GU815712_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=843 residues).
IPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815713_Pol_P-B Product feature CHAIN GU815713_Pol_P-B of FT:mat_peptide GU815713_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAVMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCPAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815715_Pol_P-B Product feature CHAIN GU815715_Pol_P-B of FT:mat_peptide GU815715_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRAPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815716_Pol_P-B Product feature CHAIN GU815716_Pol_P-B of FT:mat_peptide GU815716_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815717_Pol_P-B Product feature CHAIN GU815717_Pol_P-B of FT:mat_peptide GU815717_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815718_Pol_P-B Product feature CHAIN GU815718_Pol_P-B of FT:mat_peptide GU815718_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRTINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815719_Pol_P-B Product feature CHAIN GU815719_Pol_P-B of FT:mat_peptide GU815719_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815720_Pol_P-B Product feature CHAIN GU815720_Pol_P-B of FT:mat_peptide GU815720_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVREAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKTKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVPSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPARVHFASPLHVAWKPP
>gnl|hbvpro|GU815721_Pol_P-B Product feature CHAIN GU815721_Pol_P-B of FT:mat_peptide GU815721_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815722_Pol_P-B Product feature CHAIN GU815722_Pol_P-B of FT:mat_peptide GU815722_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVARRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAATNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSPYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815723_Pol_P-B Product feature CHAIN GU815723_Pol_P-B of FT:mat_peptide GU815723_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815724_Pol_P-B Product feature CHAIN GU815724_Pol_P-B of FT:mat_peptide GU815724_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815725_Pol_P-B Product feature CHAIN GU815725_Pol_P-B of FT:mat_peptide GU815725_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPARVHFASPLHVAWKPP
>gnl|hbvpro|GU815726_Pol_P-B Product feature CHAIN GU815726_Pol_P-B of FT:mat_peptide GU815726_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFGYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815727_Pol_P-B Product feature CHAIN GU815727_Pol_P-B of FT:mat_peptide GU815727_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSMVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGMGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTAGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815728_Pol_P-B Product feature CHAIN GU815728_Pol_P-B of FT:mat_peptide GU815728_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRVRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKPV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815729_Pol_P-B Product feature CHAIN GU815729_Pol_P-B of FT:mat_peptide GU815729_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKGHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGYT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815730_Pol_P-B Product feature CHAIN GU815730_Pol_P-B of FT:mat_peptide GU815730_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815731_Pol_P-B Product feature CHAIN GU815731_Pol_P-B of FT:mat_peptide GU815731_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRRLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815732_Pol_P-B Product feature CHAIN GU815732_Pol_P-B of FT:mat_peptide GU815732_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815733_Pol_P-B Product feature CHAIN GU815733_Pol_P-B of FT:mat_peptide GU815733_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVVPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMSHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSQPPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815734_Pol_P-B Product feature CHAIN GU815734_Pol_P-B of FT:mat_peptide GU815734_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815735_Pol_P-B Product feature CHAIN GU815735_Pol_P-B of FT:mat_peptide GU815735_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
FCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEFLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815736_Pol_P-B Product feature CHAIN GU815736_Pol_P-B of FT:mat_peptide GU815736_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815737_Pol_P-B Product feature CHAIN GU815737_Pol_P-B of FT:mat_peptide GU815737_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815738_Pol_P-B Product feature CHAIN GU815738_Pol_P-B of FT:mat_peptide GU815738_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815739_Pol_P-B Product feature CHAIN GU815739_Pol_P-B of FT:mat_peptide GU815739_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRQSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815740_Pol_P-B Product feature CHAIN GU815740_Pol_P-B of FT:mat_peptide GU815740_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815741_Pol_P-B Product feature CHAIN GU815741_Pol_P-B of FT:mat_peptide GU815741_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-4). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815742_Pol_P-B Product feature CHAIN GU815742_Pol_P-B of FT:mat_peptide GU815742_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815743_Pol_P-B Product feature CHAIN GU815743_Pol_P-B of FT:mat_peptide GU815743_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815744_Pol_P-B Product feature CHAIN GU815744_Pol_P-B of FT:mat_peptide GU815744_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815745_Pol_P-B Product feature CHAIN GU815745_Pol_P-B of FT:mat_peptide GU815745_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDNGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815746_Pol_P-B Product feature CHAIN GU815746_Pol_P-B of FT:mat_peptide GU815746_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEHCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815747_Pol_P-B Product feature CHAIN GU815747_Pol_P-B of FT:mat_peptide GU815747_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815748_Pol_P-B Product feature CHAIN GU815748_Pol_P-B of FT:mat_peptide GU815748_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815749_Pol_P-B Product feature CHAIN GU815749_Pol_P-B of FT:mat_peptide GU815749_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGGKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSSPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU815750_Pol_P-B Product feature CHAIN GU815750_Pol_P-B of FT:mat_peptide GU815750_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815751_Pol_P-B Product feature CHAIN GU815751_Pol_P-B of FT:mat_peptide GU815751_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815752_Pol_P-B Product feature CHAIN GU815752_Pol_P-B of FT:mat_peptide GU815752_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLCVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAEPLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815753_Pol_P-B Product feature CHAIN GU815753_Pol_P-B of FT:mat_peptide GU815753_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKPPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815754_Pol_P-B Product feature CHAIN GU815754_Pol_P-B of FT:mat_peptide GU815754_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815755_Pol_P-B Product feature CHAIN GU815755_Pol_P-B of FT:mat_peptide GU815755_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLS
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815756_Pol_P-B Product feature CHAIN GU815756_Pol_P-B of FT:mat_peptide GU815756_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815757_Pol_P-B Product feature CHAIN GU815757_Pol_P-B of FT:mat_peptide GU815757_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815759_Pol_P-B Product feature CHAIN GU815759_Pol_P-B of FT:mat_peptide GU815759_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815760_Pol_P-B Product feature CHAIN GU815760_Pol_P-B of FT:mat_peptide GU815760_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSFMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMCGTFV
SPLPIRTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815761_Pol_P-B Product feature CHAIN GU815761_Pol_P-B of FT:mat_peptide GU815761_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815762_Pol_P-B Product feature CHAIN GU815762_Pol_P-B of FT:mat_peptide GU815762_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815764_Pol_P-B Product feature CHAIN GU815764_Pol_P-B of FT:mat_peptide GU815764_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815765_Pol_P-B Product feature CHAIN GU815765_Pol_P-B of FT:mat_peptide GU815765_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815766_Pol_P-B Product feature CHAIN GU815766_Pol_P-B of FT:mat_peptide GU815766_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815767_Pol_P-B Product feature CHAIN GU815767_Pol_P-B of FT:mat_peptide GU815767_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815768_Pol_P-B Product feature CHAIN GU815768_Pol_P-B of FT:mat_peptide GU815768_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815769_Pol_P-B Product feature CHAIN GU815769_Pol_P-B of FT:mat_peptide GU815769_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNESRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815770_Pol_P-B Product feature CHAIN GU815770_Pol_P-B of FT:mat_peptide GU815770_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQSLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815771_Pol_P-B Product feature CHAIN GU815771_Pol_P-B of FT:mat_peptide GU815771_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815772_Pol_P-B Product feature CHAIN GU815772_Pol_P-B of FT:mat_peptide GU815772_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815773_Pol_P-B Product feature CHAIN GU815773_Pol_P-B of FT:mat_peptide GU815773_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWPQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815774_Pol_P-B Product feature CHAIN GU815774_Pol_P-B of FT:mat_peptide GU815774_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSEAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815775_Pol_P-B Product feature CHAIN GU815775_Pol_P-B of FT:mat_peptide GU815775_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815776_Pol_P-B Product feature CHAIN GU815776_Pol_P-B of FT:mat_peptide GU815776_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWPQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815777_Pol_P-B Product feature CHAIN GU815777_Pol_P-B of FT:mat_peptide GU815777_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815778_Pol_P-B Product feature CHAIN GU815778_Pol_P-B of FT:mat_peptide GU815778_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFE
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815779_Pol_P-B Product feature CHAIN GU815779_Pol_P-B of FT:mat_peptide GU815779_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCVSSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGKT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLSSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815780_Pol_P-B Product feature CHAIN GU815780_Pol_P-B of FT:mat_peptide GU815780_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815781_Pol_P-B Product feature CHAIN GU815781_Pol_P-B of FT:mat_peptide GU815781_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815782_Pol_P-B Product feature CHAIN GU815782_Pol_P-B of FT:mat_peptide GU815782_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGAVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALTPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU815783_Pol_P-B Product feature CHAIN GU815783_Pol_P-B of FT:mat_peptide GU815783_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFKTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSRISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNQLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHS
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDGKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011466_Pol_P-B Product feature CHAIN HM011466_Pol_P-B of FT:mat_peptide HM011466_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLARRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVXKAAYSLISTSKGHSSSGHAVELHHXPPNSSXSQSQGPV
LSCWWLQFRNSEPCSEYCLXHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGET
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLXRYVARLSSNSRIIDNKHGTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVMGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRXGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAXSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011467_Pol_P-B Product feature CHAIN HM011467_Pol_P-B of FT:mat_peptide HM011467_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPXFNPXWQTPSFPD
IHLXEDIINRCTEFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRE
TTHSASFCGSPYSWEQELQHGRLVLQTSKRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGSQPTQGQLAGLQQGGSG
SIRAGIHSTPWGTVGVEPSSSGHSHNCASSSSSCLXQSAVREKAYSPVSTSQRHSSSGHAVELHHVPPNSSRSQSQGSVP
SCWWLQFRNSEPCSEYCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTR
VSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHXPLHPAAMPHLLVGSSGLSXYVARLSSNSRIINHQHRTMQNLHDS
CSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVSNFLLSLGIHLNXHKTKRWGYSLNFMGYXIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVS
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLXYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011469_Pol_P-B Product feature CHAIN HM011469_Pol_P-B of FT:mat_peptide HM011469_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLXEDIIDRCKQFVGPLTANENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGXCIQSQLRQSRLGSQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHSHNCASSSSSCLHQSAVRKEAYSPVSTXXRHSSSXHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCXEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGXT
RVSWPKFAVPNLQSLTNLLSSBLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEXIYXAVSNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011470_Pol_P-B Product feature CHAIN HM011470_Pol_P-B of FT:mat_peptide HM011470_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCZQFVGPLTVNENRRLKLIMPARFYPNVTKYFPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCXQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARSHPSPWGTVGVEPSGSGPTHNGASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPA
RSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRKLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYTCIQAKQAFTFSPTYKAFLSKQYLNLYPVVRQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|HM011471_Pol_P-B Product feature CHAIN HM011471_Pol_P-B of FT:mat_peptide HM011471_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNTEWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGMEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSXHEVELHHFSPNSPRSQSQGPV
LSCWWLQFRNSEPCSEYCLXHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHH
SCSRHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVXNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLVIGHQRMRGTFX
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|HM011473_Pol_P-B Product feature CHAIN HM011473_Pol_P-B of FT:mat_peptide HM011473_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFP
DIHLQEDIVDRCQQFVGPLTXNEXRRLKLIMPARFYPNVTKYXPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRTASFXGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLGKSRLGPQPAQRQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGXAVEXHHXPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYXTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLXLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011474_Pol_P-B Product feature CHAIN HM011474_Pol_P-B of FT:mat_peptide HM011474_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAXDLXLGNXNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIIDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPYPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011475_Pol_P-B Product feature CHAIN HM011475_Pol_P-B of FT:mat_peptide HM011475_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKXLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
NIHLQEDIVDRCQQFVGPLTVNEXRRLKLIMPARFYPXXTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGVLYKR
ESTRSASFCGSPYSWEQDLQHGRLVVQTSKRHGDKSFCPQSPGILPRSSVGPCIXSQLRKSRLEPQPAQGQLAGRQQGGR
GSIRARXHXSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKXADSLISTXKGHSSSGHAVELHHFPPNSSRSQSQGPV
LXCWWLQFRNSEPCSEYCLXHIVNLXEDWGPCTEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRTQYXNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLXQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|HM011476_Pol_P-B Product feature CHAIN HM011476_Pol_P-B of FT:mat_peptide HM011476_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLNLIMPARFYPNVTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLPHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRXXRLGPQPAQRQLAGRXQGGS
GSIRARVHPSPWGXVGVEPSGSGHTHNCASSSSSCLHLSAVRKAAYSLNSTSKGHSSSGHAVELHHFPPNYSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGXWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLXLYPVARQRSGLCQVFADATPTGWGLAIGHQRXRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011477_Pol_P-B Product feature CHAIN HM011477_Pol_P-B of FT:mat_peptide HM011477_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYXXFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLDVXIPWTHKVGNFTGLYSSTVPCFNPBWQTPSFP
DIHLQEDIVDRCQQFVGPLTXNENRRLKLIMPARFYPXXTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
EXTRSASFYGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPXQGQLAGRQQXGS
GSIRARVHXSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVQKAAYSLXSTSKGHSSSGHAVELHHFPPNSARSQSQGPV
LSCWWLQFRNSEPCSEYCLGHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHXPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGXWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXXQYLHLYPVARQRXGLCQVFADATPTGWGLAXGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAXLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLMXRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011478_Pol_P-B Product feature CHAIN HM011478_Pol_P-B of FT:mat_peptide HM011478_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSCQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCQQFVGPLTVNZXRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQXGXXXFXXSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGXQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHXPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHXTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIXLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXXQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011480_Pol_P-B Product feature CHAIN HM011480_Pol_P-B of FT:mat_peptide HM011480_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSPPWGIVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSDHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTEXRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011482_Pol_P-B Product feature CHAIN HM011482_Pol_P-B of FT:mat_peptide HM011482_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEXRXLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAXRQQGGS
GSIRARVHXSPWGXVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAXSLISTSXGHSSSXHAVELHHVPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSBLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
XHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGXWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|HM011483_Pol_P-B Product feature CHAIN HM011483_Pol_P-B of FT:mat_peptide HM011483_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNXSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPRIQSQLRKSRLGPQPAQGQLAXRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSPSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVPWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGXKSV
QHLESXYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXXQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011484_Pol_P-B Product feature CHAIN HM011484_Pol_P-B of FT:mat_peptide HM011484_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSSPRGTVGVEPSGSGHTHNCASSSSSCLHQSADRKAAYSLISTXKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIRMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLDLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|HM011487_Pol_P-B Product feature CHAIN HM011487_Pol_P-B of FT:mat_peptide HM011487_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDDAAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSAGILSRSPVGPCIQSQLQQSRLGPQPTQGQLAGLQQGGS
GSIRVGTHSTPWGTVGVEPSSSGHTHNCASSSTSCLHQSAGRKAAYSPLSTSKRHSSSGHAVELHHVPPNSSRSQSPGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCTEHGEHRIRTPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRIINHQHRTMPNLHD
SCSRKLYVSLMLLYKTYGRKLHLYSHPXILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVVKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKXAFTFSATYKAFLRXQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011490_Pol_P-B Product feature CHAIN HM011490_Pol_P-B of FT:mat_peptide HM011490_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIIHRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKXTYSPVSTSKRLSSSGXAVELHHVPPNSSRSQSQGSV
SSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011492_Pol_P-B Product feature CHAIN HM011492_Pol_P-B of FT:mat_peptide HM011492_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFP
BIHLQEDIIBRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGRXVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYXPVSTSKRHASSGNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCVEHGEHHIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPZKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011494_Pol_P-B Product feature CHAIN HM011494_Pol_P-B of FT:mat_peptide HM011494_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFXGSPYSWEQDLQHGRLVFQTSKRHGDKSXCPQSPGILPRSSVGPCIQSQLRKSRLGPQPXQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSXPTHNCASSSSSCLHQSAVRKAAYSLISTSKGLSSSGHAVELHHFPPNXSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIXDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQBLHX
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011496_Pol_P-B Product feature CHAIN HM011496_Pol_P-B of FT:mat_peptide HM011496_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGRLVLKTSKRHGDKSFCPQSLGILSRSPVGPCIQSQFRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASNSSSCLHQSAGREAAYSPVSTSKGHASSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIDDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARMSSNXRIINHQHXTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEXLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVTWRPP
>gnl|hbvpro|HM011499_Pol_P-B Product feature CHAIN HM011499_Pol_P-B of FT:mat_peptide HM011499_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDBEAGPLEEELPRLADEGLNRRVAEDLNLGBPXVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIIDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTXSASFCGSPYSWEQELQHGRXVLQTSTRHGDKSFSPQSSGILSRSPVGPCIQSQXRQSXLGSQLTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSXGHSHNCASSSSSCLHQSAXRKEAYSPVSTSKRHSSSGHXVELXHVPPYSSRSQSQGSV
PSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVXGAKSV
QHLESXYXAVSHFLLSLGIHLNPHKTKRWGYSLNFMGYVXGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACVQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAXSPSVPSHLPXRVHFASPLHVAWRPP
>gnl|hbvpro|HM011503_Pol_P-B Product feature CHAIN HM011503_Pol_P-B of FT:mat_peptide HM011503_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLXLDEGAGPLEEELPRLADEGLNRRVAEDLNLGXLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
BIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEHVVDHYFQTRHYLHTLWKAGILYKR
XSTHSASFYGSPYSWEQDLQHGRLVFQTSTRHGDKSVCPQSPGILPRSSVGPCIQSQLRXSRLGPQPAQGQLAGRRQGGS
GSIRARXHPSPWGAVGVEPSGSGPTHNCASSSSSCLHQSAVGKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRXQSQGPV
XSCWWLQFRNSEPCSEYCLCHIVNLXEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINBQHXTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
XHLEXLYTAVTNFLXSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAXLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM011504_Pol_P-B Product feature CHAIN HM011504_Pol_P-B of FT:mat_peptide HM011504_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLVLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLXEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQXGS
GSIRTRVHPSSWGTVGVEPSDSGHTHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHXFPPNSSRSQSQGXV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEXLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRDQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPXRVHFASPLHVAWKPP
>gnl|hbvpro|HM153811_Pol_P-B Product feature CHAIN HM153811_Pol_P-B of FT:mat_peptide HM153811_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 712005001256). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSVSGPTHNCASSSSSCLHQSAVRKAAYSLISTSEGHSSSGHAVELHHFPPNSSRSQSQDTV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDMVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRRRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700546_Pol_P-B Product feature CHAIN HQ700546_Pol_P-B of FT:mat_peptide HQ700546_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSIQGQLAGCQQGGS
GSIRARVHPSPWGLVGVEPSGSGPTHNCASSTSSCLHQSAVRKAAYSLISTSKGNSSSGHAVELHQFPSNSSRSKSQGSV
LSCWWLQFRNREPCSEYCLCHIVNLLEDWGPCTEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700548_Pol_P-B Product feature CHAIN HQ700548_Pol_P-B of FT:mat_peptide HQ700548_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGSCIQSQLRQSRLGPQPTQGQLAELQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAVRKEAYSPVSTSKRYSSSGHAVELHXVPPNSSRFQSQGSV
FSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSAGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKKCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHXRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700549_Pol_P-B Product feature CHAIN HQ700549_Pol_P-B of FT:mat_peptide HQ700549_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHNHNCASSSSSCLHQSAVRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
LPCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHLIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSXLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIALKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPXYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMCGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF412801_Pol_P-B Product feature CHAIN JF412801_Pol_P-B of FT:mat_peptide JF412801_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSLCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLFVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKICFRNLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF436921_Pol_P-B Product feature CHAIN JF436921_Pol_P-B of FT:mat_peptide JF436921_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQCFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHRDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHTSPWGTVGVEPSGSGHTHNCASSSSSRLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCNIVNLIDDWGPCTEHGDQLIRTPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQDHIAQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWTLRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLEYRPTTGRTSLYANSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF899335_Pol_P-B Product feature CHAIN JF899335_Pol_P-B of FT:mat_peptide JF899335_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKTYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDESFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGWS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN406371_Pol_P-B Product feature CHAIN JN406371_Pol_P-B of FT:mat_peptide JN406371_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPIHNRASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYVNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792893_Pol_P-B Product feature CHAIN JN792893_Pol_P-B of FT:mat_peptide JN792893_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2004). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCQQFVGPLTVNENRRLKMIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHPHISASSSSSCLRQSAGRKAAYSPFSTAKRHSSSSRAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLSHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKLYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN792894_Pol_P-B Product feature CHAIN JN792894_Pol_P-B of FT:mat_peptide JN792894_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCQQFVGPLTVNEKRRLTLIMPARFFPNTTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHPHISASSSSSCLRQSAGRKAAYSPFSTSKRHSSSSRAVELHHVPPNSSRSQSQGSV
LSCWWLQFRHSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN792895_Pol_P-B Product feature CHAIN JN792895_Pol_P-B of FT:mat_peptide JN792895_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNVSIPWTHKVGNFAGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQQLHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHSHICASSSSSCLHQSAGRKAAYSSFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSEYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAIPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSA
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN792896_Pol_P-B Product feature CHAIN JN792896_Pol_P-B of FT:mat_peptide JN792896_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQQLHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHSHICASSSSSCLHQSAGRKAAYSSFSASKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSKPCSKYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVINFLMSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN792897_Pol_P-B Product feature CHAIN JN792897_Pol_P-B of FT:mat_peptide JN792897_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGTPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLNKQYSNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792898_Pol_P-B Product feature CHAIN JN792898_Pol_P-B of FT:mat_peptide JN792898_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCKQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGTPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSNAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLNKQYSNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792899_Pol_P-B Product feature CHAIN JN792899_Pol_P-B of FT:mat_peptide JN792899_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCEQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPSVQSQLRQSRLGPQPTQRQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSACLHQSAGRKAAYSPFSTSKRHSSSSHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYSSFPWLLGCAANWILRGMSFVYVPSALNPADDPSRGRLGLYRP
ILRQPFRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN792900_Pol_P-B Product feature CHAIN JN792900_Pol_P-B of FT:mat_peptide JN792900_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIINRCEQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCVQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHISASSSSSCQHQSAGRKAAYSPLSAYKRHPSSSHAMELHHVPPNSSGSQSQGSV
LSCWWLQFRNSEPCSDYCLFHIVNLTEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKLTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN792901_Pol_P-B Product feature CHAIN JN792901_Pol_P-B of FT:mat_peptide JN792901_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQQLHHGRLVFQTSQRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHICASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSGTVELHHVPPNSSRSQSQGSV
FSCWWLQFRDSEPCSKYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSKQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLKNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN792902_Pol_P-B Product feature CHAIN JN792902_Pol_P-B of FT:mat_peptide JN792902_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQENIIDRCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQQLHHGRLVFQTSKRHGDKSFCPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSSPWGTIGVEPSGSGHTHICASSSSSCLHQSAGRKAAYSPFSTSKRHSSSSGTVELHHVPPNSSRSQSQGSV
FSCWWLQFRDSEPCSKYCLFHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQDLHD
SCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLKNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN827419_Pol_P-B Product feature CHAIN JN827419_Pol_P-B of FT:mat_peptide JN827419_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPTQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHNFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRDLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027311_Pol_P-B Product feature CHAIN JQ027311_Pol_P-B of FT:mat_peptide JQ027311_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEXGPLEEELPRLADEGLNRRVAEDLNLGNXNVSIPWTHKVGNFTGLYSSTVPSFNPXWQTPSFP
BIHLQEDIINRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPXQVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPXIQSQLRQSRLGSQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHSHNCASSSSSCLHQSAVRXXAYSPVSTSXRHSSSXHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNX
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHXPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSI
QHLEXLYAAVSXFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRXQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRISLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027312_Pol_P-B Product feature CHAIN JQ027312_Pol_P-B of FT:mat_peptide JQ027312_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLXEDIVDRCZQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEXXVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFXGXPYSWEQDLQHGRLXFQTSKRHGDKSXCPQSPGILPRSSVGPXIQSQLRKSRLGXQPAQGXLAGRXQGGS
GSIRARVHPSXWGTVGVEPSGAGPTHNCASGSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEXHHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNS
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQBLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
XHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027313_Pol_P-B Product feature CHAIN JQ027313_Pol_P-B of FT:mat_peptide JQ027313_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADDDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFP
NIHLQEDIXDRCKQXVGPLTVNEXRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVDHYFQTRHYLHTLWXAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQXGGS
GSIRVRVHPSPXGTVGVESSGSGPTHNCASSSSSCLHXSAVRKAAYSXXSTSXGHSSSXXAVELHHXPQNSSRSQSQGPV
XSCWWLQFRNSEPCSEYCLCHIVNLIXDWGPCTEXGEHXXRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGBT
RVXWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIXLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGSKSV
QHLESLYTAVXNFLMSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027315_Pol_P-B Product feature CHAIN JQ027315_Pol_P-B of FT:mat_peptide JQ027315_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHVPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQALTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ027316_Pol_P-B Product feature CHAIN JQ027316_Pol_P-B of FT:mat_peptide JQ027316_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHILWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGLQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSISGHTHNCASSSSSCLHQSAGRKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSPSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLHKQYLNLYPVARQRSGMCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027325_Pol_P-B Product feature CHAIN JQ027325_Pol_P-B of FT:mat_peptide JQ027325_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRCVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRVEGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASGSSSCLHQSAVRKAAYSLISTSKGHSSSGHTVELHHFPPNSSRSQSQGPV
PSCWWLQFRNSXPCSEYCLCHIVNLIEDWGPCTEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYETYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGAFV
SPLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLWFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027330_Pol_P-B Product feature CHAIN JQ027330_Pol_P-B of FT:mat_peptide JQ027330_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCNQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARXHPSTWGTVGMEPSGSGHTYXRASSSSSCLHQSAVRKAAYSLXSTSKGHSSSGHAVELHHXPPNSSRSQSQGPE
LSCWWLQFRNSEPCSEYCLXHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027331_Pol_P-B Product feature CHAIN JQ027331_Pol_P-B of FT:mat_peptide JQ027331_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLKEDIVDRCNQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARXHPSTWGTVGMEPSGSGHTYXRASSSSSCLHQSAVRKAAYSLXSTSKGHSSSGHAVELHHXPPNSSRSQSQGPE
LSCWWLQFRNSEPCSEYCLXHIVNLIEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRQLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ027334_Pol_P-B Product feature CHAIN JQ027334_Pol_P-B of FT:mat_peptide JQ027334_Pol_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPQFNPNWQTPSFP
DIHLQEDIVXRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETXHSASFXGSPYSWEQELQHGRLVLQTSKRHGDKSFRPQSSGILSRSPVGPCIQSQFRQSRLGPQPTQGXLAGLQQGGS
GSIRAGIHSTPWGTVGVEPSSSGHTHNCASSSSSCLHQSAGRKXAYSPVSTSKRHSSSGRXVELHXVPXNSSRSQSQGSV
PSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPXKTKRWGYSLNFMGYVIGGWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPXRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ040125_Pol_P-B Product feature CHAIN JQ040125_Pol_P-B of FT:mat_peptide JQ040125_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRIAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDXSFCPQSPGILPRSSVGPCIQSQLRKSRLGPKPAQGQLAGRQQGGN
RSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ040128_Pol_P-B Product feature CHAIN JQ040128_Pol_P-B of FT:mat_peptide JQ040128_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGBLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNXTKYLPLDKGIKPYYPEXVVXHYFQTRHYLHTLWKAGILYKR
ESTRSASFXGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSXWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHB
FCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRXRGTFV
SPLPIHTAELLAACFARSRSGAKXIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ040138_Pol_P-B Product feature CHAIN JQ040138_Pol_P-B of FT:mat_peptide JQ040138_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPAPWGTVGVEPSGSRPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
XSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPKTPARVTGGVFLVDKNPHXTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHIAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ040147_Pol_P-B Product feature CHAIN JQ040147_Pol_P-B of FT:mat_peptide JQ040147_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYIVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGLQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFSPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYQTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYXAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIRMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACXQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ040157_Pol_P-B Product feature CHAIN JQ040157_Pol_P-B of FT:mat_peptide JQ040157_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSPVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPSRVTGGVFLVDKNPXNTXESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLXWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRXINYQHGTMQDLHD
SCSRHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ040170_Pol_P-B Product feature CHAIN JQ040170_Pol_P-B of FT:mat_peptide JQ040170_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQGQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRXIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ040171_Pol_P-B Product feature CHAIN JQ040171_Pol_P-B of FT:mat_peptide JQ040171_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQXRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKVCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ040173_Pol_P-B Product feature CHAIN JQ040173_Pol_P-B of FT:mat_peptide JQ040173_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPTPWGTVGVEPSGSGTTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341549_Pol_P-B Product feature CHAIN JQ341549_Pol_P-B of FT:mat_peptide JQ341549_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFP
DIHLQEDIVDRCQQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEHDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSVRARVHSAPWGTVGVEPSGSGHTYNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLGHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHRTMQNMHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341550_Pol_P-B Product feature CHAIN JQ341550_Pol_P-B of FT:mat_peptide JQ341550_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTXNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPI
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHX
XCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341551_Pol_P-B Product feature CHAIN JQ341551_Pol_P-B of FT:mat_peptide JQ341551_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPGFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPI
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHX
SCSRXLYXSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341552_Pol_P-B Product feature CHAIN JQ341552_Pol_P-B of FT:mat_peptide JQ341552_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
FSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341553_Pol_P-B Product feature CHAIN JQ341553_Pol_P-B of FT:mat_peptide JQ341553_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVXHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPXXQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGIVGVEPSGSGXTHNCASSSXSCLHQSAVRKAAYSLXSTSKGHSSSGHXVELLHFPPNSPXSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHX
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHXNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341554_Pol_P-B Product feature CHAIN JQ341554_Pol_P-B of FT:mat_peptide JQ341554_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLXLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCNQFVGPLTVNEXRRLKLIMPARFYPNXTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGSQPTQGQLAGLQQGGS
GSIRAGIHSTPWGTVXXXXXXXXXXXXXXXXXXXXXXXXXXXKEAYSPVSTSKRHSSSGHAVELHHVPPNSSRSQSQGSV
LSCWWLQFRNSEPCSEHCLFHIVNLIEDWGPCAEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESXYAAVSNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLNKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGYQRMRGTFV
SPLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPXRVHFASPLHVAWXPP
>gnl|hbvpro|JQ341555_Pol_P-B Product feature CHAIN JQ341555_Pol_P-B of FT:mat_peptide JQ341555_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPEQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASNSSSCLHQSAVRKAAYSHISTSKGHSSTGHAVELHHFPPSSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSHSRIINNQHRTMQNMHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341556_Pol_P-B Product feature CHAIN JQ341556_Pol_P-B of FT:mat_peptide JQ341556_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIWAGVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHNFPPNSSRSQSQGPI
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINBQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKXCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXXQYLNLYPVARQRPGLCQVFADATPTGWGLAXGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCXANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ341557_Pol_P-B Product feature CHAIN JQ341557_Pol_P-B of FT:mat_peptide JQ341557_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno09). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCXQFVGPLTVNEXRRLKLIMPARFYPNVTKYLPLXKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQXAGRQQGGS
GSIRARVHPSPWGTIGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPXNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRXMQBLHD
SCSRNLYVSLMLLYKTYGXKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341558_Pol_P-B Product feature CHAIN JQ341558_Pol_P-B of FT:mat_peptide JQ341558_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGLTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341559_Pol_P-B Product feature CHAIN JQ341559_Pol_P-B of FT:mat_peptide JQ341559_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSVCPQSPGILPRSSVGPFXQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAANSLISTSKGHSSAGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHRTMQBLHX
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|JQ341560_Pol_P-B Product feature CHAIN JQ341560_Pol_P-B of FT:mat_peptide JQ341560_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIIDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSTRGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHASSGHEVELPHFPPNSSRSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ341561_Pol_P-B Product feature CHAIN JQ341561_Pol_P-B of FT:mat_peptide JQ341561_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno13). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVLQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPXQGQLAGRQPGGX
GSIRARVHSSPRGNVGVEPSGSGTTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSSHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLXHIVNLIEDWGPCTEHGEHRIRTPXTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIINNQHGTMQNLHD
SCSXXLYVSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDXVLGAKSV
QHLEALNTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXXQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLSYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ341562_Pol_P-B Product feature CHAIN JQ341562_Pol_P-B of FT:mat_peptide JQ341562_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQYFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEXRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGMEPSGSGPTHNXASSSSSCLHQSAVRKAAYSLNSTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
XSCWWLQFRNSEPCSEYCLCHIVNLIDDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAXCSVVRRAFPHCLAFSYMDDVVLGAKSV
XHLESLYXAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341563_Pol_P-B Product feature CHAIN JQ341563_Pol_P-B of FT:mat_peptide JQ341563_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQFRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQXLHB
SCSRNLYVSLMLLFKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341564_Pol_P-B Product feature CHAIN JQ341564_Pol_P-B of FT:mat_peptide JQ341564_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSSPWGTVGVEPAGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPXTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKMCFRKIPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|JQ341565_Pol_P-B Product feature CHAIN JQ341565_Pol_P-B of FT:mat_peptide JQ341565_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGBLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHXXXXXXXSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSXSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFKKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341566_Pol_P-B Product feature CHAIN JQ341566_Pol_P-B of FT:mat_peptide JQ341566_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFG
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341567_Pol_P-B Product feature CHAIN JQ341567_Pol_P-B of FT:mat_peptide JQ341567_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNVBIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
BIHLQEDVIDRCEQFVGPLTXNEXRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTIGMEPSGSGHTHBCASSSSSCLHQSAVRKAAYSLISTSKGXSSSGHXXELHHFPPNSSGSQSQGPV
LSCWWLQFRNSXPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLXVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGXHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVXKIKMCFRKXPVNXPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRXGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAXLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLXYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|JQ341568_Pol_P-B Product feature CHAIN JQ341568_Pol_P-B of FT:mat_peptide JQ341568_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
YCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQAHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ341569_Pol_P-B Product feature CHAIN JQ341569_Pol_P-B of FT:mat_peptide JQ341569_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGSQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIXDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGXYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341570_Pol_P-B Product feature CHAIN JQ341570_Pol_P-B of FT:mat_peptide JQ341570_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIIDRCKLFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSDYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFIYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341571_Pol_P-B Product feature CHAIN JQ341571_Pol_P-B of FT:mat_peptide JQ341571_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYXHFRKLLLLEDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIVDRCRQFVGPLTVNENRRLKLIMPSRFYPKVTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHXLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSERHGDKSLCPQSPGILPRSSVGPCIQSQLRKSRLXPQPTQGQLAGRQQGGS
GSIRARVHPSTWGIVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAYSPLSTSKGNPSSSHAVELHHFPPNSSRSQSQGSV
PSCWWLQFRNSKPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHN
SCSRNLYVSLMLLYKTYGWKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALXPLYACIQAKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341572_Pol_P-B Product feature CHAIN JQ341572_Pol_P-B of FT:mat_peptide JQ341572_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLSLGNLNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFP
VIHLQEDIVDRCEQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLDFQTSKRHGDKSFCPQSPGILPRSSVGPCIQTQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341573_Pol_P-B Product feature CHAIN JQ341573_Pol_P-B of FT:mat_peptide JQ341573_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSSWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSGSQSQGPV
PSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341574_Pol_P-B Product feature CHAIN JQ341574_Pol_P-B of FT:mat_peptide JQ341574_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRHQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341575_Pol_P-B Product feature CHAIN JQ341575_Pol_P-B of FT:mat_peptide JQ341575_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKHFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPVQGQLAGRQQGGS
GSIRARVHPSPWGTVGVESSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELNHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHGTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFM
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341576_Pol_P-B Product feature CHAIN JQ341576_Pol_P-B of FT:mat_peptide JQ341576_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYPHFRRILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNVNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFFGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILSRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSTWGTVGVEPSGSGHTHICASSSSSCLHQSAVRKAAYSLISTSKGHTSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLXHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHWTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSE
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRXYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLVYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ341577_Pol_P-B Product feature CHAIN JQ341577_Pol_P-B of FT:mat_peptide JQ341577_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHXIRXPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGXKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLXSLGIHXNPHKTKRWGYSLNFMGYVIGSWGTLPQKHIVEKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341578_Pol_P-B Product feature CHAIN JQ341578_Pol_P-B of FT:mat_peptide JQ341578_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPFPWGTVGVEPSGSGPTNNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEFCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341579_Pol_P-B Product feature CHAIN JQ341579_Pol_P-B of FT:mat_peptide JQ341579_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCNQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGHTCNCASSSSSCLHQSAVRQAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRHLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSNQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341580_Pol_P-B Product feature CHAIN JQ341580_Pol_P-B of FT:mat_peptide JQ341580_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGHLAGRQQGGS
GSLRARVHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQXLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLYAAVTNFLXSLGIHXNPHKTKRWGYSLNFMGYVIGGWGSLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341581_Pol_P-B Product feature CHAIN JQ341581_Pol_P-B of FT:mat_peptide JQ341581_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLREDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRXVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRXQGGS
GSIRARVHPSXWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHXVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLSHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVXKIKTCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341582_Pol_P-B Product feature CHAIN JQ341582_Pol_P-B of FT:mat_peptide JQ341582_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGR
GSIRARVHSSPWGTVGVEPSGSGHTHNYASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHXXELHHFPPNSSRSQSQGPV
XSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHXIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
YCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341583_Pol_P-B Product feature CHAIN JQ341583_Pol_P-B of FT:mat_peptide JQ341583_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNVSIPWTHKXGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVELSGSGPTHNCASSSSSCLHQSAVRKAAYSLIPTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|JQ341584_Pol_P-B Product feature CHAIN JQ341584_Pol_P-B of FT:mat_peptide JQ341584_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTIPCFNPNWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLEPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWXLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341585_Pol_P-B Product feature CHAIN JQ341585_Pol_P-B of FT:mat_peptide JQ341585_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno37). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGCQQGGS
GSIRARVHPSPWGLVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHLIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLFVSLMLLYKTYGRKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWSPP
>gnl|hbvpro|JQ341586_Pol_P-B Product feature CHAIN JQ341586_Pol_P-B of FT:mat_peptide JQ341586_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHXVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPXTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQQHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLFYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341587_Pol_P-B Product feature CHAIN JQ341587_Pol_P-B of FT:mat_peptide JQ341587_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNINVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRCXFQTSKRHGDKSXCPQSPGILPRSSVGPFVQSQLRKSRLGPQPAQGQLAGRQQGGS
GGIRARVHPSXRGTVGVEPSGSGPTHNCASRSSSCLHQSAVRKEAYSLISXSKGHASSGRAVELHHFPPNSSXSQSTGPV
LSCWWLQFRNSKPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINBQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGXKTV
QHLESIYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341588_Pol_P-B Product feature CHAIN JQ341588_Pol_P-B of FT:mat_peptide JQ341588_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIXDRCKQFVGPLTRNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSPQGLLAGCQQGGS
GSIRARVHPSPWGLVGVEPSGSGHTHDCASSTSSCLHQSAVRKAAYSRISTSKGHASSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSKPCSXYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGSLPQEHIVQKIKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRISGTFV
SPLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFLYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341589_Pol_P-B Product feature CHAIN JQ341589_Pol_P-B of FT:mat_peptide JQ341589_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFP
DIHLQEDIVDRCKQFVGSLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQELQHGRLVFQTSKRHGDKSFCPQSTGILPRSSVGPCIQSQLRKSRLGPQSTQGQLAGCQQGGS
GSIRARVHPSPWGVVGVEPSGSGHTHNCASSTSSCLHQSAVRKTAYSLISTSKGHSSSGHAVELHHFPSNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLXHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGSLPQEHIIQKLKLCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRXQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVTWRPP
>gnl|hbvpro|JQ341590_Pol_P-B Product feature CHAIN JQ341590_Pol_P-B of FT:mat_peptide JQ341590_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPXFNPKWQTPSFP
DIHLQEDIVNRCEQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGLQQGGS
GSIRAGIHSPPWGTVGVEPSSSGHTYNCASSSSSCLHQSAVRKEAYSPVSTSKRHSPSGHAVELHHVPPNSSRSQSQGSV
FSCWWLQFRNSEPCSDHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKXPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTHFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIXLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLNKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341591_Pol_P-B Product feature CHAIN JQ341591_Pol_P-B of FT:mat_peptide JQ341591_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQSAQGQLAGRQQGGS
GXIRARVHPSPWGTVGVEPSGSGHTHNCASSSSSCLHQSAVRKAAXSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ341593_Pol_P-B Product feature CHAIN JQ341593_Pol_P-B of FT:mat_peptide JQ341593_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
NIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLVEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341594_Pol_P-B Product feature CHAIN JQ341594_Pol_P-B of FT:mat_peptide JQ341594_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLXXEAGPLEEELPRLADEGLNRRVAEDLXLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGXEPSGSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNTSRSQSQGSV
XSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPXILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESXYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLXFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341595_Pol_P-B Product feature CHAIN JQ341595_Pol_P-B of FT:mat_peptide JQ341595_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFP
DIHLQEDIVDRCKQFVGPLTVNEXRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHXLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRPSVGPCIQSQLXKSRLGPQPAQGQLAGRQQGGS
GSIRARVHSSPWGXVGVEPSGSGHTYNCASSSSSCLHQSAVRKAAYSHISTSKGHSSSGHAVELHHFPSNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIXDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNXTESRLVVDFSQFSRGNX
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHXTMQNLHB
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESIYAAVTNFLMXLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQEHIVQKIKTCFRKLPVNRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLLYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341596_Pol_P-B Product feature CHAIN JQ341596_Pol_P-B of FT:mat_peptide JQ341596_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPNFNPBWQTPSFP
DIHLREDIVDRCEQFVGPLTINEXRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHXLWKAGILYKR
ETTRSASFCGSPYSWEQEIQHGRLVFQTSKRHGDKSFCPQSTGIXPRSSVGPCIQSQLRKSRLGPQSTQGHLAGRQQGGS
GSIRARXHPSPWGPVGVEPSGSGHTHNCASSTSSCLHQSAVRKAAYSLISTSKGHSSSGHAVEFHHFPSNSSRSQSQGSV
LSCWWLQFRNSEPCSEYCLCHIVNLLEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRTMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAXCSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYXAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGSLPQEHIVQKIKSCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRXQYLXLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341597_Pol_P-B Product feature CHAIN JQ341597_Pol_P-B of FT:mat_peptide JQ341597_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLILPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHXRLVLQTSKRHGDKSXRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTIGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGHAXELHXVPPNSARSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRIMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341598_Pol_P-B Product feature CHAIN JQ341598_Pol_P-B of FT:mat_peptide JQ341598_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKTYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGPCIQSQLRKSRLGPQPAQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSGSXHTHTCASSSSSCLHQSAVRTAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINDQHRTMQNLHN
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPHKTTRWGYSLNFMGYVIGGWGTLPQDHIVHKIKMCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLXYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341599_Pol_P-B Product feature CHAIN JQ341599_Pol_P-B of FT:mat_peptide JQ341599_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFP
DIHLQEDIINRCEQFVGPLTVNENRRLKLILPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHXRLVLQTSKRHGDKSXRPQSSGILSRSPVGPCIQSQLRQSRLGPQPTQGQLAGRQQGGS
GSIRAGIHSTPWGTIGVEPSSSGHTHNCANSSSSCLHQSAVRKEAYSPVSTSKRHSSSGHAXELHXVPPNSARSQSQGSV
LSCWWLQFRNSKPCSEHCLFHIVNLIEDWGPCAEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHRIMQNLHD
SCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYAAVTNFLLSLGIHLNPQKTKRWGYSLNFMGYVIGSWGTLPQEHIVSKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLHKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ341600_Pol_P-B Product feature CHAIN JQ341600_Pol_P-B of FT:mat_peptide JQ341600_Pol_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQCFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFP
DIHLQEDIVDRCEQFVGPLTVNENRRLKLIMPARFYPXATKYLPLDKGIKPYYPEYVVNHYFQTRHYLHLLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSKRHGDKSFCPQSPGILPRSSVGSCIQSQLRKSRLGPQPSQGQLAGRQQGGS
GSIRARVHPSPWGTVGVEPSSSGPTHNCASSSSSCLHQSAVRKAAYSLISTSKGHSSSGHAVELHHFPPNSSRSQSQGPV
LSCWWLQFRNSEPCSEYCLCHIVNLIEDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RV