HBVdb

Dataset for protein SHBs of genotype B

[Download (right click)] [Alignment] [Repertoires]

5994 sequence(s)

>gnl|hbvpro|AB010289_SHBs_P-B Product feature CHAIN AB010289_SHBs_P-B of FT:mat_peptide AB010289_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB010290_SHBs_P-B Product feature CHAIN AB010290_SHBs_P-B of FT:mat_peptide AB010290_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|AB010291_SHBs_P-B Product feature CHAIN AB010291_SHBs_P-B of FT:mat_peptide AB010291_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|AB010292_SHBs_P-B Product feature CHAIN AB010292_SHBs_P-B of FT:mat_peptide AB010292_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB014366_SHBs_P-B Product feature CHAIN AB014366_SHBs_P-B of FT:mat_peptide AB014366_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 07D07HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB030509_SHBs_P-B Product feature CHAIN AB030509_SHBs_P-B of FT:mat_peptide AB030509_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBNP3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB031266_SHBs_P-B Product feature CHAIN AB031266_SHBs_P-B of FT:mat_peptide AB031266_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB031267_SHBs_P-B Product feature CHAIN AB031267_SHBs_P-B of FT:mat_peptide AB031267_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMFPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB033554_SHBs_P-B Product feature CHAIN AB033554_SHBs_P-B of FT:mat_peptide AB033554_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB033555_SHBs_P-B Product feature CHAIN AB033555_SHBs_P-B of FT:mat_peptide AB033555_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB048705_SHBs_P-B Product feature CHAIN AB048705_SHBs_P-B of FT:mat_peptide AB048705_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB073821_SHBs_P-B Product feature CHAIN AB073821_SHBs_P-B of FT:mat_peptide AB073821_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073822_SHBs_P-B Product feature CHAIN AB073822_SHBs_P-B of FT:mat_peptide AB073822_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073823_SHBs_P-B Product feature CHAIN AB073823_SHBs_P-B of FT:mat_peptide AB073823_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNLQSPISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073824_SHBs_P-B Product feature CHAIN AB073824_SHBs_P-B of FT:mat_peptide AB073824_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNTLKPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073825_SHBs_P-B Product feature CHAIN AB073825_SHBs_P-B of FT:mat_peptide AB073825_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073826_SHBs_P-B Product feature CHAIN AB073826_SHBs_P-B of FT:mat_peptide AB073826_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073827_SHBs_P-B Product feature CHAIN AB073827_SHBs_P-B of FT:mat_peptide AB073827_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073828_SHBs_P-B Product feature CHAIN AB073828_SHBs_P-B of FT:mat_peptide AB073828_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073829_SHBs_P-B Product feature CHAIN AB073829_SHBs_P-B of FT:mat_peptide AB073829_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073830_SHBs_P-B Product feature CHAIN AB073830_SHBs_P-B of FT:mat_peptide AB073830_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073831_SHBs_P-B Product feature CHAIN AB073831_SHBs_P-B of FT:mat_peptide AB073831_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073832_SHBs_P-B Product feature CHAIN AB073832_SHBs_P-B of FT:mat_peptide AB073832_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073833_SHBs_P-B Product feature CHAIN AB073833_SHBs_P-B of FT:mat_peptide AB073833_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFXSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073834_SHBs_P-B Product feature CHAIN AB073834_SHBs_P-B of FT:mat_peptide AB073834_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073835_SHBs_P-B Product feature CHAIN AB073835_SHBs_P-B of FT:mat_peptide AB073835_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073836_SHBs_P-B Product feature CHAIN AB073836_SHBs_P-B of FT:mat_peptide AB073836_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073837_SHBs_P-B Product feature CHAIN AB073837_SHBs_P-B of FT:mat_peptide AB073837_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073838_SHBs_P-B Product feature CHAIN AB073838_SHBs_P-B of FT:mat_peptide AB073838_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073839_SHBs_P-B Product feature CHAIN AB073839_SHBs_P-B of FT:mat_peptide AB073839_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=226 residues).
METISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDPLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073840_SHBs_P-B Product feature CHAIN AB073840_SHBs_P-B of FT:mat_peptide AB073840_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWXTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWXVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073841_SHBs_P-B Product feature CHAIN AB073841_SHBs_P-B of FT:mat_peptide AB073841_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073842_SHBs_P-B Product feature CHAIN AB073842_SHBs_P-B of FT:mat_peptide AB073842_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073843_SHBs_P-B Product feature CHAIN AB073843_SHBs_P-B of FT:mat_peptide AB073843_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073844_SHBs_P-B Product feature CHAIN AB073844_SHBs_P-B of FT:mat_peptide AB073844_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073845_SHBs_P-B Product feature CHAIN AB073845_SHBs_P-B of FT:mat_peptide AB073845_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073846_SHBs_P-B Product feature CHAIN AB073846_SHBs_P-B of FT:mat_peptide AB073846_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073847_SHBs_P-B Product feature CHAIN AB073847_SHBs_P-B of FT:mat_peptide AB073847_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCPGRNSQSQISSHSPISCPPICPGYRWMCLRRS
IIFLCILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073848_SHBs_P-B Product feature CHAIN AB073848_SHBs_P-B of FT:mat_peptide AB073848_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073849_SHBs_P-B Product feature CHAIN AB073849_SHBs_P-B of FT:mat_peptide AB073849_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQCQISSHSPTFCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073850_SHBs_P-B Product feature CHAIN AB073850_SHBs_P-B of FT:mat_peptide AB073850_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073851_SHBs_P-B Product feature CHAIN AB073851_SHBs_P-B of FT:mat_peptide AB073851_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRLMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGNFTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFFWLSLLVPFVQWFVGLSPTVWLLVTWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073852_SHBs_P-B Product feature CHAIN AB073852_SHBs_P-B of FT:mat_peptide AB073852_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073853_SHBs_P-B Product feature CHAIN AB073853_SHBs_P-B of FT:mat_peptide AB073853_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDLWWTSLSFLGEPPVCHGQNSQCQICSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB073854_SHBs_P-B Product feature CHAIN AB073854_SHBs_P-B of FT:mat_peptide AB073854_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPPICPGYRWMYLRRF
IIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073855_SHBs_P-B Product feature CHAIN AB073855_SHBs_P-B of FT:mat_peptide AB073855_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB073856_SHBs_P-B Product feature CHAIN AB073856_SHBs_P-B of FT:mat_peptide AB073856_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry46). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073857_SHBs_P-B Product feature CHAIN AB073857_SHBs_P-B of FT:mat_peptide AB073857_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQARFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB073858_SHBs_P-B Product feature CHAIN AB073858_SHBs_P-B of FT:mat_peptide AB073858_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB100695_SHBs_P-B Product feature CHAIN AB100695_SHBs_P-B of FT:mat_peptide AB100695_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB106884_SHBs_P-B Product feature CHAIN AB106884_SHBs_P-B of FT:mat_peptide AB106884_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB115551_SHBs_P-B Product feature CHAIN AB115551_SHBs_P-B of FT:mat_peptide AB115551_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB117759_SHBs_P-B Product feature CHAIN AB117759_SHBs_P-B of FT:mat_peptide AB117759_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCPGQNSQSQIFSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARNPSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB195933_SHBs_P-B Product feature CHAIN AB195933_SHBs_P-B of FT:mat_peptide AB195933_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB195934_SHBs_P-B Product feature CHAIN AB195934_SHBs_P-B of FT:mat_peptide AB195934_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB195935_SHBs_P-B Product feature CHAIN AB195935_SHBs_P-B of FT:mat_peptide AB195935_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205119_SHBs_P-B Product feature CHAIN AB205119_SHBs_P-B of FT:mat_peptide AB205119_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLMPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205120_SHBs_P-B Product feature CHAIN AB205120_SHBs_P-B of FT:mat_peptide AB205120_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205121_SHBs_P-B Product feature CHAIN AB205121_SHBs_P-B of FT:mat_peptide AB205121_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB205122_SHBs_P-B Product feature CHAIN AB205122_SHBs_P-B of FT:mat_peptide AB205122_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMFPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLLVYI
>gnl|hbvpro|AB212625_SHBs_P-B Product feature CHAIN AB212625_SHBs_P-B of FT:mat_peptide AB212625_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB212626_SHBs_P-B Product feature CHAIN AB212626_SHBs_P-B of FT:mat_peptide AB212626_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MGNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMVPSCCCTKPTDRNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219426_SHBs_P-B Product feature CHAIN AB219426_SHBs_P-B of FT:mat_peptide AB219426_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|AB219427_SHBs_P-B Product feature CHAIN AB219427_SHBs_P-B of FT:mat_peptide AB219427_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRS
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTEGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219428_SHBs_C-B Product feature CHAIN AB219428_SHBs_C-B of FT:mat_peptide AB219428_SHBs_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219429_SHBs_P-B Product feature CHAIN AB219429_SHBs_P-B of FT:mat_peptide AB219429_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDFQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB219430_SHBs_P-B Product feature CHAIN AB219430_SHBs_P-B of FT:mat_peptide AB219430_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB231909_SHBs_P-B Product feature CHAIN AB231909_SHBs_P-B of FT:mat_peptide AB231909_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB232112_SHBs_P-B Product feature CHAIN AB232112_SHBs_P-B of FT:mat_peptide AB232112_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MY808). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB232506_SHBs_P-B Product feature CHAIN AB232506_SHBs_P-B of FT:mat_peptide AB232506_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TH81). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLNSLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPILFCLWVYI
>gnl|hbvpro|AB232519_SHBs_P-B Product feature CHAIN AB232519_SHBs_P-B of FT:mat_peptide AB232519_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TH62). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB241116_SHBs_P-B Product feature CHAIN AB241116_SHBs_P-B of FT:mat_peptide AB241116_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB241117_SHBs_P-B Product feature CHAIN AB241117_SHBs_P-B of FT:mat_peptide AB241117_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246339_SHBs_P-B Product feature CHAIN AB246339_SHBs_P-B of FT:mat_peptide AB246339_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246340_SHBs_P-B Product feature CHAIN AB246340_SHBs_P-B of FT:mat_peptide AB246340_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246341_SHBs_P-B Product feature CHAIN AB246341_SHBs_P-B of FT:mat_peptide AB246341_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246342_SHBs_P-B Product feature CHAIN AB246342_SHBs_P-B of FT:mat_peptide AB246342_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB246343_SHBs_P-B Product feature CHAIN AB246343_SHBs_P-B of FT:mat_peptide AB246343_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWLTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253402_SHBs_P-B Product feature CHAIN AB253402_SHBs_P-B of FT:mat_peptide AB253402_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGLLPVCPLIPGSSTTSTGPCITCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253403_SHBs_P-B Product feature CHAIN AB253403_SHBs_P-B of FT:mat_peptide AB253403_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253404_SHBs_P-B Product feature CHAIN AB253404_SHBs_P-B of FT:mat_peptide AB253404_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC48). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253405_SHBs_P-B Product feature CHAIN AB253405_SHBs_P-B of FT:mat_peptide AB253405_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC58). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB253406_SHBs_P-B Product feature CHAIN AB253406_SHBs_P-B of FT:mat_peptide AB253406_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC59). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253410_SHBs_P-B Product feature CHAIN AB253410_SHBs_P-B of FT:mat_peptide AB253410_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC63). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253413_SHBs_P-B Product feature CHAIN AB253413_SHBs_P-B of FT:mat_peptide AB253413_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC95). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253414_SHBs_P-B Product feature CHAIN AB253414_SHBs_P-B of FT:mat_peptide AB253414_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VC97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253608_SHBs_P-B Product feature CHAIN AB253608_SHBs_P-B of FT:mat_peptide AB253608_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV72). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253609_SHBs_P-B Product feature CHAIN AB253609_SHBs_P-B of FT:mat_peptide AB253609_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV73). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB253610_SHBs_P-B Product feature CHAIN AB253610_SHBs_P-B of FT:mat_peptide AB253610_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV77). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB253613_SHBs_P-B Product feature CHAIN AB253613_SHBs_P-B of FT:mat_peptide AB253613_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|AB253614_SHBs_P-B Product feature CHAIN AB253614_SHBs_P-B of FT:mat_peptide AB253614_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV86). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWYWGPNLYNTLSPFMPLLPIFFSLWVYI
>gnl|hbvpro|AB253616_SHBs_P-B Product feature CHAIN AB253616_SHBs_P-B of FT:mat_peptide AB253616_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV88). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWYWGPNLYNTLSPFMPLLPIFFSLWVYI
>gnl|hbvpro|AB253617_SHBs_P-B Product feature CHAIN AB253617_SHBs_P-B of FT:mat_peptide AB253617_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253618_SHBs_P-B Product feature CHAIN AB253618_SHBs_P-B of FT:mat_peptide AB253618_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB253619_SHBs_P-B Product feature CHAIN AB253619_SHBs_P-B of FT:mat_peptide AB253619_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV92). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB253621_SHBs_P-B Product feature CHAIN AB253621_SHBs_P-B of FT:mat_peptide AB253621_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV94). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB253622_SHBs_P-B Product feature CHAIN AB253622_SHBs_P-B of FT:mat_peptide AB253622_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TV95). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB287314_SHBs_P-B Product feature CHAIN AB287314_SHBs_P-B of FT:mat_peptide AB287314_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287315_SHBs_P-B Product feature CHAIN AB287315_SHBs_P-B of FT:mat_peptide AB287315_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287316_SHBs_P-B Product feature CHAIN AB287316_SHBs_P-B of FT:mat_peptide AB287316_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGPNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|AB287317_SHBs_P-B Product feature CHAIN AB287317_SHBs_P-B of FT:mat_peptide AB287317_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287318_SHBs_P-B Product feature CHAIN AB287318_SHBs_P-B of FT:mat_peptide AB287318_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB287319_SHBs_P-B Product feature CHAIN AB287319_SHBs_P-B of FT:mat_peptide AB287319_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287320_SHBs_P-B Product feature CHAIN AB287320_SHBs_P-B of FT:mat_peptide AB287320_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287321_SHBs_P-B Product feature CHAIN AB287321_SHBs_P-B of FT:mat_peptide AB287321_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB287322_SHBs_P-B Product feature CHAIN AB287322_SHBs_P-B of FT:mat_peptide AB287322_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287323_SHBs_P-B Product feature CHAIN AB287323_SHBs_P-B of FT:mat_peptide AB287323_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEMPGCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILRPFTPLLPIFLCLWVYI
>gnl|hbvpro|AB287324_SHBs_P-B Product feature CHAIN AB287324_SHBs_P-B of FT:mat_peptide AB287324_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-5). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGTPVCLGQNLQSQISSHSPTCCPPICPGYPWMCRRRF
IISLYILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLFPTVWLSVIWMIWYWGPSLNTILSPFMPRLLIFFCLWVYI
>gnl|hbvpro|AB287325_SHBs_P-B Product feature CHAIN AB287325_SHBs_P-B of FT:mat_peptide AB287325_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLCTILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB287326_SHBs_P-B Product feature CHAIN AB287326_SHBs_P-B of FT:mat_peptide AB287326_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB287327_SHBs_P-B Product feature CHAIN AB287327_SHBs_P-B of FT:mat_peptide AB287327_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287328_SHBs_P-B Product feature CHAIN AB287328_SHBs_P-B of FT:mat_peptide AB287328_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB287329_SHBs_P-B Product feature CHAIN AB287329_SHBs_P-B of FT:mat_peptide AB287329_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB289695_SHBs_P-B Product feature CHAIN AB289695_SHBs_P-B of FT:mat_peptide AB289695_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB289696_SHBs_P-B Product feature CHAIN AB289696_SHBs_P-B of FT:mat_peptide AB289696_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB289713_SHBs_P-B Product feature CHAIN AB289713_SHBs_P-B of FT:mat_peptide AB289713_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYGGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB289730_SHBs_P-B Product feature CHAIN AB289730_SHBs_P-B of FT:mat_peptide AB289730_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB289732_SHBs_P-B Product feature CHAIN AB289732_SHBs_P-B of FT:mat_peptide AB289732_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB289738_SHBs_P-B Product feature CHAIN AB289738_SHBs_P-B of FT:mat_peptide AB289738_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 47). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPRSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVXLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB300364_SHBs_P-B Product feature CHAIN AB300364_SHBs_P-B of FT:mat_peptide AB300364_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB300370_SHBs_P-B Product feature CHAIN AB300370_SHBs_P-B of FT:mat_peptide AB300370_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRHF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB300371_SHBs_P-B Product feature CHAIN AB300371_SHBs_P-B of FT:mat_peptide AB300371_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302095_SHBs_P-B Product feature CHAIN AB302095_SHBs_P-B of FT:mat_peptide AB302095_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQTSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSSIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB302942_SHBs_P-B Product feature CHAIN AB302942_SHBs_P-B of FT:mat_peptide AB302942_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302943_SHBs_P-B Product feature CHAIN AB302943_SHBs_P-B of FT:mat_peptide AB302943_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302944_SHBs_P-B Product feature CHAIN AB302944_SHBs_P-B of FT:mat_peptide AB302944_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB302945_SHBs_P-B Product feature CHAIN AB302945_SHBs_P-B of FT:mat_peptide AB302945_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPVQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB362933_SHBs_P-B Product feature CHAIN AB362933_SHBs_P-B of FT:mat_peptide AB362933_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTECLGQNSQFQISNHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB365441_SHBs_P-B Product feature CHAIN AB365441_SHBs_P-B of FT:mat_peptide AB365441_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL431). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB365445_SHBs_P-B Product feature CHAIN AB365445_SHBs_P-B of FT:mat_peptide AB365445_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB368295_SHBs_P-B Product feature CHAIN AB368295_SHBs_P-B of FT:mat_peptide AB368295_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB471854_SHBs_P-B Product feature CHAIN AB471854_SHBs_P-B of FT:mat_peptide AB471854_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWNSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB471855_SHBs_P-B Product feature CHAIN AB471855_SHBs_P-B of FT:mat_peptide AB471855_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB493827_SHBs_P-B Product feature CHAIN AB493827_SHBs_P-B of FT:mat_peptide AB493827_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB493833_SHBs_P-B Product feature CHAIN AB493833_SHBs_P-B of FT:mat_peptide AB493833_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVFI
>gnl|hbvpro|AB493835_SHBs_P-B Product feature CHAIN AB493835_SHBs_P-B of FT:mat_peptide AB493835_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB555498_SHBs_P-B Product feature CHAIN AB555498_SHBs_P-B of FT:mat_peptide AB555498_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB555499_SHBs_P-B Product feature CHAIN AB555499_SHBs_P-B of FT:mat_peptide AB555499_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLPGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB642093_SHBs_P-B Product feature CHAIN AB642093_SHBs_P-B of FT:mat_peptide AB642093_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWXXXFWGPXLXNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|AB642094_SHBs_P-B Product feature CHAIN AB642094_SHBs_P-B of FT:mat_peptide AB642094_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB642101_SHBs_P-B Product feature CHAIN AB642101_SHBs_P-B of FT:mat_peptide AB642101_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT2009-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGEAPVCPGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLGLLDYHGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB675676_SHBs_P-B Product feature CHAIN AB675676_SHBs_P-B of FT:mat_peptide AB675676_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713527_SHBs_P-B Product feature CHAIN AB713527_SHBs_P-B of FT:mat_peptide AB713527_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713528_SHBs_P-B Product feature CHAIN AB713528_SHBs_P-B of FT:mat_peptide AB713528_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713529_SHBs_P-B Product feature CHAIN AB713529_SHBs_P-B of FT:mat_peptide AB713529_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv68). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713530_SHBs_P-B Product feature CHAIN AB713530_SHBs_P-B of FT:mat_peptide AB713530_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSWCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSGLSLLVPFVQWFVGLSPPVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB713531_SHBs_P-B Product feature CHAIN AB713531_SHBs_P-B of FT:mat_peptide AB713531_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=226 residues).
MEDIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLAPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB809488_SHBs_P-B Product feature CHAIN AB809488_SHBs_P-B of FT:mat_peptide AB809488_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGESPVCLGQNSQSQICSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLALLDSQGMLPTCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPQSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCTILRPFIPLLPIFCCLWVYI
>gnl|hbvpro|AB809524_SHBs_P-B Product feature CHAIN AB809524_SHBs_P-B of FT:mat_peptide AB809524_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ibaragi-s-2006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRS
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSAIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB809526_SHBs_P-B Product feature CHAIN AB809526_SHBs_P-B of FT:mat_peptide AB809526_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Iwate-S-2006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB809529_SHBs_P-B Product feature CHAIN AB809529_SHBs_P-B of FT:mat_peptide AB809529_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Aichi1-S-2006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAAFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB809552_SHBs_P-B Product feature CHAIN AB809552_SHBs_P-B of FT:mat_peptide AB809552_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Aichi2-S-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQCQISSHSPTFCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB828708_SHBs_P-B Product feature CHAIN AB828708_SHBs_P-B of FT:mat_peptide AB828708_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HB12-0626). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900095_SHBs_P-B Product feature CHAIN AB900095_SHBs_P-B of FT:mat_peptide AB900095_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQICSHLPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|AB900096_SHBs_P-B Product feature CHAIN AB900096_SHBs_P-B of FT:mat_peptide AB900096_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB900097_SHBs_P-B Product feature CHAIN AB900097_SHBs_P-B of FT:mat_peptide AB900097_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|AB900098_SHBs_P-B Product feature CHAIN AB900098_SHBs_P-B of FT:mat_peptide AB900098_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AB900102_SHBs_P-B Product feature CHAIN AB900102_SHBs_P-B of FT:mat_peptide AB900102_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900103_SHBs_P-B Product feature CHAIN AB900103_SHBs_P-B of FT:mat_peptide AB900103_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQICSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900104_SHBs_P-B Product feature CHAIN AB900104_SHBs_P-B of FT:mat_peptide AB900104_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900105_SHBs_P-B Product feature CHAIN AB900105_SHBs_P-B of FT:mat_peptide AB900105_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQCQISSHSPTCCPPTCPGYXWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900106_SHBs_P-B Product feature CHAIN AB900106_SHBs_P-B of FT:mat_peptide AB900106_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900107_SHBs_P-B Product feature CHAIN AB900107_SHBs_P-B of FT:mat_peptide AB900107_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFVLWVYI
>gnl|hbvpro|AB900108_SHBs_P-B Product feature CHAIN AB900108_SHBs_P-B of FT:mat_peptide AB900108_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900110_SHBs_P-B Product feature CHAIN AB900110_SHBs_P-B of FT:mat_peptide AB900110_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB900111_SHBs_P-B Product feature CHAIN AB900111_SHBs_P-B of FT:mat_peptide AB900111_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMFLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900112_SHBs_P-B Product feature CHAIN AB900112_SHBs_P-B of FT:mat_peptide AB900112_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLXLWVYI
>gnl|hbvpro|AB931168_SHBs_P-B Product feature CHAIN AB931168_SHBs_P-B of FT:mat_peptide AB931168_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGVPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRS
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB931169_SHBs_P-B Product feature CHAIN AB931169_SHBs_P-B of FT:mat_peptide AB931169_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGVPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLCNILSPFMPLLPIFCCLWVFI
>gnl|hbvpro|AB976562_SHBs_P-B Product feature CHAIN AB976562_SHBs_P-B of FT:mat_peptide AB976562_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPVLPIFFCLWVYI
>gnl|hbvpro|AF013629_SHBs_P-B Product feature CHAIN AF013629_SHBs_P-B of FT:mat_peptide AF013629_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPISFCLWVYI
>gnl|hbvpro|AF013630_SHBs_P-B Product feature CHAIN AF013630_SHBs_P-B of FT:mat_peptide AF013630_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEKIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPISFCLWVYI
>gnl|hbvpro|AF061527_SHBs_P-B Product feature CHAIN AF061527_SHBs_P-B of FT:mat_peptide AF061527_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xf8298). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPSCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF100308_SHBs_P-B Product feature CHAIN AF100308_SHBs_P-B of FT:mat_peptide AF100308_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF100309_SHBs_P-B Product feature CHAIN AF100309_SHBs_P-B of FT:mat_peptide AF100309_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121243_SHBs_P-B Product feature CHAIN AF121243_SHBs_P-B of FT:mat_peptide AF121243_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121244_SHBs_P-B Product feature CHAIN AF121244_SHBs_P-B of FT:mat_peptide AF121244_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF121245_SHBs_P-B Product feature CHAIN AF121245_SHBs_P-B of FT:mat_peptide AF121245_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121246_SHBs_P-B Product feature CHAIN AF121246_SHBs_P-B of FT:mat_peptide AF121246_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121247_SHBs_P-B Product feature CHAIN AF121247_SHBs_P-B of FT:mat_peptide AF121247_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121248_SHBs_P-B Product feature CHAIN AF121248_SHBs_P-B of FT:mat_peptide AF121248_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121249_SHBs_P-B Product feature CHAIN AF121249_SHBs_P-B of FT:mat_peptide AF121249_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121250_SHBs_P-B Product feature CHAIN AF121250_SHBs_P-B of FT:mat_peptide AF121250_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF121251_SHBs_P-B Product feature CHAIN AF121251_SHBs_P-B of FT:mat_peptide AF121251_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGQTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLCNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF134137_SHBs_P-B Product feature CHAIN AF134137_SHBs_P-B of FT:mat_peptide AF134137_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=228 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCFGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLNYQGMLPVCPLIPGSSTTSTGPCRNTTCTTPAQGTSMFPSCCCTKPTDRNCTCIPIPSSWAF
AKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFYGLWVYI
>gnl|hbvpro|AF279464_SHBs_P-B Product feature CHAIN AF279464_SHBs_P-B of FT:mat_peptide AF279464_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF282917_SHBs_P-B Product feature CHAIN AF282917_SHBs_P-B of FT:mat_peptide AF282917_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AF282918_SHBs_P-B Product feature CHAIN AF282918_SHBs_P-B of FT:mat_peptide AF282918_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF397207_SHBs_P-B Product feature CHAIN AF397207_SHBs_P-B of FT:mat_peptide AF397207_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF411291_SHBs_P-B Product feature CHAIN AF411291_SHBs_P-B of FT:mat_peptide AF411291_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRL
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTRTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF415217_SHBs_P-B Product feature CHAIN AF415217_SHBs_P-B of FT:mat_peptide AF415217_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQRNSTLPSCCCTKPTDGNCTCIXIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF415222_SHBs_P-B Product feature CHAIN AF415222_SHBs_P-B of FT:mat_peptide AF415222_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=228 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKRGTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAF
AKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF461360_SHBs_P-B Product feature CHAIN AF461360_SHBs_P-B of FT:mat_peptide AF461360_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AF479684_SHBs_P-B Product feature CHAIN AF479684_SHBs_P-B of FT:mat_peptide AF479684_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AJ627225_SHBs_P-B Product feature CHAIN AJ627225_SHBs_P-B of FT:mat_peptide AJ627225_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011084_SHBs_P-B Product feature CHAIN AP011084_SHBs_P-B of FT:mat_peptide AP011084_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWSVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011085_SHBs_P-B Product feature CHAIN AP011085_SHBs_P-B of FT:mat_peptide AP011085_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011086_SHBs_P-B Product feature CHAIN AP011086_SHBs_P-B of FT:mat_peptide AP011086_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011087_SHBs_P-B Product feature CHAIN AP011087_SHBs_P-B of FT:mat_peptide AP011087_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011088_SHBs_P-B Product feature CHAIN AP011088_SHBs_P-B of FT:mat_peptide AP011088_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011089_SHBs_P-B Product feature CHAIN AP011089_SHBs_P-B of FT:mat_peptide AP011089_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AP011090_SHBs_P-B Product feature CHAIN AP011090_SHBs_P-B of FT:mat_peptide AP011090_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011091_SHBs_P-B Product feature CHAIN AP011091_SHBs_P-B of FT:mat_peptide AP011091_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011092_SHBs_P-B Product feature CHAIN AP011092_SHBs_P-B of FT:mat_peptide AP011092_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011093_SHBs_P-B Product feature CHAIN AP011093_SHBs_P-B of FT:mat_peptide AP011093_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFIQWFVGLSPTVWLSVLWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011094_SHBs_P-B Product feature CHAIN AP011094_SHBs_P-B of FT:mat_peptide AP011094_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011095_SHBs_P-B Product feature CHAIN AP011095_SHBs_P-B of FT:mat_peptide AP011095_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AP011096_SHBs_P-B Product feature CHAIN AP011096_SHBs_P-B of FT:mat_peptide AP011096_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY033072_SHBs_P-B Product feature CHAIN AY033072_SHBs_P-B of FT:mat_peptide AY033072_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY033073_SHBs_P-B Product feature CHAIN AY033073_SHBs_P-B of FT:mat_peptide AY033073_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIVMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY163869_SHBs_P-B Product feature CHAIN AY163869_SHBs_P-B of FT:mat_peptide AY163869_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY163870_SHBs_P-B Product feature CHAIN AY163870_SHBs_P-B of FT:mat_peptide AY163870_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167089_SHBs_P-B Product feature CHAIN AY167089_SHBs_P-B of FT:mat_peptide AY167089_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167093_SHBs_P-B Product feature CHAIN AY167093_SHBs_P-B of FT:mat_peptide AY167093_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILTPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167094_SHBs_P-B Product feature CHAIN AY167094_SHBs_P-B of FT:mat_peptide AY167094_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167097_SHBs_P-B Product feature CHAIN AY167097_SHBs_P-B of FT:mat_peptide AY167097_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167098_SHBs_P-B Product feature CHAIN AY167098_SHBs_P-B of FT:mat_peptide AY167098_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|AY167100_SHBs_P-B Product feature CHAIN AY167100_SHBs_P-B of FT:mat_peptide AY167100_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIVSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167101_SHBs_P-B Product feature CHAIN AY167101_SHBs_P-B of FT:mat_peptide AY167101_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY167102_SHBs_P-B Product feature CHAIN AY167102_SHBs_P-B of FT:mat_peptide AY167102_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGIPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPLSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY206373_SHBs_P-B Product feature CHAIN AY206373_SHBs_P-B of FT:mat_peptide AY206373_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLVDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSLFMPLLPIFFCLWVYI
>gnl|hbvpro|AY206375_SHBs_P-B Product feature CHAIN AY206375_SHBs_P-B of FT:mat_peptide AY206375_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNRTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY206383_SHBs_P-B Product feature CHAIN AY206383_SHBs_P-B of FT:mat_peptide AY206383_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY206387_SHBs_P-B Product feature CHAIN AY206387_SHBs_P-B of FT:mat_peptide AY206387_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFWLTKILTIPQSLDLWWTSLSFLGGPPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDFQGMLPVCPLIPGSSTTSTGACKTCTTPAQGTSMFPSCCCTKPTDANCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY206390_SHBs_P-B Product feature CHAIN AY206390_SHBs_P-B of FT:mat_peptide AY206390_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYV
>gnl|hbvpro|AY206391_SHBs_P-B Product feature CHAIN AY206391_SHBs_P-B of FT:mat_peptide AY206391_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217355_SHBs_P-B Product feature CHAIN AY217355_SHBs_P-B of FT:mat_peptide AY217355_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A6-2). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217356_SHBs_P-B Product feature CHAIN AY217356_SHBs_P-B of FT:mat_peptide AY217356_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217357_SHBs_P-B Product feature CHAIN AY217357_SHBs_P-B of FT:mat_peptide AY217357_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217358_SHBs_P-B Product feature CHAIN AY217358_SHBs_P-B of FT:mat_peptide AY217358_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217359_SHBs_P-B Product feature CHAIN AY217359_SHBs_P-B of FT:mat_peptide AY217359_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPVQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217360_SHBs_P-B Product feature CHAIN AY217360_SHBs_P-B of FT:mat_peptide AY217360_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217362_SHBs_P-B Product feature CHAIN AY217362_SHBs_P-B of FT:mat_peptide AY217362_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY217368_SHBs_P-B Product feature CHAIN AY217368_SHBs_P-B of FT:mat_peptide AY217368_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21949). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQAMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFFLWAYI
>gnl|hbvpro|AY220697_SHBs_P-B Product feature CHAIN AY220697_SHBs_P-B of FT:mat_peptide AY220697_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY220698_SHBs_P-B Product feature CHAIN AY220698_SHBs_P-B of FT:mat_peptide AY220698_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY220703_SHBs_P-B Product feature CHAIN AY220703_SHBs_P-B of FT:mat_peptide AY220703_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AY220704_SHBs_P-B Product feature CHAIN AY220704_SHBs_P-B of FT:mat_peptide AY220704_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY293309_SHBs_P-B Product feature CHAIN AY293309_SHBs_P-B of FT:mat_peptide AY293309_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY517489_SHBs_P-B Product feature CHAIN AY517489_SHBs_P-B of FT:mat_peptide AY517489_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY517619_SHBs_P-B Product feature CHAIN AY517619_SHBs_P-B of FT:mat_peptide AY517619_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY518556_SHBs_P-B Product feature CHAIN AY518556_SHBs_P-B of FT:mat_peptide AY518556_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596102_SHBs_P-B Product feature CHAIN AY596102_SHBs_P-B of FT:mat_peptide AY596102_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596103_SHBs_P-B Product feature CHAIN AY596103_SHBs_P-B of FT:mat_peptide AY596103_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596104_SHBs_P-B Product feature CHAIN AY596104_SHBs_P-B of FT:mat_peptide AY596104_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY596105_SHBs_P-B Product feature CHAIN AY596105_SHBs_P-B of FT:mat_peptide AY596105_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596106_SHBs_P-B Product feature CHAIN AY596106_SHBs_P-B of FT:mat_peptide AY596106_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596109_SHBs_P-B Product feature CHAIN AY596109_SHBs_P-B of FT:mat_peptide AY596109_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596110_SHBs_P-B Product feature CHAIN AY596110_SHBs_P-B of FT:mat_peptide AY596110_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY596111_SHBs_P-B Product feature CHAIN AY596111_SHBs_P-B of FT:mat_peptide AY596111_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYSILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|AY596112_SHBs_P-B Product feature CHAIN AY596112_SHBs_P-B of FT:mat_peptide AY596112_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738926_SHBs_P-B Product feature CHAIN AY738926_SHBs_P-B of FT:mat_peptide AY738926_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|AY738927_SHBs_P-B Product feature CHAIN AY738927_SHBs_P-B of FT:mat_peptide AY738927_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738928_SHBs_P-B Product feature CHAIN AY738928_SHBs_P-B of FT:mat_peptide AY738928_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQCFVGLSPSVGLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738929_SHBs_P-B Product feature CHAIN AY738929_SHBs_P-B of FT:mat_peptide AY738929_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738930_SHBs_P-B Product feature CHAIN AY738930_SHBs_P-B of FT:mat_peptide AY738930_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738931_SHBs_P-B Product feature CHAIN AY738931_SHBs_P-B of FT:mat_peptide AY738931_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738932_SHBs_P-B Product feature CHAIN AY738932_SHBs_P-B of FT:mat_peptide AY738932_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQSFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738933_SHBs_P-B Product feature CHAIN AY738933_SHBs_P-B of FT:mat_peptide AY738933_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738934_SHBs_P-B Product feature CHAIN AY738934_SHBs_P-B of FT:mat_peptide AY738934_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738935_SHBs_P-B Product feature CHAIN AY738935_SHBs_P-B of FT:mat_peptide AY738935_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738936_SHBs_P-B Product feature CHAIN AY738936_SHBs_P-B of FT:mat_peptide AY738936_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738937_SHBs_P-B Product feature CHAIN AY738937_SHBs_P-B of FT:mat_peptide AY738937_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738938_SHBs_P-B Product feature CHAIN AY738938_SHBs_P-B of FT:mat_peptide AY738938_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY738939_SHBs_P-B Product feature CHAIN AY738939_SHBs_P-B of FT:mat_peptide AY738939_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVHWFVGLSHIVWLSAIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AY766463_SHBs_P-B Product feature CHAIN AY766463_SHBs_P-B of FT:mat_peptide AY766463_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSPWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800389_SHBs_P-B Product feature CHAIN AY800389_SHBs_P-B of FT:mat_peptide AY800389_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800391_SHBs_P-B Product feature CHAIN AY800391_SHBs_P-B of FT:mat_peptide AY800391_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY800392_SHBs_P-B Product feature CHAIN AY800392_SHBs_P-B of FT:mat_peptide AY800392_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|D00329_SHBs_P-B Product feature CHAIN D00329_SHBs_P-B of FT:mat_peptide D00329_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D00330_SHBs_P-B Product feature CHAIN D00330_SHBs_P-B of FT:mat_peptide D00330_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D00331_SHBs_C-B Product feature CHAIN D00331_SHBs_C-B of FT:mat_peptide D00331_SHBs_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPLSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D23678_SHBs_P-B Product feature CHAIN D23678_SHBs_P-B of FT:mat_peptide D23678_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D23679_SHBs_P-B Product feature CHAIN D23679_SHBs_P-B of FT:mat_peptide D23679_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|D50521_SHBs_P-B Product feature CHAIN D50521_SHBs_P-B of FT:mat_peptide D50521_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGPCKTCTTPARNTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWAYI
>gnl|hbvpro|D50522_SHBs_P-B Product feature CHAIN D50522_SHBs_P-B of FT:mat_peptide D50522_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141615_SHBs_P-B Product feature CHAIN DQ141615_SHBs_P-B of FT:mat_peptide DQ141615_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141616_SHBs_P-B Product feature CHAIN DQ141616_SHBs_P-B of FT:mat_peptide DQ141616_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141617_SHBs_P-B Product feature CHAIN DQ141617_SHBs_P-B of FT:mat_peptide DQ141617_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH16AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141618_SHBs_P-B Product feature CHAIN DQ141618_SHBs_P-B of FT:mat_peptide DQ141618_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPEGLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141619_SHBs_P-B Product feature CHAIN DQ141619_SHBs_P-B of FT:mat_peptide DQ141619_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH38AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141620_SHBs_P-B Product feature CHAIN DQ141620_SHBs_P-B of FT:mat_peptide DQ141620_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH30AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141621_SHBs_P-B Product feature CHAIN DQ141621_SHBs_P-B of FT:mat_peptide DQ141621_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH42AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVVQEGIFSLTKILTIPQSLESGWTSLNFLGETPVGLGQNSQSQISSHSPTCCPPICPGYRWMGLRRF
IIFLCILLLCLIFLLVLLDYQGMLPACPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141622_SHBs_P-B Product feature CHAIN DQ141622_SHBs_P-B of FT:mat_peptide DQ141622_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141623_SHBs_P-B Product feature CHAIN DQ141623_SHBs_P-B of FT:mat_peptide DQ141623_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1877Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141624_SHBs_P-B Product feature CHAIN DQ141624_SHBs_P-B of FT:mat_peptide DQ141624_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2069Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141626_SHBs_P-B Product feature CHAIN DQ141626_SHBs_P-B of FT:mat_peptide DQ141626_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2175Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLNSWWTSLNFLGGTPVCLGQNSQSQISSHSPTWCPPICPGYRWMCLRRF
IIFLSILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141627_SHBs_P-B Product feature CHAIN DQ141627_SHBs_P-B of FT:mat_peptide DQ141627_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141628_SHBs_P-B Product feature CHAIN DQ141628_SHBs_P-B of FT:mat_peptide DQ141628_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH44AJava). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141629_SHBs_P-B Product feature CHAIN DQ141629_SHBs_P-B of FT:mat_peptide DQ141629_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2028Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141630_SHBs_P-B Product feature CHAIN DQ141630_SHBs_P-B of FT:mat_peptide DQ141630_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH24AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141631_SHBs_P-B Product feature CHAIN DQ141631_SHBs_P-B of FT:mat_peptide DQ141631_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1932Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ141632_SHBs_P-B Product feature CHAIN DQ141632_SHBs_P-B of FT:mat_peptide DQ141632_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM1Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141633_SHBs_P-B Product feature CHAIN DQ141633_SHBs_P-B of FT:mat_peptide DQ141633_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM2Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141634_SHBs_P-B Product feature CHAIN DQ141634_SHBs_P-B of FT:mat_peptide DQ141634_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM4Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141635_SHBs_P-B Product feature CHAIN DQ141635_SHBs_P-B of FT:mat_peptide DQ141635_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH27AJava). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCGCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141636_SHBs_P-B Product feature CHAIN DQ141636_SHBs_P-B of FT:mat_peptide DQ141636_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH31AJava). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSGWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCGCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141637_SHBs_P-B Product feature CHAIN DQ141637_SHBs_P-B of FT:mat_peptide DQ141637_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH32Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWLWGPSLDNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141638_SHBs_P-B Product feature CHAIN DQ141638_SHBs_P-B of FT:mat_peptide DQ141638_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr026East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFTK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141639_SHBs_P-B Product feature CHAIN DQ141639_SHBs_P-B of FT:mat_peptide DQ141639_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr056East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLSLIFLLVLLDYQGMLPVCPLIPGSSTTSPGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141640_SHBs_P-B Product feature CHAIN DQ141640_SHBs_P-B of FT:mat_peptide DQ141640_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr178East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141641_SHBs_P-B Product feature CHAIN DQ141641_SHBs_P-B of FT:mat_peptide DQ141641_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2077Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLGPFVQGFVGLSPTVGLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141642_SHBs_P-B Product feature CHAIN DQ141642_SHBs_P-B of FT:mat_peptide DQ141642_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2052Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141643_SHBs_P-B Product feature CHAIN DQ141643_SHBs_P-B of FT:mat_peptide DQ141643_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2050Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141644_SHBs_P-B Product feature CHAIN DQ141644_SHBs_P-B of FT:mat_peptide DQ141644_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141645_SHBs_P-B Product feature CHAIN DQ141645_SHBs_P-B of FT:mat_peptide DQ141645_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHM3Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141646_SHBs_P-B Product feature CHAIN DQ141646_SHBs_P-B of FT:mat_peptide DQ141646_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH43AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141647_SHBs_P-B Product feature CHAIN DQ141647_SHBs_P-B of FT:mat_peptide DQ141647_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr001East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141648_SHBs_P-B Product feature CHAIN DQ141648_SHBs_P-B of FT:mat_peptide DQ141648_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr029East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCWTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141649_SHBs_P-B Product feature CHAIN DQ141649_SHBs_P-B of FT:mat_peptide DQ141649_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr040East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVPLDYQGMLPVCPLIPGLSTTSTGPCRTCTTPAQGTSMFSSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141650_SHBs_P-B Product feature CHAIN DQ141650_SHBs_P-B of FT:mat_peptide DQ141650_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIESGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSF
IIFLCILLLCLMFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141651_SHBs_P-B Product feature CHAIN DQ141651_SHBs_P-B of FT:mat_peptide DQ141651_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr052East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLFLIFLLVLLDYQGMLPLCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141652_SHBs_P-B Product feature CHAIN DQ141652_SHBs_P-B of FT:mat_peptide DQ141652_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr060East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141653_SHBs_P-B Product feature CHAIN DQ141653_SHBs_P-B of FT:mat_peptide DQ141653_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD48East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141654_SHBs_P-B Product feature CHAIN DQ141654_SHBs_P-B of FT:mat_peptide DQ141654_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SBT19East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|DQ141655_SHBs_P-B Product feature CHAIN DQ141655_SHBs_P-B of FT:mat_peptide DQ141655_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD35East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASRLPRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLRGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ361535_SHBs_P-B Product feature CHAIN DQ361535_SHBs_P-B of FT:mat_peptide DQ361535_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSSFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLCNILSPFVPLLPIFCCLWVYI
>gnl|hbvpro|DQ377158_SHBs_P-B Product feature CHAIN DQ377158_SHBs_P-B of FT:mat_peptide DQ377158_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412176_SHBs_P-B Product feature CHAIN DQ412176_SHBs_P-B of FT:mat_peptide DQ412176_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate e05010937). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412177_SHBs_P-B Product feature CHAIN DQ412177_SHBs_P-B of FT:mat_peptide DQ412177_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02004200). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILRPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412178_SHBs_P-B Product feature CHAIN DQ412178_SHBs_P-B of FT:mat_peptide DQ412178_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02009123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412179_SHBs_P-B Product feature CHAIN DQ412179_SHBs_P-B of FT:mat_peptide DQ412179_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02011109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRX
IXFLCILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412180_SHBs_P-B Product feature CHAIN DQ412180_SHBs_P-B of FT:mat_peptide DQ412180_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02012947). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|DQ412181_SHBs_P-B Product feature CHAIN DQ412181_SHBs_P-B of FT:mat_peptide DQ412181_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02015689). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412182_SHBs_P-B Product feature CHAIN DQ412182_SHBs_P-B of FT:mat_peptide DQ412182_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02015693). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|DQ412183_SHBs_P-B Product feature CHAIN DQ412183_SHBs_P-B of FT:mat_peptide DQ412183_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02022147). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLSFLGGTPACLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412184_SHBs_P-B Product feature CHAIN DQ412184_SHBs_P-B of FT:mat_peptide DQ412184_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S02023964). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412185_SHBs_P-B Product feature CHAIN DQ412185_SHBs_P-B of FT:mat_peptide DQ412185_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02023969). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412186_SHBs_P-B Product feature CHAIN DQ412186_SHBs_P-B of FT:mat_peptide DQ412186_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03000368). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLSFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412187_SHBs_P-B Product feature CHAIN DQ412187_SHBs_P-B of FT:mat_peptide DQ412187_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03000466). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412188_SHBs_P-B Product feature CHAIN DQ412188_SHBs_P-B of FT:mat_peptide DQ412188_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03000569). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412189_SHBs_P-B Product feature CHAIN DQ412189_SHBs_P-B of FT:mat_peptide DQ412189_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S03003845). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412190_SHBs_P-B Product feature CHAIN DQ412190_SHBs_P-B of FT:mat_peptide DQ412190_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03006674). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412191_SHBs_P-B Product feature CHAIN DQ412191_SHBs_P-B of FT:mat_peptide DQ412191_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03008348). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412192_SHBs_P-B Product feature CHAIN DQ412192_SHBs_P-B of FT:mat_peptide DQ412192_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03009620). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPRIPGSSTTSTGPCKTCTTPAQGTSMNPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFAQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412193_SHBs_P-B Product feature CHAIN DQ412193_SHBs_P-B of FT:mat_peptide DQ412193_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S03010981). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412194_SHBs_P-B Product feature CHAIN DQ412194_SHBs_P-B of FT:mat_peptide DQ412194_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03017068). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412195_SHBs_P-B Product feature CHAIN DQ412195_SHBs_P-B of FT:mat_peptide DQ412195_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03017071). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCXTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412196_SHBs_P-B Product feature CHAIN DQ412196_SHBs_P-B of FT:mat_peptide DQ412196_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03022048). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWXYI
>gnl|hbvpro|DQ412197_SHBs_P-B Product feature CHAIN DQ412197_SHBs_P-B of FT:mat_peptide DQ412197_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03023231). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412198_SHBs_P-B Product feature CHAIN DQ412198_SHBs_P-B of FT:mat_peptide DQ412198_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03024903). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGTPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412199_SHBs_P-B Product feature CHAIN DQ412199_SHBs_P-B of FT:mat_peptide DQ412199_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04002705). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLEGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412200_SHBs_P-B Product feature CHAIN DQ412200_SHBs_P-B of FT:mat_peptide DQ412200_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04003304). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRF
IIFLCILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412201_SHBs_P-B Product feature CHAIN DQ412201_SHBs_P-B of FT:mat_peptide DQ412201_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04008402). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412202_SHBs_P-B Product feature CHAIN DQ412202_SHBs_P-B of FT:mat_peptide DQ412202_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04010861). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412203_SHBs_P-B Product feature CHAIN DQ412203_SHBs_P-B of FT:mat_peptide DQ412203_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04012012). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLSILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412204_SHBs_P-B Product feature CHAIN DQ412204_SHBs_P-B of FT:mat_peptide DQ412204_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04013165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFFLWVYI
>gnl|hbvpro|DQ412205_SHBs_P-B Product feature CHAIN DQ412205_SHBs_P-B of FT:mat_peptide DQ412205_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04018516). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLXLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412206_SHBs_P-B Product feature CHAIN DQ412206_SHBs_P-B of FT:mat_peptide DQ412206_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04018517). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412207_SHBs_P-B Product feature CHAIN DQ412207_SHBs_P-B of FT:mat_peptide DQ412207_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04019583). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVVPAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYTILSPFMPLLPIFFCLWVFI
>gnl|hbvpro|DQ412208_SHBs_P-B Product feature CHAIN DQ412208_SHBs_P-B of FT:mat_peptide DQ412208_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04024459). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLAVQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412209_SHBs_P-B Product feature CHAIN DQ412209_SHBs_P-B of FT:mat_peptide DQ412209_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05003009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGEPPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDFQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPYVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412211_SHBs_P-B Product feature CHAIN DQ412211_SHBs_P-B of FT:mat_peptide DQ412211_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05008025). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412212_SHBs_P-B Product feature CHAIN DQ412212_SHBs_P-B of FT:mat_peptide DQ412212_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05008455). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412213_SHBs_P-B Product feature CHAIN DQ412213_SHBs_P-B of FT:mat_peptide DQ412213_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S05008970). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412214_SHBs_P-B Product feature CHAIN DQ412214_SHBs_P-B of FT:mat_peptide DQ412214_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05010384). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSXIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412215_SHBs_P-B Product feature CHAIN DQ412215_SHBs_P-B of FT:mat_peptide DQ412215_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s04026375). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412216_SHBs_P-B Product feature CHAIN DQ412216_SHBs_P-B of FT:mat_peptide DQ412216_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S05011425). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412217_SHBs_P-B Product feature CHAIN DQ412217_SHBs_P-B of FT:mat_peptide DQ412217_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05004976). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412218_SHBs_P-B Product feature CHAIN DQ412218_SHBs_P-B of FT:mat_peptide DQ412218_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s02001724). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412219_SHBs_P-B Product feature CHAIN DQ412219_SHBs_P-B of FT:mat_peptide DQ412219_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s03006573). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412220_SHBs_P-B Product feature CHAIN DQ412220_SHBs_P-B of FT:mat_peptide DQ412220_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S05016360). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|DQ412221_SHBs_P-B Product feature CHAIN DQ412221_SHBs_P-B of FT:mat_peptide DQ412221_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05017887). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412222_SHBs_P-B Product feature CHAIN DQ412222_SHBs_P-B of FT:mat_peptide DQ412222_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05021369). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412223_SHBs_P-B Product feature CHAIN DQ412223_SHBs_P-B of FT:mat_peptide DQ412223_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05021810). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLIKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQTSSHSPTCCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412224_SHBs_P-B Product feature CHAIN DQ412224_SHBs_P-B of FT:mat_peptide DQ412224_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05023212). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCHGQNSQSQISSHLPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYTILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|DQ412225_SHBs_P-B Product feature CHAIN DQ412225_SHBs_P-B of FT:mat_peptide DQ412225_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s05024254). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLHNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|DQ412226_SHBs_P-B Product feature CHAIN DQ412226_SHBs_P-B of FT:mat_peptide DQ412226_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s06000630). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIVSGLLKPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412227_SHBs_P-B Product feature CHAIN DQ412227_SHBs_P-B of FT:mat_peptide DQ412227_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate s06000633). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ412228_SHBs_P-B Product feature CHAIN DQ412228_SHBs_P-B of FT:mat_peptide DQ412228_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S06002112). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ448619_SHBs_P-B Product feature CHAIN DQ448619_SHBs_P-B of FT:mat_peptide DQ448619_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448620_SHBs_P-B Product feature CHAIN DQ448620_SHBs_P-B of FT:mat_peptide DQ448620_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448621_SHBs_P-B Product feature CHAIN DQ448621_SHBs_P-B of FT:mat_peptide DQ448621_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448622_SHBs_P-B Product feature CHAIN DQ448622_SHBs_P-B of FT:mat_peptide DQ448622_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448623_SHBs_P-B Product feature CHAIN DQ448623_SHBs_P-B of FT:mat_peptide DQ448623_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448624_SHBs_P-B Product feature CHAIN DQ448624_SHBs_P-B of FT:mat_peptide DQ448624_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448625_SHBs_P-B Product feature CHAIN DQ448625_SHBs_P-B of FT:mat_peptide DQ448625_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448626_SHBs_P-B Product feature CHAIN DQ448626_SHBs_P-B of FT:mat_peptide DQ448626_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448627_SHBs_P-B Product feature CHAIN DQ448627_SHBs_P-B of FT:mat_peptide DQ448627_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ448628_SHBs_P-B Product feature CHAIN DQ448628_SHBs_P-B of FT:mat_peptide DQ448628_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463787_SHBs_P-B Product feature CHAIN DQ463787_SHBs_P-B of FT:mat_peptide DQ463787_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQFQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ463788_SHBs_P-B Product feature CHAIN DQ463788_SHBs_P-B of FT:mat_peptide DQ463788_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463789_SHBs_P-B Product feature CHAIN DQ463789_SHBs_P-B of FT:mat_peptide DQ463789_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRS
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463790_SHBs_P-B Product feature CHAIN DQ463790_SHBs_P-B of FT:mat_peptide DQ463790_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLILLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463791_SHBs_P-B Product feature CHAIN DQ463791_SHBs_P-B of FT:mat_peptide DQ463791_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCPGQNSQSQICSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWSWGPNLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463792_SHBs_P-B Product feature CHAIN DQ463792_SHBs_P-B of FT:mat_peptide DQ463792_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463793_SHBs_P-B Product feature CHAIN DQ463793_SHBs_P-B of FT:mat_peptide DQ463793_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463794_SHBs_P-B Product feature CHAIN DQ463794_SHBs_P-B of FT:mat_peptide DQ463794_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEPPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463795_SHBs_P-B Product feature CHAIN DQ463795_SHBs_P-B of FT:mat_peptide DQ463795_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGGTPECLGQNSQFQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCNTLSRFVPLFPIFFCLWVYI
>gnl|hbvpro|DQ463796_SHBs_P-B Product feature CHAIN DQ463796_SHBs_P-B of FT:mat_peptide DQ463796_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYHWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463797_SHBs_P-B Product feature CHAIN DQ463797_SHBs_P-B of FT:mat_peptide DQ463797_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDLWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLYLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLRNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463798_SHBs_P-B Product feature CHAIN DQ463798_SHBs_P-B of FT:mat_peptide DQ463798_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463799_SHBs_P-B Product feature CHAIN DQ463799_SHBs_P-B of FT:mat_peptide DQ463799_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463800_SHBs_P-B Product feature CHAIN DQ463800_SHBs_P-B of FT:mat_peptide DQ463800_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463801_SHBs_P-B Product feature CHAIN DQ463801_SHBs_P-B of FT:mat_peptide DQ463801_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ463802_SHBs_P-B Product feature CHAIN DQ463802_SHBs_P-B of FT:mat_peptide DQ463802_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCHIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ904357_SHBs_P-B Product feature CHAIN DQ904357_SHBs_P-B of FT:mat_peptide DQ904357_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993680_SHBs_P-B Product feature CHAIN DQ993680_SHBs_P-B of FT:mat_peptide DQ993680_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993681_SHBs_P-B Product feature CHAIN DQ993681_SHBs_P-B of FT:mat_peptide DQ993681_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|DQ993682_SHBs_P-B Product feature CHAIN DQ993682_SHBs_P-B of FT:mat_peptide DQ993682_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 479). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993683_SHBs_P-B Product feature CHAIN DQ993683_SHBs_P-B of FT:mat_peptide DQ993683_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993684_SHBs_P-B Product feature CHAIN DQ993684_SHBs_P-B of FT:mat_peptide DQ993684_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLQGPLLVLQAGFFLLTKSLTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPDCPGYPRMCLRGF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993685_SHBs_P-B Product feature CHAIN DQ993685_SHBs_P-B of FT:mat_peptide DQ993685_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993686_SHBs_P-B Product feature CHAIN DQ993686_SHBs_P-B of FT:mat_peptide DQ993686_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCPGQNSQSQIFSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARNPSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993687_SHBs_P-B Product feature CHAIN DQ993687_SHBs_P-B of FT:mat_peptide DQ993687_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFSLTKILTIPQXLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIRIPSSWAFAK
YLWEWASVRFSWLSLLLPFVQWFVRLSPTVWFSVIWMMWNWGPSLYKIGSPFMPLLPIFFCXXXFI
>gnl|hbvpro|DQ993696_SHBs_P-B Product feature CHAIN DQ993696_SHBs_P-B of FT:mat_peptide DQ993696_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLNFLVGAPVCLDQNSQSPISSHSPTCCPPICPDYPWMCLRRF
IIFLCILLLCLIFLMVLLDYQGMLPVCPLIPGSSTTSTGPWNTCTAPAQGTSMFPSCCCTKPTDGNCACIPVPSSWAFPK
YLWEWASVRFSWLGLLVPFVQWFVRLSPLVWLSVIWMMWYWGPSLYNILSPFMPLLPXFFCLWVYI
>gnl|hbvpro|DQ993697_SHBs_P-B Product feature CHAIN DQ993697_SHBs_P-B of FT:mat_peptide DQ993697_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993698_SHBs_P-B Product feature CHAIN DQ993698_SHBs_P-B of FT:mat_peptide DQ993698_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRSCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993699_SHBs_P-B Product feature CHAIN DQ993699_SHBs_P-B of FT:mat_peptide DQ993699_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRSCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993700_SHBs_P-B Product feature CHAIN DQ993700_SHBs_P-B of FT:mat_peptide DQ993700_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVQFVQWFVGLSPTVWLSVMWKMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ993701_SHBs_P-B Product feature CHAIN DQ993701_SHBs_P-B of FT:mat_peptide DQ993701_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ993702_SHBs_P-B Product feature CHAIN DQ993702_SHBs_P-B of FT:mat_peptide DQ993702_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSTTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFLCLWVYL
>gnl|hbvpro|DQ993703_SHBs_P-B Product feature CHAIN DQ993703_SHBs_P-B of FT:mat_peptide DQ993703_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993704_SHBs_P-B Product feature CHAIN DQ993704_SHBs_P-B of FT:mat_peptide DQ993704_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993705_SHBs_P-B Product feature CHAIN DQ993705_SHBs_P-B of FT:mat_peptide DQ993705_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSHISSHSPTCCPPICPGYRWMCLPRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993706_SHBs_P-B Product feature CHAIN DQ993706_SHBs_P-B of FT:mat_peptide DQ993706_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993707_SHBs_P-B Product feature CHAIN DQ993707_SHBs_P-B of FT:mat_peptide DQ993707_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993708_SHBs_P-B Product feature CHAIN DQ993708_SHBs_P-B of FT:mat_peptide DQ993708_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993709_SHBs_P-B Product feature CHAIN DQ993709_SHBs_P-B of FT:mat_peptide DQ993709_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ993710_SHBs_P-B Product feature CHAIN DQ993710_SHBs_P-B of FT:mat_peptide DQ993710_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ995801_SHBs_P-B Product feature CHAIN DQ995801_SHBs_P-B of FT:mat_peptide DQ995801_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMSLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCAKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995802_SHBs_P-B Product feature CHAIN DQ995802_SHBs_P-B of FT:mat_peptide DQ995802_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLRAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLGQNSQSPISSHSPTCCPPICPGYRRMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995804_SHBs_P-B Product feature CHAIN DQ995804_SHBs_P-B of FT:mat_peptide DQ995804_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLGFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLLILFCLWVYI
>gnl|hbvpro|DQ995805_SHBs_P-B Product feature CHAIN DQ995805_SHBs_P-B of FT:mat_peptide DQ995805_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-2.5KB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPISSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF134945_SHBs_P-B Product feature CHAIN EF134945_SHBs_P-B of FT:mat_peptide EF134945_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQRTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF134946_SHBs_P-B Product feature CHAIN EF134946_SHBs_P-B of FT:mat_peptide EF134946_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQRTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473971_SHBs_P-B Product feature CHAIN EF473971_SHBs_P-B of FT:mat_peptide EF473971_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473972_SHBs_P-B Product feature CHAIN EF473972_SHBs_P-B of FT:mat_peptide EF473972_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473973_SHBs_P-B Product feature CHAIN EF473973_SHBs_P-B of FT:mat_peptide EF473973_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473974_SHBs_P-B Product feature CHAIN EF473974_SHBs_P-B of FT:mat_peptide EF473974_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPEGLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473975_SHBs_P-B Product feature CHAIN EF473975_SHBs_P-B of FT:mat_peptide EF473975_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473976_SHBs_P-B Product feature CHAIN EF473976_SHBs_P-B of FT:mat_peptide EF473976_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIESGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSF
IIFLCILLLCLMFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF473977_SHBs_P-B Product feature CHAIN EF473977_SHBs_P-B of FT:mat_peptide EF473977_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494380_SHBs_P-B Product feature CHAIN EF494380_SHBs_P-B of FT:mat_peptide EF494380_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRS
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCACIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494381_SHBs_P-B Product feature CHAIN EF494381_SHBs_P-B of FT:mat_peptide EF494381_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLICLLGLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EF494382_SHBs_P-B Product feature CHAIN EF494382_SHBs_P-B of FT:mat_peptide EF494382_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTGTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU075308_SHBs_P-B Product feature CHAIN EU075308_SHBs_P-B of FT:mat_peptide EU075308_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU131110_SHBs_P-B Product feature CHAIN EU131110_SHBs_P-B of FT:mat_peptide EU131110_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs1). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYKGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCNPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131112_SHBs_P-B Product feature CHAIN EU131112_SHBs_P-B of FT:mat_peptide EU131112_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPIYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDLKGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWAWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU131113_SHBs_P-B Product feature CHAIN EU131113_SHBs_P-B of FT:mat_peptide EU131113_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU131114_SHBs_P-B Product feature CHAIN EU131114_SHBs_P-B of FT:mat_peptide EU131114_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs6). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDSNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFSLWVYI
>gnl|hbvpro|EU131115_SHBs_P-B Product feature CHAIN EU131115_SHBs_P-B of FT:mat_peptide EU131115_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131117_SHBs_P-B Product feature CHAIN EU131117_SHBs_P-B of FT:mat_peptide EU131117_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU131118_SHBs_P-B Product feature CHAIN EU131118_SHBs_P-B of FT:mat_peptide EU131118_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPIYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDLKGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWAWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131119_SHBs_P-B Product feature CHAIN EU131119_SHBs_P-B of FT:mat_peptide EU131119_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|EU131120_SHBs_P-B Product feature CHAIN EU131120_SHBs_P-B of FT:mat_peptide EU131120_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131121_SHBs_P-B Product feature CHAIN EU131121_SHBs_P-B of FT:mat_peptide EU131121_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCATPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWALAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131123_SHBs_P-B Product feature CHAIN EU131123_SHBs_P-B of FT:mat_peptide EU131123_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGASMFPSCCCTKPTDRNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131124_SHBs_P-B Product feature CHAIN EU131124_SHBs_P-B of FT:mat_peptide EU131124_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCRTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU131125_SHBs_P-B Product feature CHAIN EU131125_SHBs_P-B of FT:mat_peptide EU131125_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131126_SHBs_P-B Product feature CHAIN EU131126_SHBs_P-B of FT:mat_peptide EU131126_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTASTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU131127_SHBs_P-B Product feature CHAIN EU131127_SHBs_P-B of FT:mat_peptide EU131127_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTNSTGPCKTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPISCCLWVYI
>gnl|hbvpro|EU131128_SHBs_P-B Product feature CHAIN EU131128_SHBs_P-B of FT:mat_peptide EU131128_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPIYCPPICPGYRWMCLRRF
IIFLRILLLCLIFLLVLLDLKGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWAWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131129_SHBs_P-B Product feature CHAIN EU131129_SHBs_P-B of FT:mat_peptide EU131129_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU131130_SHBs_P-B Product feature CHAIN EU131130_SHBs_P-B of FT:mat_peptide EU131130_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate xs27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|EU139529_SHBs_P-B Product feature CHAIN EU139529_SHBs_P-B of FT:mat_peptide EU139529_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate hwd-24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTNSTGPCKTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPISCCLWGYI
>gnl|hbvpro|EU139533_SHBs_P-B Product feature CHAIN EU139533_SHBs_P-B of FT:mat_peptide EU139533_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate zxq-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU139534_SHBs_P-B Product feature CHAIN EU139534_SHBs_P-B of FT:mat_peptide EU139534_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate zxq-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU139535_SHBs_P-B Product feature CHAIN EU139535_SHBs_P-B of FT:mat_peptide EU139535_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate zxq-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU139537_SHBs_P-B Product feature CHAIN EU139537_SHBs_P-B of FT:mat_peptide EU139537_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate zxq-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU139538_SHBs_P-B Product feature CHAIN EU139538_SHBs_P-B of FT:mat_peptide EU139538_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate zxq-6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU139539_SHBs_P-B Product feature CHAIN EU139539_SHBs_P-B of FT:mat_peptide EU139539_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate zxq-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU139542_SHBs_P-B Product feature CHAIN EU139542_SHBs_P-B of FT:mat_peptide EU139542_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate zxq-10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNYTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|EU139543_SHBs_P-B Product feature CHAIN EU139543_SHBs_P-B of FT:mat_peptide EU139543_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU158262_SHBs_P-B Product feature CHAIN EU158262_SHBs_P-B of FT:mat_peptide EU158262_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G116). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU158263_SHBs_P-B Product feature CHAIN EU158263_SHBs_P-B of FT:mat_peptide EU158263_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU305547_SHBs_P-B Product feature CHAIN EU305547_SHBs_P-B of FT:mat_peptide EU305547_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCAKPTNGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFRLWVYI
>gnl|hbvpro|EU305548_SHBs_P-B Product feature CHAIN EU305548_SHBs_P-B of FT:mat_peptide EU305548_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSIGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306678_SHBs_P-B Product feature CHAIN EU306678_SHBs_P-B of FT:mat_peptide EU306678_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306679_SHBs_P-B Product feature CHAIN EU306679_SHBs_P-B of FT:mat_peptide EU306679_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYV
>gnl|hbvpro|EU306680_SHBs_P-B Product feature CHAIN EU306680_SHBs_P-B of FT:mat_peptide EU306680_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYV
>gnl|hbvpro|EU306681_SHBs_P-B Product feature CHAIN EU306681_SHBs_P-B of FT:mat_peptide EU306681_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306695_SHBs_P-B Product feature CHAIN EU306695_SHBs_P-B of FT:mat_peptide EU306695_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306696_SHBs_P-B Product feature CHAIN EU306696_SHBs_P-B of FT:mat_peptide EU306696_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWERASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306697_SHBs_P-B Product feature CHAIN EU306697_SHBs_P-B of FT:mat_peptide EU306697_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306698_SHBs_P-B Product feature CHAIN EU306698_SHBs_P-B of FT:mat_peptide EU306698_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306699_SHBs_P-B Product feature CHAIN EU306699_SHBs_P-B of FT:mat_peptide EU306699_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTSTTLAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLGLLVPFVQWFVGLSPTVWLPVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU306700_SHBs_P-B Product feature CHAIN EU306700_SHBs_P-B of FT:mat_peptide EU306700_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306701_SHBs_P-B Product feature CHAIN EU306701_SHBs_P-B of FT:mat_peptide EU306701_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306702_SHBs_P-B Product feature CHAIN EU306702_SHBs_P-B of FT:mat_peptide EU306702_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306703_SHBs_P-B Product feature CHAIN EU306703_SHBs_P-B of FT:mat_peptide EU306703_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWLCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306704_SHBs_P-B Product feature CHAIN EU306704_SHBs_P-B of FT:mat_peptide EU306704_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
CLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306705_SHBs_P-B Product feature CHAIN EU306705_SHBs_P-B of FT:mat_peptide EU306705_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPAVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306706_SHBs_P-B Product feature CHAIN EU306706_SHBs_P-B of FT:mat_peptide EU306706_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306707_SHBs_P-B Product feature CHAIN EU306707_SHBs_P-B of FT:mat_peptide EU306707_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
CLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306708_SHBs_P-B Product feature CHAIN EU306708_SHBs_P-B of FT:mat_peptide EU306708_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306709_SHBs_P-B Product feature CHAIN EU306709_SHBs_P-B of FT:mat_peptide EU306709_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306710_SHBs_P-B Product feature CHAIN EU306710_SHBs_P-B of FT:mat_peptide EU306710_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306711_SHBs_P-B Product feature CHAIN EU306711_SHBs_P-B of FT:mat_peptide EU306711_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU306712_SHBs_P-B Product feature CHAIN EU306712_SHBs_P-B of FT:mat_peptide EU306712_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU330989_SHBs_P-B Product feature CHAIN EU330989_SHBs_P-B of FT:mat_peptide EU330989_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSATSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
HLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330990_SHBs_P-B Product feature CHAIN EU330990_SHBs_P-B of FT:mat_peptide EU330990_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSATSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
HLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330994_SHBs_P-B Product feature CHAIN EU330994_SHBs_P-B of FT:mat_peptide EU330994_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISGHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVRLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330995_SHBs_P-B Product feature CHAIN EU330995_SHBs_P-B of FT:mat_peptide EU330995_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|EU330996_SHBs_P-B Product feature CHAIN EU330996_SHBs_P-B of FT:mat_peptide EU330996_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330997_SHBs_P-B Product feature CHAIN EU330997_SHBs_P-B of FT:mat_peptide EU330997_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330998_SHBs_P-B Product feature CHAIN EU330998_SHBs_P-B of FT:mat_peptide EU330998_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRLF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU330999_SHBs_P-B Product feature CHAIN EU330999_SHBs_P-B of FT:mat_peptide EU330999_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRLF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU331000_SHBs_P-B Product feature CHAIN EU331000_SHBs_P-B of FT:mat_peptide EU331000_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU331001_SHBs_P-B Product feature CHAIN EU331001_SHBs_P-B of FT:mat_peptide EU331001_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU350409_SHBs_P-B Product feature CHAIN EU350409_SHBs_P-B of FT:mat_peptide EU350409_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439018_SHBs_P-B Product feature CHAIN EU439018_SHBs_P-B of FT:mat_peptide EU439018_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439020_SHBs_P-B Product feature CHAIN EU439020_SHBs_P-B of FT:mat_peptide EU439020_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439021_SHBs_P-B Product feature CHAIN EU439021_SHBs_P-B of FT:mat_peptide EU439021_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPILFCLWVYI
>gnl|hbvpro|EU439022_SHBs_P-B Product feature CHAIN EU439022_SHBs_P-B of FT:mat_peptide EU439022_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNRTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU439023_SHBs_P-B Product feature CHAIN EU439023_SHBs_P-B of FT:mat_peptide EU439023_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGPSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU487256_SHBs_P-B Product feature CHAIN EU487256_SHBs_P-B of FT:mat_peptide EU487256_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIQLLPIFFCLWVYI
>gnl|hbvpro|EU487257_SHBs_P-B Product feature CHAIN EU487257_SHBs_P-B of FT:mat_peptide EU487257_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU522066_SHBs_P-B Product feature CHAIN EU522066_SHBs_P-B of FT:mat_peptide EU522066_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4N). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU522067_SHBs_P-B Product feature CHAIN EU522067_SHBs_P-B of FT:mat_peptide EU522067_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU522072_SHBs_P-B Product feature CHAIN EU522072_SHBs_P-B of FT:mat_peptide EU522072_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|EU522073_SHBs_P-B Product feature CHAIN EU522073_SHBs_P-B of FT:mat_peptide EU522073_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|EU522074_SHBs_P-B Product feature CHAIN EU522074_SHBs_P-B of FT:mat_peptide EU522074_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU522075_SHBs_P-B Product feature CHAIN EU522075_SHBs_P-B of FT:mat_peptide EU522075_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|EU547563_SHBs_P-B Product feature CHAIN EU547563_SHBs_P-B of FT:mat_peptide EU547563_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564822_SHBs_P-B Product feature CHAIN EU564822_SHBs_P-B of FT:mat_peptide EU564822_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564823_SHBs_P-B Product feature CHAIN EU564823_SHBs_P-B of FT:mat_peptide EU564823_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU564824_SHBs_P-B Product feature CHAIN EU564824_SHBs_P-B of FT:mat_peptide EU564824_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMLLLPIFFCLWVYI
>gnl|hbvpro|EU564826_SHBs_P-B Product feature CHAIN EU564826_SHBs_P-B of FT:mat_peptide EU564826_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570070_SHBs_P-B Product feature CHAIN EU570070_SHBs_P-B of FT:mat_peptide EU570070_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570071_SHBs_P-B Product feature CHAIN EU570071_SHBs_P-B of FT:mat_peptide EU570071_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU570075_SHBs_P-B Product feature CHAIN EU570075_SHBs_P-B of FT:mat_peptide EU570075_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPACLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU579441_SHBs_P-B Product feature CHAIN EU579441_SHBs_P-B of FT:mat_peptide EU579441_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSPNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|EU589335_SHBs_P-B Product feature CHAIN EU589335_SHBs_P-B of FT:mat_peptide EU589335_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|EU595031_SHBs_P-B Product feature CHAIN EU595031_SHBs_P-B of FT:mat_peptide EU595031_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVILMMWFWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|EU660224_SHBs_P-B Product feature CHAIN EU660224_SHBs_P-B of FT:mat_peptide EU660224_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Non-functional genomic sequence. [Hepadnaviridae] (length=223 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGTLPVCPLTNRTSTGPCKTCTTTAQGTSLFPSCCCSKPTDGNCTCIPIPSSWAFAKYLW
EWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYAILSPFIQLLPIFFCLWVYI
>gnl|hbvpro|EU660230_SHBs_P-B Product feature CHAIN EU660230_SHBs_P-B of FT:mat_peptide EU660230_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU660231_SHBs_P-B Product feature CHAIN EU660231_SHBs_P-B of FT:mat_peptide EU660231_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU660232_SHBs_P-B Product feature CHAIN EU660232_SHBs_P-B of FT:mat_peptide EU660232_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=223 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLW
EWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU660233_SHBs_P-B Product feature CHAIN EU660233_SHBs_P-B of FT:mat_peptide EU660233_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=223 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLW
EWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU796066_SHBs_P-B Product feature CHAIN EU796066_SHBs_P-B of FT:mat_peptide EU796066_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU796067_SHBs_P-B Product feature CHAIN EU796067_SHBs_P-B of FT:mat_peptide EU796067_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU796068_SHBs_P-B Product feature CHAIN EU796068_SHBs_P-B of FT:mat_peptide EU796068_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MVNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU881997_SHBs_P-B Product feature CHAIN EU881997_SHBs_P-B of FT:mat_peptide EU881997_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCRGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU881998_SHBs_P-B Product feature CHAIN EU881998_SHBs_P-B of FT:mat_peptide EU881998_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU882002_SHBs_P-B Product feature CHAIN EU882002_SHBs_P-B of FT:mat_peptide EU882002_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU882003_SHBs_P-B Product feature CHAIN EU882003_SHBs_P-B of FT:mat_peptide EU882003_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Non-functional genomic sequence. [Hepadnaviridae] (length=223 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGNSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLW
EWASARFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPSLYNILSPFMPLLPIFYCLWVYI
>gnl|hbvpro|EU882004_SHBs_P-B Product feature CHAIN EU882004_SHBs_P-B of FT:mat_peptide EU882004_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFAQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYI
>gnl|hbvpro|EU915485_SHBs_P-B Product feature CHAIN EU915485_SHBs_P-B of FT:mat_peptide EU915485_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919171_SHBs_P-B Product feature CHAIN EU919171_SHBs_P-B of FT:mat_peptide EU919171_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919172_SHBs_P-B Product feature CHAIN EU919172_SHBs_P-B of FT:mat_peptide EU919172_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAQ
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919173_SHBs_P-B Product feature CHAIN EU919173_SHBs_P-B of FT:mat_peptide EU919173_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919175_SHBs_P-B Product feature CHAIN EU919175_SHBs_P-B of FT:mat_peptide EU919175_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU919176_SHBs_P-B Product feature CHAIN EU919176_SHBs_P-B of FT:mat_peptide EU919176_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU921791_SHBs_P-B Product feature CHAIN EU921791_SHBs_P-B of FT:mat_peptide EU921791_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLFPIFFXLWVYI
>gnl|hbvpro|EU921794_SHBs_P-B Product feature CHAIN EU921794_SHBs_P-B of FT:mat_peptide EU921794_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTNSTGPCKTCTTPAQGTSMFHSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU926432_SHBs_P-B Product feature CHAIN EU926432_SHBs_P-B of FT:mat_peptide EU926432_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926434_SHBs_P-B Product feature CHAIN EU926434_SHBs_P-B of FT:mat_peptide EU926434_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926436_SHBs_P-B Product feature CHAIN EU926436_SHBs_P-B of FT:mat_peptide EU926436_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFGLWVYI
>gnl|hbvpro|EU926437_SHBs_P-B Product feature CHAIN EU926437_SHBs_P-B of FT:mat_peptide EU926437_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926443_SHBs_P-B Product feature CHAIN EU926443_SHBs_P-B of FT:mat_peptide EU926443_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926448_SHBs_P-B Product feature CHAIN EU926448_SHBs_P-B of FT:mat_peptide EU926448_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926450_SHBs_P-B Product feature CHAIN EU926450_SHBs_P-B of FT:mat_peptide EU926450_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926455_SHBs_P-B Product feature CHAIN EU926455_SHBs_P-B of FT:mat_peptide EU926455_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNXLSPFMPLLPIFFXLWVYI
>gnl|hbvpro|EU926460_SHBs_P-B Product feature CHAIN EU926460_SHBs_P-B of FT:mat_peptide EU926460_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGYFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLVDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|EU926462_SHBs_P-B Product feature CHAIN EU926462_SHBs_P-B of FT:mat_peptide EU926462_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVHI
>gnl|hbvpro|EU926464_SHBs_P-B Product feature CHAIN EU926464_SHBs_P-B of FT:mat_peptide EU926464_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926465_SHBs_P-B Product feature CHAIN EU926465_SHBs_P-B of FT:mat_peptide EU926465_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926470_SHBs_P-B Product feature CHAIN EU926470_SHBs_P-B of FT:mat_peptide EU926470_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926471_SHBs_P-B Product feature CHAIN EU926471_SHBs_P-B of FT:mat_peptide EU926471_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU926473_SHBs_P-B Product feature CHAIN EU926473_SHBs_P-B of FT:mat_peptide EU926473_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLNLLVPFVQWSVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU927155_SHBs_P-B Product feature CHAIN EU927155_SHBs_P-B of FT:mat_peptide EU927155_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927156_SHBs_P-B Product feature CHAIN EU927156_SHBs_P-B of FT:mat_peptide EU927156_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927164_SHBs_P-B Product feature CHAIN EU927164_SHBs_P-B of FT:mat_peptide EU927164_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927177_SHBs_P-B Product feature CHAIN EU927177_SHBs_P-B of FT:mat_peptide EU927177_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927181_SHBs_P-B Product feature CHAIN EU927181_SHBs_P-B of FT:mat_peptide EU927181_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|EU927187_SHBs_P-B Product feature CHAIN EU927187_SHBs_P-B of FT:mat_peptide EU927187_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPLXXXXXGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927189_SHBs_P-B Product feature CHAIN EU927189_SHBs_P-B of FT:mat_peptide EU927189_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927190_SHBs_P-B Product feature CHAIN EU927190_SHBs_P-B of FT:mat_peptide EU927190_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGQSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927191_SHBs_P-B Product feature CHAIN EU927191_SHBs_P-B of FT:mat_peptide EU927191_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927192_SHBs_P-B Product feature CHAIN EU927192_SHBs_P-B of FT:mat_peptide EU927192_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927198_SHBs_P-B Product feature CHAIN EU927198_SHBs_P-B of FT:mat_peptide EU927198_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927200_SHBs_P-B Product feature CHAIN EU927200_SHBs_P-B of FT:mat_peptide EU927200_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927201_SHBs_P-B Product feature CHAIN EU927201_SHBs_P-B of FT:mat_peptide EU927201_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927210_SHBs_P-B Product feature CHAIN EU927210_SHBs_P-B of FT:mat_peptide EU927210_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927213_SHBs_P-B Product feature CHAIN EU927213_SHBs_P-B of FT:mat_peptide EU927213_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927215_SHBs_P-B Product feature CHAIN EU927215_SHBs_P-B of FT:mat_peptide EU927215_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGSFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU927216_SHBs_P-B Product feature CHAIN EU927216_SHBs_P-B of FT:mat_peptide EU927216_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU927220_SHBs_P-B Product feature CHAIN EU927220_SHBs_P-B of FT:mat_peptide EU927220_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927222_SHBs_P-B Product feature CHAIN EU927222_SHBs_P-B of FT:mat_peptide EU927222_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU927223_SHBs_P-B Product feature CHAIN EU927223_SHBs_P-B of FT:mat_peptide EU927223_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|EU927224_SHBs_P-B Product feature CHAIN EU927224_SHBs_P-B of FT:mat_peptide EU927224_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927226_SHBs_P-B Product feature CHAIN EU927226_SHBs_P-B of FT:mat_peptide EU927226_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927231_SHBs_P-B Product feature CHAIN EU927231_SHBs_P-B of FT:mat_peptide EU927231_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927233_SHBs_P-B Product feature CHAIN EU927233_SHBs_P-B of FT:mat_peptide EU927233_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927234_SHBs_P-B Product feature CHAIN EU927234_SHBs_P-B of FT:mat_peptide EU927234_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927235_SHBs_P-B Product feature CHAIN EU927235_SHBs_P-B of FT:mat_peptide EU927235_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927236_SHBs_P-B Product feature CHAIN EU927236_SHBs_P-B of FT:mat_peptide EU927236_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927239_SHBs_P-B Product feature CHAIN EU927239_SHBs_P-B of FT:mat_peptide EU927239_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927242_SHBs_P-B Product feature CHAIN EU927242_SHBs_P-B of FT:mat_peptide EU927242_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWXMWFWGPSLYNILSPFXPLLPIFLCLWVYI
>gnl|hbvpro|EU927243_SHBs_P-B Product feature CHAIN EU927243_SHBs_P-B of FT:mat_peptide EU927243_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXXTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927244_SHBs_P-B Product feature CHAIN EU927244_SHBs_P-B of FT:mat_peptide EU927244_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927247_SHBs_P-B Product feature CHAIN EU927247_SHBs_P-B of FT:mat_peptide EU927247_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYYILSPFMPLLPIFFCIWVYI
>gnl|hbvpro|EU927251_SHBs_P-B Product feature CHAIN EU927251_SHBs_P-B of FT:mat_peptide EU927251_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927272_SHBs_P-B Product feature CHAIN EU927272_SHBs_P-B of FT:mat_peptide EU927272_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU927284_SHBs_P-B Product feature CHAIN EU927284_SHBs_P-B of FT:mat_peptide EU927284_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939559_SHBs_P-B Product feature CHAIN EU939559_SHBs_P-B of FT:mat_peptide EU939559_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939633_SHBs_P-B Product feature CHAIN EU939633_SHBs_P-B of FT:mat_peptide EU939633_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFGLWVYM
>gnl|hbvpro|EU939634_SHBs_P-B Product feature CHAIN EU939634_SHBs_P-B of FT:mat_peptide EU939634_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFXLWVYM
>gnl|hbvpro|EU939635_SHBs_P-B Product feature CHAIN EU939635_SHBs_P-B of FT:mat_peptide EU939635_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B125). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGYFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPKLYSILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939636_SHBs_P-B Product feature CHAIN EU939636_SHBs_P-B of FT:mat_peptide EU939636_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939637_SHBs_P-B Product feature CHAIN EU939637_SHBs_P-B of FT:mat_peptide EU939637_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKVCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYDILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939638_SHBs_P-B Product feature CHAIN EU939638_SHBs_P-B of FT:mat_peptide EU939638_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939639_SHBs_P-B Product feature CHAIN EU939639_SHBs_P-B of FT:mat_peptide EU939639_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939660_SHBs_P-B Product feature CHAIN EU939660_SHBs_P-B of FT:mat_peptide EU939660_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C34). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939661_SHBs_P-B Product feature CHAIN EU939661_SHBs_P-B of FT:mat_peptide EU939661_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939663_SHBs_P-B Product feature CHAIN EU939663_SHBs_P-B of FT:mat_peptide EU939663_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939664_SHBs_P-B Product feature CHAIN EU939664_SHBs_P-B of FT:mat_peptide EU939664_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGEXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939665_SHBs_P-B Product feature CHAIN EU939665_SHBs_P-B of FT:mat_peptide EU939665_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939666_SHBs_P-B Product feature CHAIN EU939666_SHBs_P-B of FT:mat_peptide EU939666_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939667_SHBs_P-B Product feature CHAIN EU939667_SHBs_P-B of FT:mat_peptide EU939667_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939669_SHBs_P-B Product feature CHAIN EU939669_SHBs_P-B of FT:mat_peptide EU939669_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939670_SHBs_P-B Product feature CHAIN EU939670_SHBs_P-B of FT:mat_peptide EU939670_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939671_SHBs_P-B Product feature CHAIN EU939671_SHBs_P-B of FT:mat_peptide EU939671_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C201). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLTPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939672_SHBs_P-B Product feature CHAIN EU939672_SHBs_P-B of FT:mat_peptide EU939672_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939673_SHBs_P-B Product feature CHAIN EU939673_SHBs_P-B of FT:mat_peptide EU939673_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939674_SHBs_P-B Product feature CHAIN EU939674_SHBs_P-B of FT:mat_peptide EU939674_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|EU939675_SHBs_P-B Product feature CHAIN EU939675_SHBs_P-B of FT:mat_peptide EU939675_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU939676_SHBs_P-B Product feature CHAIN EU939676_SHBs_P-B of FT:mat_peptide EU939676_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939677_SHBs_P-B Product feature CHAIN EU939677_SHBs_P-B of FT:mat_peptide EU939677_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939678_SHBs_P-B Product feature CHAIN EU939678_SHBs_P-B of FT:mat_peptide EU939678_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRS
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFLCLWAYI
>gnl|hbvpro|FJ023631_SHBs_P-B Product feature CHAIN FJ023631_SHBs_P-B of FT:mat_peptide FJ023631_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPFIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLFPIFLCLWVYI
>gnl|hbvpro|FJ023632_SHBs_P-B Product feature CHAIN FJ023632_SHBs_P-B of FT:mat_peptide FJ023632_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023633_SHBs_P-B Product feature CHAIN FJ023633_SHBs_P-B of FT:mat_peptide FJ023633_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023634_SHBs_P-B Product feature CHAIN FJ023634_SHBs_P-B of FT:mat_peptide FJ023634_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023635_SHBs_P-B Product feature CHAIN FJ023635_SHBs_P-B of FT:mat_peptide FJ023635_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023636_SHBs_P-B Product feature CHAIN FJ023636_SHBs_P-B of FT:mat_peptide FJ023636_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023637_SHBs_P-B Product feature CHAIN FJ023637_SHBs_P-B of FT:mat_peptide FJ023637_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIXSXLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023638_SHBs_P-B Product feature CHAIN FJ023638_SHBs_P-B of FT:mat_peptide FJ023638_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023697_SHBs_P-B Product feature CHAIN FJ023697_SHBs_P-B of FT:mat_peptide FJ023697_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C04-0326). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023715_SHBs_P-B Product feature CHAIN FJ023715_SHBs_P-B of FT:mat_peptide FJ023715_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023718_SHBs_P-B Product feature CHAIN FJ023718_SHBs_P-B of FT:mat_peptide FJ023718_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0204). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023720_SHBs_P-B Product feature CHAIN FJ023720_SHBs_P-B of FT:mat_peptide FJ023720_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0238). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023723_SHBs_P-B Product feature CHAIN FJ023723_SHBs_P-B of FT:mat_peptide FJ023723_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0349). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023724_SHBs_P-B Product feature CHAIN FJ023724_SHBs_P-B of FT:mat_peptide FJ023724_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0405). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023729_SHBs_P-B Product feature CHAIN FJ023729_SHBs_P-B of FT:mat_peptide FJ023729_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0492). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023731_SHBs_P-B Product feature CHAIN FJ023731_SHBs_P-B of FT:mat_peptide FJ023731_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0516). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023738_SHBs_P-B Product feature CHAIN FJ023738_SHBs_P-B of FT:mat_peptide FJ023738_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0771). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023739_SHBs_P-B Product feature CHAIN FJ023739_SHBs_P-B of FT:mat_peptide FJ023739_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0875). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDANCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023741_SHBs_P-B Product feature CHAIN FJ023741_SHBs_P-B of FT:mat_peptide FJ023741_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-0980). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023743_SHBs_P-B Product feature CHAIN FJ023743_SHBs_P-B of FT:mat_peptide FJ023743_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-1165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGQNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023746_SHBs_P-B Product feature CHAIN FJ023746_SHBs_P-B of FT:mat_peptide FJ023746_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-1362). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023749_SHBs_P-B Product feature CHAIN FJ023749_SHBs_P-B of FT:mat_peptide FJ023749_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-1458). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023750_SHBs_P-B Product feature CHAIN FJ023750_SHBs_P-B of FT:mat_peptide FJ023750_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-1519). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023762_SHBs_P-B Product feature CHAIN FJ023762_SHBs_P-B of FT:mat_peptide FJ023762_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-1916). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023763_SHBs_P-B Product feature CHAIN FJ023763_SHBs_P-B of FT:mat_peptide FJ023763_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-1925). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023767_SHBs_P-B Product feature CHAIN FJ023767_SHBs_P-B of FT:mat_peptide FJ023767_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-2073). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023770_SHBs_P-B Product feature CHAIN FJ023770_SHBs_P-B of FT:mat_peptide FJ023770_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-2140). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023771_SHBs_P-B Product feature CHAIN FJ023771_SHBs_P-B of FT:mat_peptide FJ023771_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-2146). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023772_SHBs_P-B Product feature CHAIN FJ023772_SHBs_P-B of FT:mat_peptide FJ023772_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CO5-2147). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023773_SHBs_P-B Product feature CHAIN FJ023773_SHBs_P-B of FT:mat_peptide FJ023773_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0081). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023776_SHBs_P-B Product feature CHAIN FJ023776_SHBs_P-B of FT:mat_peptide FJ023776_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0415). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023792_SHBs_P-B Product feature CHAIN FJ023792_SHBs_P-B of FT:mat_peptide FJ023792_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-1580). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023797_SHBs_P-B Product feature CHAIN FJ023797_SHBs_P-B of FT:mat_peptide FJ023797_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-1760). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023801_SHBs_P-B Product feature CHAIN FJ023801_SHBs_P-B of FT:mat_peptide FJ023801_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2035). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023803_SHBs_P-B Product feature CHAIN FJ023803_SHBs_P-B of FT:mat_peptide FJ023803_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2064). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023808_SHBs_P-B Product feature CHAIN FJ023808_SHBs_P-B of FT:mat_peptide FJ023808_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2099). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023810_SHBs_P-B Product feature CHAIN FJ023810_SHBs_P-B of FT:mat_peptide FJ023810_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2129). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023811_SHBs_P-B Product feature CHAIN FJ023811_SHBs_P-B of FT:mat_peptide FJ023811_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023813_SHBs_P-B Product feature CHAIN FJ023813_SHBs_P-B of FT:mat_peptide FJ023813_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2289). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023814_SHBs_P-B Product feature CHAIN FJ023814_SHBs_P-B of FT:mat_peptide FJ023814_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2365). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPKLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023816_SHBs_P-B Product feature CHAIN FJ023816_SHBs_P-B of FT:mat_peptide FJ023816_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2370). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLNNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023817_SHBs_P-B Product feature CHAIN FJ023817_SHBs_P-B of FT:mat_peptide FJ023817_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2394). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023825_SHBs_P-B Product feature CHAIN FJ023825_SHBs_P-B of FT:mat_peptide FJ023825_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2656). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023829_SHBs_P-B Product feature CHAIN FJ023829_SHBs_P-B of FT:mat_peptide FJ023829_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2763). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023830_SHBs_P-B Product feature CHAIN FJ023830_SHBs_P-B of FT:mat_peptide FJ023830_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2766). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023831_SHBs_P-B Product feature CHAIN FJ023831_SHBs_P-B of FT:mat_peptide FJ023831_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2770). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023832_SHBs_P-B Product feature CHAIN FJ023832_SHBs_P-B of FT:mat_peptide FJ023832_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2783). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|FJ023835_SHBs_P-B Product feature CHAIN FJ023835_SHBs_P-B of FT:mat_peptide FJ023835_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2800). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023836_SHBs_P-B Product feature CHAIN FJ023836_SHBs_P-B of FT:mat_peptide FJ023836_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2866). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023838_SHBs_P-B Product feature CHAIN FJ023838_SHBs_P-B of FT:mat_peptide FJ023838_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-2884). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023842_SHBs_P-B Product feature CHAIN FJ023842_SHBs_P-B of FT:mat_peptide FJ023842_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023846_SHBs_P-B Product feature CHAIN FJ023846_SHBs_P-B of FT:mat_peptide FJ023846_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3069). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023848_SHBs_P-B Product feature CHAIN FJ023848_SHBs_P-B of FT:mat_peptide FJ023848_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3122). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023850_SHBs_P-B Product feature CHAIN FJ023850_SHBs_P-B of FT:mat_peptide FJ023850_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023852_SHBs_P-B Product feature CHAIN FJ023852_SHBs_P-B of FT:mat_peptide FJ023852_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3214). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023853_SHBs_P-B Product feature CHAIN FJ023853_SHBs_P-B of FT:mat_peptide FJ023853_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3222). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023855_SHBs_P-B Product feature CHAIN FJ023855_SHBs_P-B of FT:mat_peptide FJ023855_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3234). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IISLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023857_SHBs_P-B Product feature CHAIN FJ023857_SHBs_P-B of FT:mat_peptide FJ023857_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3260). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023858_SHBs_P-B Product feature CHAIN FJ023858_SHBs_P-B of FT:mat_peptide FJ023858_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3289). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023860_SHBs_P-B Product feature CHAIN FJ023860_SHBs_P-B of FT:mat_peptide FJ023860_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3304). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023862_SHBs_P-B Product feature CHAIN FJ023862_SHBs_P-B of FT:mat_peptide FJ023862_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3331). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023863_SHBs_P-B Product feature CHAIN FJ023863_SHBs_P-B of FT:mat_peptide FJ023863_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3361). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023867_SHBs_P-B Product feature CHAIN FJ023867_SHBs_P-B of FT:mat_peptide FJ023867_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3425). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023869_SHBs_P-B Product feature CHAIN FJ023869_SHBs_P-B of FT:mat_peptide FJ023869_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3457). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023870_SHBs_P-B Product feature CHAIN FJ023870_SHBs_P-B of FT:mat_peptide FJ023870_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3461). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023871_SHBs_P-B Product feature CHAIN FJ023871_SHBs_P-B of FT:mat_peptide FJ023871_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3504). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023873_SHBs_P-B Product feature CHAIN FJ023873_SHBs_P-B of FT:mat_peptide FJ023873_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023876_SHBs_P-B Product feature CHAIN FJ023876_SHBs_P-B of FT:mat_peptide FJ023876_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3688). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023888_SHBs_P-B Product feature CHAIN FJ023888_SHBs_P-B of FT:mat_peptide FJ023888_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3719). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023889_SHBs_P-B Product feature CHAIN FJ023889_SHBs_P-B of FT:mat_peptide FJ023889_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3720). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023893_SHBs_P-B Product feature CHAIN FJ023893_SHBs_P-B of FT:mat_peptide FJ023893_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3732). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023895_SHBs_P-B Product feature CHAIN FJ023895_SHBs_P-B of FT:mat_peptide FJ023895_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3800). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023899_SHBs_P-B Product feature CHAIN FJ023899_SHBs_P-B of FT:mat_peptide FJ023899_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3847). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQSSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023900_SHBs_P-B Product feature CHAIN FJ023900_SHBs_P-B of FT:mat_peptide FJ023900_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3853). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023902_SHBs_P-B Product feature CHAIN FJ023902_SHBs_P-B of FT:mat_peptide FJ023902_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4000). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023903_SHBs_P-B Product feature CHAIN FJ023903_SHBs_P-B of FT:mat_peptide FJ023903_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4005). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023905_SHBs_P-B Product feature CHAIN FJ023905_SHBs_P-B of FT:mat_peptide FJ023905_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4072). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023909_SHBs_P-B Product feature CHAIN FJ023909_SHBs_P-B of FT:mat_peptide FJ023909_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4144). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023910_SHBs_P-B Product feature CHAIN FJ023910_SHBs_P-B of FT:mat_peptide FJ023910_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4149). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023911_SHBs_P-B Product feature CHAIN FJ023911_SHBs_P-B of FT:mat_peptide FJ023911_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4160). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023913_SHBs_P-B Product feature CHAIN FJ023913_SHBs_P-B of FT:mat_peptide FJ023913_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4186). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023915_SHBs_P-B Product feature CHAIN FJ023915_SHBs_P-B of FT:mat_peptide FJ023915_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4257). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023916_SHBs_P-B Product feature CHAIN FJ023916_SHBs_P-B of FT:mat_peptide FJ023916_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4272). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023918_SHBs_P-B Product feature CHAIN FJ023918_SHBs_P-B of FT:mat_peptide FJ023918_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4293). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023919_SHBs_P-B Product feature CHAIN FJ023919_SHBs_P-B of FT:mat_peptide FJ023919_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4295). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLAPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023921_SHBs_P-B Product feature CHAIN FJ023921_SHBs_P-B of FT:mat_peptide FJ023921_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4325). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023923_SHBs_P-B Product feature CHAIN FJ023923_SHBs_P-B of FT:mat_peptide FJ023923_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4449). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023924_SHBs_P-B Product feature CHAIN FJ023924_SHBs_P-B of FT:mat_peptide FJ023924_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4450). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023925_SHBs_P-B Product feature CHAIN FJ023925_SHBs_P-B of FT:mat_peptide FJ023925_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4486). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023930_SHBs_P-B Product feature CHAIN FJ023930_SHBs_P-B of FT:mat_peptide FJ023930_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4604). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023933_SHBs_P-B Product feature CHAIN FJ023933_SHBs_P-B of FT:mat_peptide FJ023933_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4685). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023934_SHBs_P-B Product feature CHAIN FJ023934_SHBs_P-B of FT:mat_peptide FJ023934_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4734). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSATTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023937_SHBs_P-B Product feature CHAIN FJ023937_SHBs_P-B of FT:mat_peptide FJ023937_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4783). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023940_SHBs_P-B Product feature CHAIN FJ023940_SHBs_P-B of FT:mat_peptide FJ023940_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4869). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023941_SHBs_P-B Product feature CHAIN FJ023941_SHBs_P-B of FT:mat_peptide FJ023941_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-4917). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023946_SHBs_P-B Product feature CHAIN FJ023946_SHBs_P-B of FT:mat_peptide FJ023946_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0152). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023948_SHBs_P-B Product feature CHAIN FJ023948_SHBs_P-B of FT:mat_peptide FJ023948_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0159). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023950_SHBs_P-B Product feature CHAIN FJ023950_SHBs_P-B of FT:mat_peptide FJ023950_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0189). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023951_SHBs_P-B Product feature CHAIN FJ023951_SHBs_P-B of FT:mat_peptide FJ023951_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0220). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023952_SHBs_P-B Product feature CHAIN FJ023952_SHBs_P-B of FT:mat_peptide FJ023952_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0268). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023953_SHBs_P-B Product feature CHAIN FJ023953_SHBs_P-B of FT:mat_peptide FJ023953_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0279). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023954_SHBs_P-B Product feature CHAIN FJ023954_SHBs_P-B of FT:mat_peptide FJ023954_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0285). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023957_SHBs_P-B Product feature CHAIN FJ023957_SHBs_P-B of FT:mat_peptide FJ023957_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0426). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023958_SHBs_P-B Product feature CHAIN FJ023958_SHBs_P-B of FT:mat_peptide FJ023958_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0431). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023959_SHBs_P-B Product feature CHAIN FJ023959_SHBs_P-B of FT:mat_peptide FJ023959_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-0537). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023960_SHBs_P-B Product feature CHAIN FJ023960_SHBs_P-B of FT:mat_peptide FJ023960_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1072). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023962_SHBs_P-B Product feature CHAIN FJ023962_SHBs_P-B of FT:mat_peptide FJ023962_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1230). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023963_SHBs_P-B Product feature CHAIN FJ023963_SHBs_P-B of FT:mat_peptide FJ023963_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1427). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023964_SHBs_P-B Product feature CHAIN FJ023964_SHBs_P-B of FT:mat_peptide FJ023964_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1608). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023965_SHBs_P-B Product feature CHAIN FJ023965_SHBs_P-B of FT:mat_peptide FJ023965_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1623). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023970_SHBs_P-B Product feature CHAIN FJ023970_SHBs_P-B of FT:mat_peptide FJ023970_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1867). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023971_SHBs_P-B Product feature CHAIN FJ023971_SHBs_P-B of FT:mat_peptide FJ023971_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1898). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023972_SHBs_P-B Product feature CHAIN FJ023972_SHBs_P-B of FT:mat_peptide FJ023972_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1937). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023973_SHBs_P-B Product feature CHAIN FJ023973_SHBs_P-B of FT:mat_peptide FJ023973_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-1973). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023974_SHBs_P-B Product feature CHAIN FJ023974_SHBs_P-B of FT:mat_peptide FJ023974_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2068). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023975_SHBs_P-B Product feature CHAIN FJ023975_SHBs_P-B of FT:mat_peptide FJ023975_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2118). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023976_SHBs_P-B Product feature CHAIN FJ023976_SHBs_P-B of FT:mat_peptide FJ023976_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2156). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023978_SHBs_P-B Product feature CHAIN FJ023978_SHBs_P-B of FT:mat_peptide FJ023978_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2164). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023981_SHBs_P-B Product feature CHAIN FJ023981_SHBs_P-B of FT:mat_peptide FJ023981_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2237). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023982_SHBs_P-B Product feature CHAIN FJ023982_SHBs_P-B of FT:mat_peptide FJ023982_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2278). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023983_SHBs_P-B Product feature CHAIN FJ023983_SHBs_P-B of FT:mat_peptide FJ023983_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2367). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023984_SHBs_P-B Product feature CHAIN FJ023984_SHBs_P-B of FT:mat_peptide FJ023984_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2381). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023986_SHBs_P-B Product feature CHAIN FJ023986_SHBs_P-B of FT:mat_peptide FJ023986_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2388). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023987_SHBs_P-B Product feature CHAIN FJ023987_SHBs_P-B of FT:mat_peptide FJ023987_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2391). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023989_SHBs_P-B Product feature CHAIN FJ023989_SHBs_P-B of FT:mat_peptide FJ023989_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2485). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023990_SHBs_P-B Product feature CHAIN FJ023990_SHBs_P-B of FT:mat_peptide FJ023990_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2492). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023992_SHBs_P-B Product feature CHAIN FJ023992_SHBs_P-B of FT:mat_peptide FJ023992_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2511). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023993_SHBs_P-B Product feature CHAIN FJ023993_SHBs_P-B of FT:mat_peptide FJ023993_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2518). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023995_SHBs_P-B Product feature CHAIN FJ023995_SHBs_P-B of FT:mat_peptide FJ023995_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2563). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023996_SHBs_P-B Product feature CHAIN FJ023996_SHBs_P-B of FT:mat_peptide FJ023996_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2566). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023997_SHBs_P-B Product feature CHAIN FJ023997_SHBs_P-B of FT:mat_peptide FJ023997_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2580). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023998_SHBs_P-B Product feature CHAIN FJ023998_SHBs_P-B of FT:mat_peptide FJ023998_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2596). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023999_SHBs_P-B Product feature CHAIN FJ023999_SHBs_P-B of FT:mat_peptide FJ023999_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2673). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024000_SHBs_P-B Product feature CHAIN FJ024000_SHBs_P-B of FT:mat_peptide FJ024000_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2705). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024004_SHBs_P-B Product feature CHAIN FJ024004_SHBs_P-B of FT:mat_peptide FJ024004_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2752). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024005_SHBs_P-B Product feature CHAIN FJ024005_SHBs_P-B of FT:mat_peptide FJ024005_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2767). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024006_SHBs_P-B Product feature CHAIN FJ024006_SHBs_P-B of FT:mat_peptide FJ024006_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2835). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024008_SHBs_P-B Product feature CHAIN FJ024008_SHBs_P-B of FT:mat_peptide FJ024008_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2842). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024010_SHBs_P-B Product feature CHAIN FJ024010_SHBs_P-B of FT:mat_peptide FJ024010_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2894). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024012_SHBs_P-B Product feature CHAIN FJ024012_SHBs_P-B of FT:mat_peptide FJ024012_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2963). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024013_SHBs_P-B Product feature CHAIN FJ024013_SHBs_P-B of FT:mat_peptide FJ024013_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-2964). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024014_SHBs_P-B Product feature CHAIN FJ024014_SHBs_P-B of FT:mat_peptide FJ024014_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3019). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024015_SHBs_P-B Product feature CHAIN FJ024015_SHBs_P-B of FT:mat_peptide FJ024015_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3023). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024016_SHBs_P-B Product feature CHAIN FJ024016_SHBs_P-B of FT:mat_peptide FJ024016_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3164). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024017_SHBs_P-B Product feature CHAIN FJ024017_SHBs_P-B of FT:mat_peptide FJ024017_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024018_SHBs_P-B Product feature CHAIN FJ024018_SHBs_P-B of FT:mat_peptide FJ024018_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3206). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ024019_SHBs_P-B Product feature CHAIN FJ024019_SHBs_P-B of FT:mat_peptide FJ024019_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3249). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024020_SHBs_P-B Product feature CHAIN FJ024020_SHBs_P-B of FT:mat_peptide FJ024020_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3275). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024022_SHBs_P-B Product feature CHAIN FJ024022_SHBs_P-B of FT:mat_peptide FJ024022_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3540). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024027_SHBs_P-B Product feature CHAIN FJ024027_SHBs_P-B of FT:mat_peptide FJ024027_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3861). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024029_SHBs_P-B Product feature CHAIN FJ024029_SHBs_P-B of FT:mat_peptide FJ024029_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-3976). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024030_SHBs_P-B Product feature CHAIN FJ024030_SHBs_P-B of FT:mat_peptide FJ024030_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4122). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024032_SHBs_P-B Product feature CHAIN FJ024032_SHBs_P-B of FT:mat_peptide FJ024032_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4148). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ024033_SHBs_P-B Product feature CHAIN FJ024033_SHBs_P-B of FT:mat_peptide FJ024033_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4152). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024036_SHBs_P-B Product feature CHAIN FJ024036_SHBs_P-B of FT:mat_peptide FJ024036_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4217). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024038_SHBs_P-B Product feature CHAIN FJ024038_SHBs_P-B of FT:mat_peptide FJ024038_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4282). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024040_SHBs_P-B Product feature CHAIN FJ024040_SHBs_P-B of FT:mat_peptide FJ024040_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4377). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024041_SHBs_P-B Product feature CHAIN FJ024041_SHBs_P-B of FT:mat_peptide FJ024041_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4451). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024042_SHBs_P-B Product feature CHAIN FJ024042_SHBs_P-B of FT:mat_peptide FJ024042_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4454). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024044_SHBs_P-B Product feature CHAIN FJ024044_SHBs_P-B of FT:mat_peptide FJ024044_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4636). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPVQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024045_SHBs_P-B Product feature CHAIN FJ024045_SHBs_P-B of FT:mat_peptide FJ024045_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4686). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ024046_SHBs_P-B Product feature CHAIN FJ024046_SHBs_P-B of FT:mat_peptide FJ024046_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M05-4750). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ032342_SHBs_P-B Product feature CHAIN FJ032342_SHBs_P-B of FT:mat_peptide FJ032342_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSSLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|FJ032344_SHBs_P-B Product feature CHAIN FJ032344_SHBs_P-B of FT:mat_peptide FJ032344_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSSLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|FJ032349_SHBs_P-B Product feature CHAIN FJ032349_SHBs_P-B of FT:mat_peptide FJ032349_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSSTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSRCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032352_SHBs_P-B Product feature CHAIN FJ032352_SHBs_P-B of FT:mat_peptide FJ032352_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032353_SHBs_P-B Product feature CHAIN FJ032353_SHBs_P-B of FT:mat_peptide FJ032353_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032354_SHBs_P-B Product feature CHAIN FJ032354_SHBs_P-B of FT:mat_peptide FJ032354_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ032357_SHBs_P-B Product feature CHAIN FJ032357_SHBs_P-B of FT:mat_peptide FJ032357_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|FJ032358_SHBs_P-B Product feature CHAIN FJ032358_SHBs_P-B of FT:mat_peptide FJ032358_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLAKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMWPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFLCLWVYM
>gnl|hbvpro|FJ349236_SHBs_P-B Product feature CHAIN FJ349236_SHBs_P-B of FT:mat_peptide FJ349236_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386582_SHBs_P-B Product feature CHAIN FJ386582_SHBs_P-B of FT:mat_peptide FJ386582_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386583_SHBs_P-B Product feature CHAIN FJ386583_SHBs_P-B of FT:mat_peptide FJ386583_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386584_SHBs_P-B Product feature CHAIN FJ386584_SHBs_P-B of FT:mat_peptide FJ386584_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386600_SHBs_P-B Product feature CHAIN FJ386600_SHBs_P-B of FT:mat_peptide FJ386600_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
ILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386608_SHBs_P-B Product feature CHAIN FJ386608_SHBs_P-B of FT:mat_peptide FJ386608_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVILMMWFWGPSLYNIVRPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ386610_SHBs_P-B Product feature CHAIN FJ386610_SHBs_P-B of FT:mat_peptide FJ386610_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386615_SHBs_P-B Product feature CHAIN FJ386615_SHBs_P-B of FT:mat_peptide FJ386615_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386634_SHBs_P-B Product feature CHAIN FJ386634_SHBs_P-B of FT:mat_peptide FJ386634_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386636_SHBs_P-B Product feature CHAIN FJ386636_SHBs_P-B of FT:mat_peptide FJ386636_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
ILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386642_SHBs_P-B Product feature CHAIN FJ386642_SHBs_P-B of FT:mat_peptide FJ386642_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386648_SHBs_P-B Product feature CHAIN FJ386648_SHBs_P-B of FT:mat_peptide FJ386648_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
YLWEWASIRFSSLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386654_SHBs_P-B Product feature CHAIN FJ386654_SHBs_P-B of FT:mat_peptide FJ386654_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386655_SHBs_P-B Product feature CHAIN FJ386655_SHBs_P-B of FT:mat_peptide FJ386655_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386656_SHBs_P-B Product feature CHAIN FJ386656_SHBs_P-B of FT:mat_peptide FJ386656_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQNLYTILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|FJ386658_SHBs_P-B Product feature CHAIN FJ386658_SHBs_P-B of FT:mat_peptide FJ386658_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386660_SHBs_P-B Product feature CHAIN FJ386660_SHBs_P-B of FT:mat_peptide FJ386660_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386666_SHBs_P-B Product feature CHAIN FJ386666_SHBs_P-B of FT:mat_peptide FJ386666_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386668_SHBs_P-B Product feature CHAIN FJ386668_SHBs_P-B of FT:mat_peptide FJ386668_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386669_SHBs_P-B Product feature CHAIN FJ386669_SHBs_P-B of FT:mat_peptide FJ386669_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386675_SHBs_P-B Product feature CHAIN FJ386675_SHBs_P-B of FT:mat_peptide FJ386675_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386676_SHBs_P-B Product feature CHAIN FJ386676_SHBs_P-B of FT:mat_peptide FJ386676_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMFPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386680_SHBs_P-B Product feature CHAIN FJ386680_SHBs_P-B of FT:mat_peptide FJ386680_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1244). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386681_SHBs_P-B Product feature CHAIN FJ386681_SHBs_P-B of FT:mat_peptide FJ386681_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386682_SHBs_P-B Product feature CHAIN FJ386682_SHBs_P-B of FT:mat_peptide FJ386682_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386683_SHBs_P-B Product feature CHAIN FJ386683_SHBs_P-B of FT:mat_peptide FJ386683_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386684_SHBs_P-B Product feature CHAIN FJ386684_SHBs_P-B of FT:mat_peptide FJ386684_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ386688_SHBs_P-B Product feature CHAIN FJ386688_SHBs_P-B of FT:mat_peptide FJ386688_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ518812_SHBs_P-B Product feature CHAIN FJ518812_SHBs_P-B of FT:mat_peptide FJ518812_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSCLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ560992_SHBs_P-B Product feature CHAIN FJ560992_SHBs_P-B of FT:mat_peptide FJ560992_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ560995_SHBs_P-B Product feature CHAIN FJ560995_SHBs_P-B of FT:mat_peptide FJ560995_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H26). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPHSLNSWWTSLNFLGGTPVCLGQNSHSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ560996_SHBs_P-B Product feature CHAIN FJ560996_SHBs_P-B of FT:mat_peptide FJ560996_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561001_SHBs_P-B Product feature CHAIN FJ561001_SHBs_P-B of FT:mat_peptide FJ561001_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWLTSLNFLGETPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561007_SHBs_P-B Product feature CHAIN FJ561007_SHBs_P-B of FT:mat_peptide FJ561007_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate QS263). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561009_SHBs_P-B Product feature CHAIN FJ561009_SHBs_P-B of FT:mat_peptide FJ561009_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate QS88). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561013_SHBs_P-B Product feature CHAIN FJ561013_SHBs_P-B of FT:mat_peptide FJ561013_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S118). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ561015_SHBs_P-B Product feature CHAIN FJ561015_SHBs_P-B of FT:mat_peptide FJ561015_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S124). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561018_SHBs_P-B Product feature CHAIN FJ561018_SHBs_P-B of FT:mat_peptide FJ561018_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561019_SHBs_P-B Product feature CHAIN FJ561019_SHBs_P-B of FT:mat_peptide FJ561019_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561021_SHBs_P-B Product feature CHAIN FJ561021_SHBs_P-B of FT:mat_peptide FJ561021_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561024_SHBs_P-B Product feature CHAIN FJ561024_SHBs_P-B of FT:mat_peptide FJ561024_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S50). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENNASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561027_SHBs_P-B Product feature CHAIN FJ561027_SHBs_P-B of FT:mat_peptide FJ561027_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S61). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ561034_SHBs_P-B Product feature CHAIN FJ561034_SHBs_P-B of FT:mat_peptide FJ561034_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S77). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561038_SHBs_P-B Product feature CHAIN FJ561038_SHBs_P-B of FT:mat_peptide FJ561038_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S93). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ561044_SHBs_P-B Product feature CHAIN FJ561044_SHBs_P-B of FT:mat_peptide FJ561044_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate QS216). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSXXTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWASAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562219_SHBs_P-B Product feature CHAIN FJ562219_SHBs_P-B of FT:mat_peptide FJ562219_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSSFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562222_SHBs_P-B Product feature CHAIN FJ562222_SHBs_P-B of FT:mat_peptide FJ562222_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562224_SHBs_P-B Product feature CHAIN FJ562224_SHBs_P-B of FT:mat_peptide FJ562224_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562231_SHBs_P-B Product feature CHAIN FJ562231_SHBs_P-B of FT:mat_peptide FJ562231_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562234_SHBs_P-B Product feature CHAIN FJ562234_SHBs_P-B of FT:mat_peptide FJ562234_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFSSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562236_SHBs_P-B Product feature CHAIN FJ562236_SHBs_P-B of FT:mat_peptide FJ562236_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ562237_SHBs_P-B Product feature CHAIN FJ562237_SHBs_P-B of FT:mat_peptide FJ562237_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562240_SHBs_P-B Product feature CHAIN FJ562240_SHBs_P-B of FT:mat_peptide FJ562240_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562246_SHBs_P-B Product feature CHAIN FJ562246_SHBs_P-B of FT:mat_peptide FJ562246_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562253_SHBs_P-B Product feature CHAIN FJ562253_SHBs_P-B of FT:mat_peptide FJ562253_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFSLLIKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562254_SHBs_P-B Product feature CHAIN FJ562254_SHBs_P-B of FT:mat_peptide FJ562254_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562257_SHBs_P-B Product feature CHAIN FJ562257_SHBs_P-B of FT:mat_peptide FJ562257_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSIGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562259_SHBs_P-B Product feature CHAIN FJ562259_SHBs_P-B of FT:mat_peptide FJ562259_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562260_SHBs_P-B Product feature CHAIN FJ562260_SHBs_P-B of FT:mat_peptide FJ562260_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562262_SHBs_P-B Product feature CHAIN FJ562262_SHBs_P-B of FT:mat_peptide FJ562262_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I111). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562289_SHBs_P-B Product feature CHAIN FJ562289_SHBs_P-B of FT:mat_peptide FJ562289_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562296_SHBs_P-B Product feature CHAIN FJ562296_SHBs_P-B of FT:mat_peptide FJ562296_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPKLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562303_SHBs_P-B Product feature CHAIN FJ562303_SHBs_P-B of FT:mat_peptide FJ562303_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
ILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562311_SHBs_P-B Product feature CHAIN FJ562311_SHBs_P-B of FT:mat_peptide FJ562311_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562312_SHBs_P-B Product feature CHAIN FJ562312_SHBs_P-B of FT:mat_peptide FJ562312_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562316_SHBs_P-B Product feature CHAIN FJ562316_SHBs_P-B of FT:mat_peptide FJ562316_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
ILFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ562321_SHBs_P-B Product feature CHAIN FJ562321_SHBs_P-B of FT:mat_peptide FJ562321_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I214). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562322_SHBs_P-B Product feature CHAIN FJ562322_SHBs_P-B of FT:mat_peptide FJ562322_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621592_SHBs_P-B Product feature CHAIN FJ621592_SHBs_P-B of FT:mat_peptide FJ621592_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3157). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ621602_SHBs_P-B Product feature CHAIN FJ621602_SHBs_P-B of FT:mat_peptide FJ621602_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2068). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSXLVPFVQWFAGLSPIVWLSVXWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621603_SHBs_P-B Product feature CHAIN FJ621603_SHBs_P-B of FT:mat_peptide FJ621603_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4782). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621604_SHBs_P-B Product feature CHAIN FJ621604_SHBs_P-B of FT:mat_peptide FJ621604_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3194). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621605_SHBs_P-B Product feature CHAIN FJ621605_SHBs_P-B of FT:mat_peptide FJ621605_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621606_SHBs_P-B Product feature CHAIN FJ621606_SHBs_P-B of FT:mat_peptide FJ621606_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621607_SHBs_P-B Product feature CHAIN FJ621607_SHBs_P-B of FT:mat_peptide FJ621607_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2967). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621608_SHBs_P-B Product feature CHAIN FJ621608_SHBs_P-B of FT:mat_peptide FJ621608_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3012). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISXHSPTXCPPICPGYRWMCLRRF
IXFLXILLLCLIFLLVLLDYQGMLPVCPLXPGXSTTSTGPCKTCTXPAQGTSMFPSCCCTKPXDGNCTCIPIPSSWAFAX
YLWEWASVRFSWXSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|FJ621612_SHBs_P-B Product feature CHAIN FJ621612_SHBs_P-B of FT:mat_peptide FJ621612_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2956). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYS
>gnl|hbvpro|FJ621613_SHBs_P-B Product feature CHAIN FJ621613_SHBs_P-B of FT:mat_peptide FJ621613_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3147). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLCNILSPFIPLLPIFCCLWAYI
>gnl|hbvpro|FJ621614_SHBs_P-B Product feature CHAIN FJ621614_SHBs_P-B of FT:mat_peptide FJ621614_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4314). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621615_SHBs_P-B Product feature CHAIN FJ621615_SHBs_P-B of FT:mat_peptide FJ621615_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4744). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621616_SHBs_P-B Product feature CHAIN FJ621616_SHBs_P-B of FT:mat_peptide FJ621616_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2794). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRSMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621617_SHBs_P-B Product feature CHAIN FJ621617_SHBs_P-B of FT:mat_peptide FJ621617_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3086). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621618_SHBs_P-B Product feature CHAIN FJ621618_SHBs_P-B of FT:mat_peptide FJ621618_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3191). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621620_SHBs_P-B Product feature CHAIN FJ621620_SHBs_P-B of FT:mat_peptide FJ621620_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4756). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLPGPLLVLQAGYFLWTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ621622_SHBs_P-B Product feature CHAIN FJ621622_SHBs_P-B of FT:mat_peptide FJ621622_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4722). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYV
>gnl|hbvpro|FJ621623_SHBs_P-B Product feature CHAIN FJ621623_SHBs_P-B of FT:mat_peptide FJ621623_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3001). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLRPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621624_SHBs_P-B Product feature CHAIN FJ621624_SHBs_P-B of FT:mat_peptide FJ621624_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4057). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621625_SHBs_P-B Product feature CHAIN FJ621625_SHBs_P-B of FT:mat_peptide FJ621625_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4220). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621626_SHBs_P-B Product feature CHAIN FJ621626_SHBs_P-B of FT:mat_peptide FJ621626_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4603). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621627_SHBs_P-B Product feature CHAIN FJ621627_SHBs_P-B of FT:mat_peptide FJ621627_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGLLPVCPIIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGRNLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621628_SHBs_P-B Product feature CHAIN FJ621628_SHBs_P-B of FT:mat_peptide FJ621628_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2837). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621629_SHBs_P-B Product feature CHAIN FJ621629_SHBs_P-B of FT:mat_peptide FJ621629_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3031). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621630_SHBs_P-B Product feature CHAIN FJ621630_SHBs_P-B of FT:mat_peptide FJ621630_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4301). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621631_SHBs_P-B Product feature CHAIN FJ621631_SHBs_P-B of FT:mat_peptide FJ621631_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2020). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621632_SHBs_P-B Product feature CHAIN FJ621632_SHBs_P-B of FT:mat_peptide FJ621632_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2061). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621633_SHBs_P-B Product feature CHAIN FJ621633_SHBs_P-B of FT:mat_peptide FJ621633_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3015). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621634_SHBs_P-B Product feature CHAIN FJ621634_SHBs_P-B of FT:mat_peptide FJ621634_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621635_SHBs_P-B Product feature CHAIN FJ621635_SHBs_P-B of FT:mat_peptide FJ621635_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3142). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ621636_SHBs_P-B Product feature CHAIN FJ621636_SHBs_P-B of FT:mat_peptide FJ621636_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4184). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFXLWVYI
>gnl|hbvpro|FJ621637_SHBs_P-B Product feature CHAIN FJ621637_SHBs_P-B of FT:mat_peptide FJ621637_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4204). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ621638_SHBs_P-B Product feature CHAIN FJ621638_SHBs_P-B of FT:mat_peptide FJ621638_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621639_SHBs_P-B Product feature CHAIN FJ621639_SHBs_P-B of FT:mat_peptide FJ621639_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4546). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWFWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|FJ621640_SHBs_P-B Product feature CHAIN FJ621640_SHBs_P-B of FT:mat_peptide FJ621640_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4457). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSLAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621641_SHBs_P-B Product feature CHAIN FJ621641_SHBs_P-B of FT:mat_peptide FJ621641_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1885). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIXMMWYWGPSLYNILSPFMPLLPXFFCLWVYI
>gnl|hbvpro|FJ621642_SHBs_P-B Product feature CHAIN FJ621642_SHBs_P-B of FT:mat_peptide FJ621642_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4340). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFXLWVYI
>gnl|hbvpro|FJ621643_SHBs_P-B Product feature CHAIN FJ621643_SHBs_P-B of FT:mat_peptide FJ621643_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3152). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGQSLYNILSPFIPLLPIFLCLWAYI
>gnl|hbvpro|FJ621644_SHBs_P-B Product feature CHAIN FJ621644_SHBs_P-B of FT:mat_peptide FJ621644_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4649). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCLKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621645_SHBs_P-B Product feature CHAIN FJ621645_SHBs_P-B of FT:mat_peptide FJ621645_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2781). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621646_SHBs_P-B Product feature CHAIN FJ621646_SHBs_P-B of FT:mat_peptide FJ621646_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4252). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621647_SHBs_P-B Product feature CHAIN FJ621647_SHBs_P-B of FT:mat_peptide FJ621647_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2950). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ621648_SHBs_P-B Product feature CHAIN FJ621648_SHBs_P-B of FT:mat_peptide FJ621648_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4288). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621649_SHBs_P-B Product feature CHAIN FJ621649_SHBs_P-B of FT:mat_peptide FJ621649_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4651). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621650_SHBs_P-B Product feature CHAIN FJ621650_SHBs_P-B of FT:mat_peptide FJ621650_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4157). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621651_SHBs_P-B Product feature CHAIN FJ621651_SHBs_P-B of FT:mat_peptide FJ621651_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4031). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRGPNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSSFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621652_SHBs_P-B Product feature CHAIN FJ621652_SHBs_P-B of FT:mat_peptide FJ621652_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3902). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621653_SHBs_P-B Product feature CHAIN FJ621653_SHBs_P-B of FT:mat_peptide FJ621653_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4081). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621654_SHBs_P-B Product feature CHAIN FJ621654_SHBs_P-B of FT:mat_peptide FJ621654_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4640). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVXLSXTVWLSVIWMMWXWGPSLYNILSPXMXLLXIFFCLWVXI
>gnl|hbvpro|FJ621655_SHBs_P-B Product feature CHAIN FJ621655_SHBs_P-B of FT:mat_peptide FJ621655_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4555). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621656_SHBs_P-B Product feature CHAIN FJ621656_SHBs_P-B of FT:mat_peptide FJ621656_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3196). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621657_SHBs_P-B Product feature CHAIN FJ621657_SHBs_P-B of FT:mat_peptide FJ621657_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4333). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIXMMWFWGPSLYNTLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ621658_SHBs_P-B Product feature CHAIN FJ621658_SHBs_P-B of FT:mat_peptide FJ621658_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3956). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621659_SHBs_P-B Product feature CHAIN FJ621659_SHBs_P-B of FT:mat_peptide FJ621659_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4364). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621660_SHBs_P-B Product feature CHAIN FJ621660_SHBs_P-B of FT:mat_peptide FJ621660_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4490). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621661_SHBs_P-B Product feature CHAIN FJ621661_SHBs_P-B of FT:mat_peptide FJ621661_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1875). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621662_SHBs_P-B Product feature CHAIN FJ621662_SHBs_P-B of FT:mat_peptide FJ621662_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621663_SHBs_P-B Product feature CHAIN FJ621663_SHBs_P-B of FT:mat_peptide FJ621663_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2014). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621664_SHBs_P-B Product feature CHAIN FJ621664_SHBs_P-B of FT:mat_peptide FJ621664_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2091). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ621665_SHBs_P-B Product feature CHAIN FJ621665_SHBs_P-B of FT:mat_peptide FJ621665_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2098). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621666_SHBs_P-B Product feature CHAIN FJ621666_SHBs_P-B of FT:mat_peptide FJ621666_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2809). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621667_SHBs_P-B Product feature CHAIN FJ621667_SHBs_P-B of FT:mat_peptide FJ621667_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2835). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621668_SHBs_P-B Product feature CHAIN FJ621668_SHBs_P-B of FT:mat_peptide FJ621668_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2855). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621669_SHBs_P-B Product feature CHAIN FJ621669_SHBs_P-B of FT:mat_peptide FJ621669_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2856). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621670_SHBs_P-B Product feature CHAIN FJ621670_SHBs_P-B of FT:mat_peptide FJ621670_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2880). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621671_SHBs_P-B Product feature CHAIN FJ621671_SHBs_P-B of FT:mat_peptide FJ621671_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2927). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621672_SHBs_P-B Product feature CHAIN FJ621672_SHBs_P-B of FT:mat_peptide FJ621672_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2929). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621673_SHBs_P-B Product feature CHAIN FJ621673_SHBs_P-B of FT:mat_peptide FJ621673_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2948). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ621674_SHBs_P-B Product feature CHAIN FJ621674_SHBs_P-B of FT:mat_peptide FJ621674_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2961). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621675_SHBs_P-B Product feature CHAIN FJ621675_SHBs_P-B of FT:mat_peptide FJ621675_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2992). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621676_SHBs_P-B Product feature CHAIN FJ621676_SHBs_P-B of FT:mat_peptide FJ621676_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3024). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621677_SHBs_P-B Product feature CHAIN FJ621677_SHBs_P-B of FT:mat_peptide FJ621677_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3032). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621678_SHBs_P-B Product feature CHAIN FJ621678_SHBs_P-B of FT:mat_peptide FJ621678_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3042). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621679_SHBs_P-B Product feature CHAIN FJ621679_SHBs_P-B of FT:mat_peptide FJ621679_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3047). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621680_SHBs_P-B Product feature CHAIN FJ621680_SHBs_P-B of FT:mat_peptide FJ621680_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621681_SHBs_P-B Product feature CHAIN FJ621681_SHBs_P-B of FT:mat_peptide FJ621681_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3143). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621682_SHBs_P-B Product feature CHAIN FJ621682_SHBs_P-B of FT:mat_peptide FJ621682_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3160). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621683_SHBs_P-B Product feature CHAIN FJ621683_SHBs_P-B of FT:mat_peptide FJ621683_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3162). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621684_SHBs_P-B Product feature CHAIN FJ621684_SHBs_P-B of FT:mat_peptide FJ621684_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3167). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQETSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621685_SHBs_P-B Product feature CHAIN FJ621685_SHBs_P-B of FT:mat_peptide FJ621685_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3187). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621686_SHBs_P-B Product feature CHAIN FJ621686_SHBs_P-B of FT:mat_peptide FJ621686_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3830). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLXVXXDYXGMXPVCPLIPGSSTTSTGPCKTCTAXXQGTSXFPSCCCTKPTDGNCTCIPIXSSXAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621687_SHBs_P-B Product feature CHAIN FJ621687_SHBs_P-B of FT:mat_peptide FJ621687_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3836). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTXGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621688_SHBs_P-B Product feature CHAIN FJ621688_SHBs_P-B of FT:mat_peptide FJ621688_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3852). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFXCLWVYI
>gnl|hbvpro|FJ621689_SHBs_P-B Product feature CHAIN FJ621689_SHBs_P-B of FT:mat_peptide FJ621689_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3857). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621690_SHBs_P-B Product feature CHAIN FJ621690_SHBs_P-B of FT:mat_peptide FJ621690_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3865). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621691_SHBs_P-B Product feature CHAIN FJ621691_SHBs_P-B of FT:mat_peptide FJ621691_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3874). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621692_SHBs_P-B Product feature CHAIN FJ621692_SHBs_P-B of FT:mat_peptide FJ621692_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3893). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVXWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621693_SHBs_P-B Product feature CHAIN FJ621693_SHBs_P-B of FT:mat_peptide FJ621693_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3905). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621694_SHBs_P-B Product feature CHAIN FJ621694_SHBs_P-B of FT:mat_peptide FJ621694_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3909). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621695_SHBs_P-B Product feature CHAIN FJ621695_SHBs_P-B of FT:mat_peptide FJ621695_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3911). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621696_SHBs_P-B Product feature CHAIN FJ621696_SHBs_P-B of FT:mat_peptide FJ621696_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3913). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621697_SHBs_P-B Product feature CHAIN FJ621697_SHBs_P-B of FT:mat_peptide FJ621697_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3935). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621698_SHBs_P-B Product feature CHAIN FJ621698_SHBs_P-B of FT:mat_peptide FJ621698_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3951). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621699_SHBs_P-B Product feature CHAIN FJ621699_SHBs_P-B of FT:mat_peptide FJ621699_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3960). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621700_SHBs_P-B Product feature CHAIN FJ621700_SHBs_P-B of FT:mat_peptide FJ621700_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3975). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGXXXFPSCCCTKPTDGNCTCIPIPSSWAXAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621701_SHBs_P-B Product feature CHAIN FJ621701_SHBs_P-B of FT:mat_peptide FJ621701_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4001). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIXFCLWVYI
>gnl|hbvpro|FJ621702_SHBs_P-B Product feature CHAIN FJ621702_SHBs_P-B of FT:mat_peptide FJ621702_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621703_SHBs_P-B Product feature CHAIN FJ621703_SHBs_P-B of FT:mat_peptide FJ621703_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4020). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621704_SHBs_P-B Product feature CHAIN FJ621704_SHBs_P-B of FT:mat_peptide FJ621704_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4078). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621705_SHBs_P-B Product feature CHAIN FJ621705_SHBs_P-B of FT:mat_peptide FJ621705_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4093). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621706_SHBs_P-B Product feature CHAIN FJ621706_SHBs_P-B of FT:mat_peptide FJ621706_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4107). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIXMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621707_SHBs_P-B Product feature CHAIN FJ621707_SHBs_P-B of FT:mat_peptide FJ621707_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621708_SHBs_P-B Product feature CHAIN FJ621708_SHBs_P-B of FT:mat_peptide FJ621708_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621709_SHBs_P-B Product feature CHAIN FJ621709_SHBs_P-B of FT:mat_peptide FJ621709_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4231). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621710_SHBs_P-B Product feature CHAIN FJ621710_SHBs_P-B of FT:mat_peptide FJ621710_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4237). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621711_SHBs_P-B Product feature CHAIN FJ621711_SHBs_P-B of FT:mat_peptide FJ621711_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4265). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621712_SHBs_P-B Product feature CHAIN FJ621712_SHBs_P-B of FT:mat_peptide FJ621712_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4279). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSXAFAK
YLWEXASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621713_SHBs_P-B Product feature CHAIN FJ621713_SHBs_P-B of FT:mat_peptide FJ621713_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4286). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621714_SHBs_P-B Product feature CHAIN FJ621714_SHBs_P-B of FT:mat_peptide FJ621714_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4306). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ621715_SHBs_P-B Product feature CHAIN FJ621715_SHBs_P-B of FT:mat_peptide FJ621715_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4321). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621716_SHBs_P-B Product feature CHAIN FJ621716_SHBs_P-B of FT:mat_peptide FJ621716_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4330). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621717_SHBs_P-B Product feature CHAIN FJ621717_SHBs_P-B of FT:mat_peptide FJ621717_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4331). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621718_SHBs_P-B Product feature CHAIN FJ621718_SHBs_P-B of FT:mat_peptide FJ621718_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4373). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621719_SHBs_P-B Product feature CHAIN FJ621719_SHBs_P-B of FT:mat_peptide FJ621719_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4415). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPXFXCLWVYI
>gnl|hbvpro|FJ621720_SHBs_P-B Product feature CHAIN FJ621720_SHBs_P-B of FT:mat_peptide FJ621720_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4432). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621721_SHBs_P-B Product feature CHAIN FJ621721_SHBs_P-B of FT:mat_peptide FJ621721_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4503). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621722_SHBs_P-B Product feature CHAIN FJ621722_SHBs_P-B of FT:mat_peptide FJ621722_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4504). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621723_SHBs_P-B Product feature CHAIN FJ621723_SHBs_P-B of FT:mat_peptide FJ621723_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4510). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYXGPSLYNILSPFMPLXPIFFCLWVYI
>gnl|hbvpro|FJ621724_SHBs_P-B Product feature CHAIN FJ621724_SHBs_P-B of FT:mat_peptide FJ621724_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4512). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYXGPSLYNILSPFMPLXPIFFCLWVYI
>gnl|hbvpro|FJ621725_SHBs_P-B Product feature CHAIN FJ621725_SHBs_P-B of FT:mat_peptide FJ621725_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4513). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVXLSPTVWLSVIWMMWFWGPSLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621726_SHBs_P-B Product feature CHAIN FJ621726_SHBs_P-B of FT:mat_peptide FJ621726_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4521). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLMPFVQWFVXLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621727_SHBs_P-B Product feature CHAIN FJ621727_SHBs_P-B of FT:mat_peptide FJ621727_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4525). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621728_SHBs_P-B Product feature CHAIN FJ621728_SHBs_P-B of FT:mat_peptide FJ621728_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4549). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621729_SHBs_P-B Product feature CHAIN FJ621729_SHBs_P-B of FT:mat_peptide FJ621729_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4553). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVXWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621730_SHBs_P-B Product feature CHAIN FJ621730_SHBs_P-B of FT:mat_peptide FJ621730_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4554). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621731_SHBs_P-B Product feature CHAIN FJ621731_SHBs_P-B of FT:mat_peptide FJ621731_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4562). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621732_SHBs_P-B Product feature CHAIN FJ621732_SHBs_P-B of FT:mat_peptide FJ621732_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4584). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621733_SHBs_P-B Product feature CHAIN FJ621733_SHBs_P-B of FT:mat_peptide FJ621733_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4590). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621734_SHBs_P-B Product feature CHAIN FJ621734_SHBs_P-B of FT:mat_peptide FJ621734_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4591). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621735_SHBs_P-B Product feature CHAIN FJ621735_SHBs_P-B of FT:mat_peptide FJ621735_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4601). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ621736_SHBs_P-B Product feature CHAIN FJ621736_SHBs_P-B of FT:mat_peptide FJ621736_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4670). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621737_SHBs_P-B Product feature CHAIN FJ621737_SHBs_P-B of FT:mat_peptide FJ621737_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4687). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPXLPXFFCLWVYI
>gnl|hbvpro|FJ621738_SHBs_P-B Product feature CHAIN FJ621738_SHBs_P-B of FT:mat_peptide FJ621738_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4761). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621739_SHBs_P-B Product feature CHAIN FJ621739_SHBs_P-B of FT:mat_peptide FJ621739_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4768). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621740_SHBs_P-B Product feature CHAIN FJ621740_SHBs_P-B of FT:mat_peptide FJ621740_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4777). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621741_SHBs_P-B Product feature CHAIN FJ621741_SHBs_P-B of FT:mat_peptide FJ621741_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4258). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621742_SHBs_P-B Product feature CHAIN FJ621742_SHBs_P-B of FT:mat_peptide FJ621742_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2003). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGXFPVCPLIPGSSTTSTGPCKTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621743_SHBs_P-B Product feature CHAIN FJ621743_SHBs_P-B of FT:mat_peptide FJ621743_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2000). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621744_SHBs_P-B Product feature CHAIN FJ621744_SHBs_P-B of FT:mat_peptide FJ621744_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2942). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWGFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621745_SHBs_P-B Product feature CHAIN FJ621745_SHBs_P-B of FT:mat_peptide FJ621745_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4767). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621746_SHBs_P-B Product feature CHAIN FJ621746_SHBs_P-B of FT:mat_peptide FJ621746_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4742). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTFCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621747_SHBs_P-B Product feature CHAIN FJ621747_SHBs_P-B of FT:mat_peptide FJ621747_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4599). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFXPLLPIFXCLXVYX
>gnl|hbvpro|FJ621748_SHBs_P-B Product feature CHAIN FJ621748_SHBs_P-B of FT:mat_peptide FJ621748_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3159). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621749_SHBs_P-B Product feature CHAIN FJ621749_SHBs_P-B of FT:mat_peptide FJ621749_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4106). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPXFFCLWVYI
>gnl|hbvpro|FJ621750_SHBs_P-B Product feature CHAIN FJ621750_SHBs_P-B of FT:mat_peptide FJ621750_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4160). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621751_SHBs_P-B Product feature CHAIN FJ621751_SHBs_P-B of FT:mat_peptide FJ621751_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4539). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621752_SHBs_P-B Product feature CHAIN FJ621752_SHBs_P-B of FT:mat_peptide FJ621752_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2045). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ621753_SHBs_P-B Product feature CHAIN FJ621753_SHBs_P-B of FT:mat_peptide FJ621753_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3964). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNLQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621754_SHBs_P-B Product feature CHAIN FJ621754_SHBs_P-B of FT:mat_peptide FJ621754_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4515). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCFGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFXXLSPXVWLSVIWXMWFXGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621755_SHBs_P-B Product feature CHAIN FJ621755_SHBs_P-B of FT:mat_peptide FJ621755_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4406). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVISMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621756_SHBs_P-B Product feature CHAIN FJ621756_SHBs_P-B of FT:mat_peptide FJ621756_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4723). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSLAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621757_SHBs_P-B Product feature CHAIN FJ621757_SHBs_P-B of FT:mat_peptide FJ621757_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4062). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECRGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621758_SHBs_P-B Product feature CHAIN FJ621758_SHBs_P-B of FT:mat_peptide FJ621758_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4657). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621759_SHBs_P-B Product feature CHAIN FJ621759_SHBs_P-B of FT:mat_peptide FJ621759_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621761_SHBs_P-B Product feature CHAIN FJ621761_SHBs_P-B of FT:mat_peptide FJ621761_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4307). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621762_SHBs_P-B Product feature CHAIN FJ621762_SHBs_P-B of FT:mat_peptide FJ621762_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3992). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621763_SHBs_P-B Product feature CHAIN FJ621763_SHBs_P-B of FT:mat_peptide FJ621763_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3199). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPPTCPGYRWMFLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621764_SHBs_P-B Product feature CHAIN FJ621764_SHBs_P-B of FT:mat_peptide FJ621764_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3023). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621768_SHBs_P-B Product feature CHAIN FJ621768_SHBs_P-B of FT:mat_peptide FJ621768_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4442). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621769_SHBs_P-B Product feature CHAIN FJ621769_SHBs_P-B of FT:mat_peptide FJ621769_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4269). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621770_SHBs_P-B Product feature CHAIN FJ621770_SHBs_P-B of FT:mat_peptide FJ621770_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2793). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621771_SHBs_P-B Product feature CHAIN FJ621771_SHBs_P-B of FT:mat_peptide FJ621771_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3107). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCTKPTDGXCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621772_SHBs_P-B Product feature CHAIN FJ621772_SHBs_P-B of FT:mat_peptide FJ621772_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4101). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621773_SHBs_P-B Product feature CHAIN FJ621773_SHBs_P-B of FT:mat_peptide FJ621773_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4411). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNIXSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ621774_SHBs_P-B Product feature CHAIN FJ621774_SHBs_P-B of FT:mat_peptide FJ621774_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4696). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621775_SHBs_P-B Product feature CHAIN FJ621775_SHBs_P-B of FT:mat_peptide FJ621775_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4253). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWTMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ621776_SHBs_P-B Product feature CHAIN FJ621776_SHBs_P-B of FT:mat_peptide FJ621776_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3981). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLXPLFFCLWVYI
>gnl|hbvpro|FJ621777_SHBs_P-B Product feature CHAIN FJ621777_SHBs_P-B of FT:mat_peptide FJ621777_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2791). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621778_SHBs_P-B Product feature CHAIN FJ621778_SHBs_P-B of FT:mat_peptide FJ621778_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621779_SHBs_P-B Product feature CHAIN FJ621779_SHBs_P-B of FT:mat_peptide FJ621779_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4096). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621780_SHBs_P-B Product feature CHAIN FJ621780_SHBs_P-B of FT:mat_peptide FJ621780_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4747). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
XXNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGVTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621781_SHBs_P-B Product feature CHAIN FJ621781_SHBs_P-B of FT:mat_peptide FJ621781_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3168). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621782_SHBs_P-B Product feature CHAIN FJ621782_SHBs_P-B of FT:mat_peptide FJ621782_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4563). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621783_SHBs_P-B Product feature CHAIN FJ621783_SHBs_P-B of FT:mat_peptide FJ621783_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4128). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621784_SHBs_P-B Product feature CHAIN FJ621784_SHBs_P-B of FT:mat_peptide FJ621784_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4129). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621785_SHBs_P-B Product feature CHAIN FJ621785_SHBs_P-B of FT:mat_peptide FJ621785_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4656). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLXIXFXLWVYI
>gnl|hbvpro|FJ621786_SHBs_P-B Product feature CHAIN FJ621786_SHBs_P-B of FT:mat_peptide FJ621786_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4580). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621787_SHBs_P-B Product feature CHAIN FJ621787_SHBs_P-B of FT:mat_peptide FJ621787_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4458). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621788_SHBs_P-B Product feature CHAIN FJ621788_SHBs_P-B of FT:mat_peptide FJ621788_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4221). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILXLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621789_SHBs_P-B Product feature CHAIN FJ621789_SHBs_P-B of FT:mat_peptide FJ621789_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4743). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621790_SHBs_P-B Product feature CHAIN FJ621790_SHBs_P-B of FT:mat_peptide FJ621790_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4765). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621791_SHBs_P-B Product feature CHAIN FJ621791_SHBs_P-B of FT:mat_peptide FJ621791_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4360). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ621792_SHBs_P-B Product feature CHAIN FJ621792_SHBs_P-B of FT:mat_peptide FJ621792_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3038). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621793_SHBs_P-B Product feature CHAIN FJ621793_SHBs_P-B of FT:mat_peptide FJ621793_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3204). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621794_SHBs_P-B Product feature CHAIN FJ621794_SHBs_P-B of FT:mat_peptide FJ621794_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4502). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621795_SHBs_P-B Product feature CHAIN FJ621795_SHBs_P-B of FT:mat_peptide FJ621795_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2935). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSLAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621796_SHBs_P-B Product feature CHAIN FJ621796_SHBs_P-B of FT:mat_peptide FJ621796_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1876). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621797_SHBs_P-B Product feature CHAIN FJ621797_SHBs_P-B of FT:mat_peptide FJ621797_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2052). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621800_SHBs_P-B Product feature CHAIN FJ621800_SHBs_P-B of FT:mat_peptide FJ621800_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2825). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSSTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCKTCTTPAQGTSMFPSRCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621801_SHBs_P-B Product feature CHAIN FJ621801_SHBs_P-B of FT:mat_peptide FJ621801_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3937). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWFWGPRLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|FJ621802_SHBs_P-B Product feature CHAIN FJ621802_SHBs_P-B of FT:mat_peptide FJ621802_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4636). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQRLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621803_SHBs_P-B Product feature CHAIN FJ621803_SHBs_P-B of FT:mat_peptide FJ621803_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2974). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWXPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621804_SHBs_P-B Product feature CHAIN FJ621804_SHBs_P-B of FT:mat_peptide FJ621804_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2862). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621805_SHBs_P-B Product feature CHAIN FJ621805_SHBs_P-B of FT:mat_peptide FJ621805_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2863). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621806_SHBs_P-B Product feature CHAIN FJ621806_SHBs_P-B of FT:mat_peptide FJ621806_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3176). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621807_SHBs_P-B Product feature CHAIN FJ621807_SHBs_P-B of FT:mat_peptide FJ621807_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S4793). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621808_SHBs_P-B Product feature CHAIN FJ621808_SHBs_P-B of FT:mat_peptide FJ621808_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3049). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ621809_SHBs_P-B Product feature CHAIN FJ621809_SHBs_P-B of FT:mat_peptide FJ621809_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1893). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLIELQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ709477_SHBs_P-B Product feature CHAIN FJ709477_SHBs_P-B of FT:mat_peptide FJ709477_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CHI21). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ709490_SHBs_P-B Product feature CHAIN FJ709490_SHBs_P-B of FT:mat_peptide FJ709490_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CHI37). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ743728_SHBs_P-B Product feature CHAIN FJ743728_SHBs_P-B of FT:mat_peptide FJ743728_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HY1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ743737_SHBs_P-B Product feature CHAIN FJ743737_SHBs_P-B of FT:mat_peptide FJ743737_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HY10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751273_SHBs_P-B Product feature CHAIN FJ751273_SHBs_P-B of FT:mat_peptide FJ751273_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASRLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751275_SHBs_P-B Product feature CHAIN FJ751275_SHBs_P-B of FT:mat_peptide FJ751275_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751276_SHBs_P-B Product feature CHAIN FJ751276_SHBs_P-B of FT:mat_peptide FJ751276_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ751278_SHBs_P-B Product feature CHAIN FJ751278_SHBs_P-B of FT:mat_peptide FJ751278_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC18.R+P1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751280_SHBs_P-B Product feature CHAIN FJ751280_SHBs_P-B of FT:mat_peptide FJ751280_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC20.R+P1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751283_SHBs_P-B Product feature CHAIN FJ751283_SHBs_P-B of FT:mat_peptide FJ751283_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751285_SHBs_P-B Product feature CHAIN FJ751285_SHBs_P-B of FT:mat_peptide FJ751285_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC27-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751288_SHBs_P-B Product feature CHAIN FJ751288_SHBs_P-B of FT:mat_peptide FJ751288_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751293_SHBs_P-B Product feature CHAIN FJ751293_SHBs_P-B of FT:mat_peptide FJ751293_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751296_SHBs_P-B Product feature CHAIN FJ751296_SHBs_P-B of FT:mat_peptide FJ751296_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC44). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGQNLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751299_SHBs_P-B Product feature CHAIN FJ751299_SHBs_P-B of FT:mat_peptide FJ751299_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC47). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFASCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751306_SHBs_P-B Product feature CHAIN FJ751306_SHBs_P-B of FT:mat_peptide FJ751306_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC63). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751307_SHBs_P-B Product feature CHAIN FJ751307_SHBs_P-B of FT:mat_peptide FJ751307_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC64). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751308_SHBs_P-B Product feature CHAIN FJ751308_SHBs_P-B of FT:mat_peptide FJ751308_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC66). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751312_SHBs_P-B Product feature CHAIN FJ751312_SHBs_P-B of FT:mat_peptide FJ751312_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC72). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLPCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751314_SHBs_P-B Product feature CHAIN FJ751314_SHBs_P-B of FT:mat_peptide FJ751314_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LC75). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751317_SHBs_P-B Product feature CHAIN FJ751317_SHBs_P-B of FT:mat_peptide FJ751317_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LZM11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751347_SHBs_P-B Product feature CHAIN FJ751347_SHBs_P-B of FT:mat_peptide FJ751347_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751348_SHBs_P-B Product feature CHAIN FJ751348_SHBs_P-B of FT:mat_peptide FJ751348_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751350_SHBs_P-B Product feature CHAIN FJ751350_SHBs_P-B of FT:mat_peptide FJ751350_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A21). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751356_SHBs_P-B Product feature CHAIN FJ751356_SHBs_P-B of FT:mat_peptide FJ751356_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WX8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751358_SHBs_P-B Product feature CHAIN FJ751358_SHBs_P-B of FT:mat_peptide FJ751358_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WX11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751359_SHBs_P-B Product feature CHAIN FJ751359_SHBs_P-B of FT:mat_peptide FJ751359_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WX13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751366_SHBs_P-B Product feature CHAIN FJ751366_SHBs_P-B of FT:mat_peptide FJ751366_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WX21). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751367_SHBs_P-B Product feature CHAIN FJ751367_SHBs_P-B of FT:mat_peptide FJ751367_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WX22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751369_SHBs_P-B Product feature CHAIN FJ751369_SHBs_P-B of FT:mat_peptide FJ751369_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WX24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751376_SHBs_P-B Product feature CHAIN FJ751376_SHBs_P-B of FT:mat_peptide FJ751376_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WX31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751389_SHBs_P-B Product feature CHAIN FJ751389_SHBs_P-B of FT:mat_peptide FJ751389_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751390_SHBs_P-B Product feature CHAIN FJ751390_SHBs_P-B of FT:mat_peptide FJ751390_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751391_SHBs_P-B Product feature CHAIN FJ751391_SHBs_P-B of FT:mat_peptide FJ751391_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751392_SHBs_P-B Product feature CHAIN FJ751392_SHBs_P-B of FT:mat_peptide FJ751392_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751395_SHBs_P-B Product feature CHAIN FJ751395_SHBs_P-B of FT:mat_peptide FJ751395_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751397_SHBs_P-B Product feature CHAIN FJ751397_SHBs_P-B of FT:mat_peptide FJ751397_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751398_SHBs_P-B Product feature CHAIN FJ751398_SHBs_P-B of FT:mat_peptide FJ751398_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751399_SHBs_P-B Product feature CHAIN FJ751399_SHBs_P-B of FT:mat_peptide FJ751399_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751400_SHBs_P-B Product feature CHAIN FJ751400_SHBs_P-B of FT:mat_peptide FJ751400_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751402_SHBs_P-B Product feature CHAIN FJ751402_SHBs_P-B of FT:mat_peptide FJ751402_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751403_SHBs_P-B Product feature CHAIN FJ751403_SHBs_P-B of FT:mat_peptide FJ751403_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751406_SHBs_P-B Product feature CHAIN FJ751406_SHBs_P-B of FT:mat_peptide FJ751406_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751407_SHBs_P-B Product feature CHAIN FJ751407_SHBs_P-B of FT:mat_peptide FJ751407_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751408_SHBs_P-B Product feature CHAIN FJ751408_SHBs_P-B of FT:mat_peptide FJ751408_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ28). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751411_SHBs_P-B Product feature CHAIN FJ751411_SHBs_P-B of FT:mat_peptide FJ751411_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751413_SHBs_P-B Product feature CHAIN FJ751413_SHBs_P-B of FT:mat_peptide FJ751413_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ37). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751415_SHBs_P-B Product feature CHAIN FJ751415_SHBs_P-B of FT:mat_peptide FJ751415_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751416_SHBs_P-B Product feature CHAIN FJ751416_SHBs_P-B of FT:mat_peptide FJ751416_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751419_SHBs_P-B Product feature CHAIN FJ751419_SHBs_P-B of FT:mat_peptide FJ751419_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ44). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751421_SHBs_P-B Product feature CHAIN FJ751421_SHBs_P-B of FT:mat_peptide FJ751421_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BB1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751429_SHBs_P-B Product feature CHAIN FJ751429_SHBs_P-B of FT:mat_peptide FJ751429_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BB13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751431_SHBs_P-B Product feature CHAIN FJ751431_SHBs_P-B of FT:mat_peptide FJ751431_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BB15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751435_SHBs_P-B Product feature CHAIN FJ751435_SHBs_P-B of FT:mat_peptide FJ751435_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BB20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751450_SHBs_P-B Product feature CHAIN FJ751450_SHBs_P-B of FT:mat_peptide FJ751450_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751451_SHBs_P-B Product feature CHAIN FJ751451_SHBs_P-B of FT:mat_peptide FJ751451_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751452_SHBs_P-B Product feature CHAIN FJ751452_SHBs_P-B of FT:mat_peptide FJ751452_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751453_SHBs_P-B Product feature CHAIN FJ751453_SHBs_P-B of FT:mat_peptide FJ751453_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C42). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSQISSHSPTCCPPTCPGYRWMFLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILTPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751461_SHBs_P-B Product feature CHAIN FJ751461_SHBs_P-B of FT:mat_peptide FJ751461_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c132). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751462_SHBs_P-B Product feature CHAIN FJ751462_SHBs_P-B of FT:mat_peptide FJ751462_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751466_SHBs_P-B Product feature CHAIN FJ751466_SHBs_P-B of FT:mat_peptide FJ751466_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C172). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751467_SHBs_P-B Product feature CHAIN FJ751467_SHBs_P-B of FT:mat_peptide FJ751467_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c173). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751468_SHBs_P-B Product feature CHAIN FJ751468_SHBs_P-B of FT:mat_peptide FJ751468_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c176). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751469_SHBs_P-B Product feature CHAIN FJ751469_SHBs_P-B of FT:mat_peptide FJ751469_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c185). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751470_SHBs_P-B Product feature CHAIN FJ751470_SHBs_P-B of FT:mat_peptide FJ751470_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c189). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751471_SHBs_P-B Product feature CHAIN FJ751471_SHBs_P-B of FT:mat_peptide FJ751471_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c205). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFMPLLPIFLCLWVYI
>gnl|hbvpro|FJ751472_SHBs_P-B Product feature CHAIN FJ751472_SHBs_P-B of FT:mat_peptide FJ751472_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C212). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751473_SHBs_P-B Product feature CHAIN FJ751473_SHBs_P-B of FT:mat_peptide FJ751473_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C216). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ751479_SHBs_P-B Product feature CHAIN FJ751479_SHBs_P-B of FT:mat_peptide FJ751479_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c237). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDIPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ751480_SHBs_P-B Product feature CHAIN FJ751480_SHBs_P-B of FT:mat_peptide FJ751480_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c239). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751482_SHBs_P-B Product feature CHAIN FJ751482_SHBs_P-B of FT:mat_peptide FJ751482_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate c244). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLRFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751490_SHBs_P-B Product feature CHAIN FJ751490_SHBs_P-B of FT:mat_peptide FJ751490_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CP). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751493_SHBs_P-B Product feature CHAIN FJ751493_SHBs_P-B of FT:mat_peptide FJ751493_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF13-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751495_SHBs_P-B Product feature CHAIN FJ751495_SHBs_P-B of FT:mat_peptide FJ751495_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF18-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751498_SHBs_P-B Product feature CHAIN FJ751498_SHBs_P-B of FT:mat_peptide FJ751498_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF34-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751503_SHBs_P-B Product feature CHAIN FJ751503_SHBs_P-B of FT:mat_peptide FJ751503_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF48). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751504_SHBs_P-B Product feature CHAIN FJ751504_SHBs_P-B of FT:mat_peptide FJ751504_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF50). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751505_SHBs_P-B Product feature CHAIN FJ751505_SHBs_P-B of FT:mat_peptide FJ751505_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF51). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751508_SHBs_P-B Product feature CHAIN FJ751508_SHBs_P-B of FT:mat_peptide FJ751508_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF66-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751509_SHBs_P-B Product feature CHAIN FJ751509_SHBs_P-B of FT:mat_peptide FJ751509_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF67). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751511_SHBs_P-B Product feature CHAIN FJ751511_SHBs_P-B of FT:mat_peptide FJ751511_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF69). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLIFLGGTPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751512_SHBs_P-B Product feature CHAIN FJ751512_SHBs_P-B of FT:mat_peptide FJ751512_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF72). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751518_SHBs_P-B Product feature CHAIN FJ751518_SHBs_P-B of FT:mat_peptide FJ751518_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF84-B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751522_SHBs_P-B Product feature CHAIN FJ751522_SHBs_P-B of FT:mat_peptide FJ751522_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF93-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751523_SHBs_P-B Product feature CHAIN FJ751523_SHBs_P-B of FT:mat_peptide FJ751523_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF95-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751526_SHBs_P-B Product feature CHAIN FJ751526_SHBs_P-B of FT:mat_peptide FJ751526_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF103-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751530_SHBs_P-B Product feature CHAIN FJ751530_SHBs_P-B of FT:mat_peptide FJ751530_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF112-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751531_SHBs_P-B Product feature CHAIN FJ751531_SHBs_P-B of FT:mat_peptide FJ751531_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF113-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSLAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751535_SHBs_P-B Product feature CHAIN FJ751535_SHBs_P-B of FT:mat_peptide FJ751535_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF129-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751537_SHBs_P-B Product feature CHAIN FJ751537_SHBs_P-B of FT:mat_peptide FJ751537_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF131-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCFGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751543_SHBs_P-B Product feature CHAIN FJ751543_SHBs_P-B of FT:mat_peptide FJ751543_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF141-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751544_SHBs_P-B Product feature CHAIN FJ751544_SHBs_P-B of FT:mat_peptide FJ751544_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF142-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751547_SHBs_P-B Product feature CHAIN FJ751547_SHBs_P-B of FT:mat_peptide FJ751547_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF152-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751555_SHBs_P-B Product feature CHAIN FJ751555_SHBs_P-B of FT:mat_peptide FJ751555_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF196-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751556_SHBs_P-B Product feature CHAIN FJ751556_SHBs_P-B of FT:mat_peptide FJ751556_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KXF197-b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751566_SHBs_P-B Product feature CHAIN FJ751566_SHBs_P-B of FT:mat_peptide FJ751566_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751571_SHBs_P-B Product feature CHAIN FJ751571_SHBs_P-B of FT:mat_peptide FJ751571_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKIHTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751577_SHBs_P-B Product feature CHAIN FJ751577_SHBs_P-B of FT:mat_peptide FJ751577_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751579_SHBs_P-B Product feature CHAIN FJ751579_SHBs_P-B of FT:mat_peptide FJ751579_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751585_SHBs_P-B Product feature CHAIN FJ751585_SHBs_P-B of FT:mat_peptide FJ751585_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751587_SHBs_P-B Product feature CHAIN FJ751587_SHBs_P-B of FT:mat_peptide FJ751587_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751590_SHBs_P-B Product feature CHAIN FJ751590_SHBs_P-B of FT:mat_peptide FJ751590_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD38). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751592_SHBs_P-B Product feature CHAIN FJ751592_SHBs_P-B of FT:mat_peptide FJ751592_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751595_SHBs_P-B Product feature CHAIN FJ751595_SHBs_P-B of FT:mat_peptide FJ751595_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HD46). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWISLNFLGGSPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751608_SHBs_P-B Product feature CHAIN FJ751608_SHBs_P-B of FT:mat_peptide FJ751608_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JL14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ751610_SHBs_P-B Product feature CHAIN FJ751610_SHBs_P-B of FT:mat_peptide FJ751610_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JL17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751612_SHBs_P-B Product feature CHAIN FJ751612_SHBs_P-B of FT:mat_peptide FJ751612_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JL23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCLKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751613_SHBs_P-B Product feature CHAIN FJ751613_SHBs_P-B of FT:mat_peptide FJ751613_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JL24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ751615_SHBs_P-B Product feature CHAIN FJ751615_SHBs_P-B of FT:mat_peptide FJ751615_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZL). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787444_SHBs_P-B Product feature CHAIN FJ787444_SHBs_P-B of FT:mat_peptide FJ787444_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787475_SHBs_P-B Product feature CHAIN FJ787475_SHBs_P-B of FT:mat_peptide FJ787475_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWVWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPYMPLLPIFFCLWVYI
>gnl|hbvpro|FJ787477_SHBs_P-B Product feature CHAIN FJ787477_SHBs_P-B of FT:mat_peptide FJ787477_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPQICPGYRLMCLRRF
IILLCILLLCLIFLLVLLDYQGMLLVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ899779_SHBs_P-B Product feature CHAIN FJ899779_SHBs_P-B of FT:mat_peptide FJ899779_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRL
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ899784_SHBs_P-B Product feature CHAIN FJ899784_SHBs_P-B of FT:mat_peptide FJ899784_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899785_SHBs_P-B Product feature CHAIN FJ899785_SHBs_P-B of FT:mat_peptide FJ899785_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899786_SHBs_P-B Product feature CHAIN FJ899786_SHBs_P-B of FT:mat_peptide FJ899786_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899787_SHBs_P-B Product feature CHAIN FJ899787_SHBs_P-B of FT:mat_peptide FJ899787_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGETLVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ899790_SHBs_P-B Product feature CHAIN FJ899790_SHBs_P-B of FT:mat_peptide FJ899790_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ899791_SHBs_P-B Product feature CHAIN FJ899791_SHBs_P-B of FT:mat_peptide FJ899791_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|FJ919933_SHBs_P-B Product feature CHAIN FJ919933_SHBs_P-B of FT:mat_peptide FJ919933_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGEPPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ919934_SHBs_P-B Product feature CHAIN FJ919934_SHBs_P-B of FT:mat_peptide FJ919934_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FM200206_SHBs_P-B Product feature CHAIN FM200206_SHBs_P-B of FT:mat_peptide FM200206_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYHWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295499_SHBs_P-B Product feature CHAIN FN295499_SHBs_P-B of FT:mat_peptide FN295499_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295502_SHBs_P-B Product feature CHAIN FN295502_SHBs_P-B of FT:mat_peptide FN295502_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295522_SHBs_P-B Product feature CHAIN FN295522_SHBs_P-B of FT:mat_peptide FN295522_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M32). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295535_SHBs_P-B Product feature CHAIN FN295535_SHBs_P-B of FT:mat_peptide FN295535_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1_B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295536_SHBs_P-B Product feature CHAIN FN295536_SHBs_P-B of FT:mat_peptide FN295536_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AR3_B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295537_SHBs_P-B Product feature CHAIN FN295537_SHBs_P-B of FT:mat_peptide FN295537_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AR5_B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295538_SHBs_P-B Product feature CHAIN FN295538_SHBs_P-B of FT:mat_peptide FN295538_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AR6_B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FN295539_SHBs_P-B Product feature CHAIN FN295539_SHBs_P-B of FT:mat_peptide FN295539_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RB1_B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821800_SHBs_P-B Product feature CHAIN FR821800_SHBs_P-B of FT:mat_peptide FR821800_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|FR821801_SHBs_P-B Product feature CHAIN FR821801_SHBs_P-B of FT:mat_peptide FR821801_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTRPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGPSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|FR821803_SHBs_P-B Product feature CHAIN FR821803_SHBs_P-B of FT:mat_peptide FR821803_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGRLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821804_SHBs_P-B Product feature CHAIN FR821804_SHBs_P-B of FT:mat_peptide FR821804_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|FR821805_SHBs_P-B Product feature CHAIN FR821805_SHBs_P-B of FT:mat_peptide FR821805_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|FR821806_SHBs_P-B Product feature CHAIN FR821806_SHBs_P-B of FT:mat_peptide FR821806_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|FR821807_SHBs_P-B Product feature CHAIN FR821807_SHBs_P-B of FT:mat_peptide FR821807_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|FR821808_SHBs_P-B Product feature CHAIN FR821808_SHBs_P-B of FT:mat_peptide FR821808_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR821809_SHBs_P-B Product feature CHAIN FR821809_SHBs_P-B of FT:mat_peptide FR821809_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821817_SHBs_P-B Product feature CHAIN FR821817_SHBs_P-B of FT:mat_peptide FR821817_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVRLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRI
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR821844_SHBs_P-B Product feature CHAIN FR821844_SHBs_P-B of FT:mat_peptide FR821844_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR821889_SHBs_P-B Product feature CHAIN FR821889_SHBs_P-B of FT:mat_peptide FR821889_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821892_SHBs_P-B Product feature CHAIN FR821892_SHBs_P-B of FT:mat_peptide FR821892_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR821902_SHBs_P-B Product feature CHAIN FR821902_SHBs_P-B of FT:mat_peptide FR821902_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR821906_SHBs_P-B Product feature CHAIN FR821906_SHBs_P-B of FT:mat_peptide FR821906_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR821911_SHBs_P-B Product feature CHAIN FR821911_SHBs_P-B of FT:mat_peptide FR821911_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821912_SHBs_P-B Product feature CHAIN FR821912_SHBs_P-B of FT:mat_peptide FR821912_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821913_SHBs_P-B Product feature CHAIN FR821913_SHBs_P-B of FT:mat_peptide FR821913_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821914_SHBs_P-B Product feature CHAIN FR821914_SHBs_P-B of FT:mat_peptide FR821914_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLHNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821928_SHBs_P-B Product feature CHAIN FR821928_SHBs_P-B of FT:mat_peptide FR821928_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLWRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821937_SHBs_P-B Product feature CHAIN FR821937_SHBs_P-B of FT:mat_peptide FR821937_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLIKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGPSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821940_SHBs_P-B Product feature CHAIN FR821940_SHBs_P-B of FT:mat_peptide FR821940_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821972_SHBs_P-B Product feature CHAIN FR821972_SHBs_P-B of FT:mat_peptide FR821972_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTCTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821975_SHBs_P-B Product feature CHAIN FR821975_SHBs_P-B of FT:mat_peptide FR821975_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSRSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR821978_SHBs_P-B Product feature CHAIN FR821978_SHBs_P-B of FT:mat_peptide FR821978_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGCRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822020_SHBs_P-B Product feature CHAIN FR822020_SHBs_P-B of FT:mat_peptide FR822020_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSRAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822021_SHBs_P-B Product feature CHAIN FR822021_SHBs_P-B of FT:mat_peptide FR822021_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822032_SHBs_P-B Product feature CHAIN FR822032_SHBs_P-B of FT:mat_peptide FR822032_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGDCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822044_SHBs_P-B Product feature CHAIN FR822044_SHBs_P-B of FT:mat_peptide FR822044_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR822055_SHBs_P-B Product feature CHAIN FR822055_SHBs_P-B of FT:mat_peptide FR822055_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822056_SHBs_P-B Product feature CHAIN FR822056_SHBs_P-B of FT:mat_peptide FR822056_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822058_SHBs_P-B Product feature CHAIN FR822058_SHBs_P-B of FT:mat_peptide FR822058_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822060_SHBs_P-B Product feature CHAIN FR822060_SHBs_P-B of FT:mat_peptide FR822060_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPTFFCLWVYI
>gnl|hbvpro|FR822062_SHBs_P-B Product feature CHAIN FR822062_SHBs_P-B of FT:mat_peptide FR822062_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822063_SHBs_P-B Product feature CHAIN FR822063_SHBs_P-B of FT:mat_peptide FR822063_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822065_SHBs_P-B Product feature CHAIN FR822065_SHBs_P-B of FT:mat_peptide FR822065_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822068_SHBs_P-B Product feature CHAIN FR822068_SHBs_P-B of FT:mat_peptide FR822068_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822070_SHBs_P-B Product feature CHAIN FR822070_SHBs_P-B of FT:mat_peptide FR822070_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLILGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822071_SHBs_P-B Product feature CHAIN FR822071_SHBs_P-B of FT:mat_peptide FR822071_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822072_SHBs_P-B Product feature CHAIN FR822072_SHBs_P-B of FT:mat_peptide FR822072_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRYSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822080_SHBs_P-B Product feature CHAIN FR822080_SHBs_P-B of FT:mat_peptide FR822080_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPVQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822082_SHBs_P-B Product feature CHAIN FR822082_SHBs_P-B of FT:mat_peptide FR822082_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822083_SHBs_P-B Product feature CHAIN FR822083_SHBs_P-B of FT:mat_peptide FR822083_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822084_SHBs_P-B Product feature CHAIN FR822084_SHBs_P-B of FT:mat_peptide FR822084_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822085_SHBs_P-B Product feature CHAIN FR822085_SHBs_P-B of FT:mat_peptide FR822085_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822086_SHBs_P-B Product feature CHAIN FR822086_SHBs_P-B of FT:mat_peptide FR822086_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822087_SHBs_P-B Product feature CHAIN FR822087_SHBs_P-B of FT:mat_peptide FR822087_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822088_SHBs_P-B Product feature CHAIN FR822088_SHBs_P-B of FT:mat_peptide FR822088_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822089_SHBs_P-B Product feature CHAIN FR822089_SHBs_P-B of FT:mat_peptide FR822089_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTRIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822090_SHBs_P-B Product feature CHAIN FR822090_SHBs_P-B of FT:mat_peptide FR822090_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGRNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLPCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822092_SHBs_P-B Product feature CHAIN FR822092_SHBs_P-B of FT:mat_peptide FR822092_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822093_SHBs_P-B Product feature CHAIN FR822093_SHBs_P-B of FT:mat_peptide FR822093_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822094_SHBs_P-B Product feature CHAIN FR822094_SHBs_P-B of FT:mat_peptide FR822094_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822095_SHBs_P-B Product feature CHAIN FR822095_SHBs_P-B of FT:mat_peptide FR822095_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822096_SHBs_P-B Product feature CHAIN FR822096_SHBs_P-B of FT:mat_peptide FR822096_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
TIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822097_SHBs_P-B Product feature CHAIN FR822097_SHBs_P-B of FT:mat_peptide FR822097_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822105_SHBs_P-B Product feature CHAIN FR822105_SHBs_P-B of FT:mat_peptide FR822105_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPSMPLLPIFFCLWVYI
>gnl|hbvpro|FR822106_SHBs_P-B Product feature CHAIN FR822106_SHBs_P-B of FT:mat_peptide FR822106_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822107_SHBs_P-B Product feature CHAIN FR822107_SHBs_P-B of FT:mat_peptide FR822107_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822108_SHBs_P-B Product feature CHAIN FR822108_SHBs_P-B of FT:mat_peptide FR822108_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822109_SHBs_P-B Product feature CHAIN FR822109_SHBs_P-B of FT:mat_peptide FR822109_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822132_SHBs_P-B Product feature CHAIN FR822132_SHBs_P-B of FT:mat_peptide FR822132_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822158_SHBs_P-B Product feature CHAIN FR822158_SHBs_P-B of FT:mat_peptide FR822158_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822159_SHBs_P-B Product feature CHAIN FR822159_SHBs_P-B of FT:mat_peptide FR822159_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822160_SHBs_P-B Product feature CHAIN FR822160_SHBs_P-B of FT:mat_peptide FR822160_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPIVQWFVGLSPTVWLSAIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822161_SHBs_P-B Product feature CHAIN FR822161_SHBs_P-B of FT:mat_peptide FR822161_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822162_SHBs_P-B Product feature CHAIN FR822162_SHBs_P-B of FT:mat_peptide FR822162_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822163_SHBs_P-B Product feature CHAIN FR822163_SHBs_P-B of FT:mat_peptide FR822163_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGHRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822164_SHBs_P-B Product feature CHAIN FR822164_SHBs_P-B of FT:mat_peptide FR822164_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR822167_SHBs_P-B Product feature CHAIN FR822167_SHBs_P-B of FT:mat_peptide FR822167_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FR822171_SHBs_P-B Product feature CHAIN FR822171_SHBs_P-B of FT:mat_peptide FR822171_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQVSSHSPTCCPPTCPGHRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325779_SHBs_P-B Product feature CHAIN GQ325779_SHBs_P-B of FT:mat_peptide GQ325779_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325780_SHBs_P-B Product feature CHAIN GQ325780_SHBs_P-B of FT:mat_peptide GQ325780_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325781_SHBs_P-B Product feature CHAIN GQ325781_SHBs_P-B of FT:mat_peptide GQ325781_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325783_SHBs_P-B Product feature CHAIN GQ325783_SHBs_P-B of FT:mat_peptide GQ325783_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325787_SHBs_P-B Product feature CHAIN GQ325787_SHBs_P-B of FT:mat_peptide GQ325787_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPARNISMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFMPLLXIFFCLWXYI
>gnl|hbvpro|GQ325788_SHBs_P-B Product feature CHAIN GQ325788_SHBs_P-B of FT:mat_peptide GQ325788_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLXXPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ325789_SHBs_P-B Product feature CHAIN GQ325789_SHBs_P-B of FT:mat_peptide GQ325789_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325790_SHBs_P-B Product feature CHAIN GQ325790_SHBs_P-B of FT:mat_peptide GQ325790_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKVCITPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325791_SHBs_P-B Product feature CHAIN GQ325791_SHBs_P-B of FT:mat_peptide GQ325791_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLXAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325793_SHBs_P-B Product feature CHAIN GQ325793_SHBs_P-B of FT:mat_peptide GQ325793_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HTT). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNTLSPFXPLLPIFFCLWAYI
>gnl|hbvpro|GQ325794_SHBs_P-B Product feature CHAIN GQ325794_SHBs_P-B of FT:mat_peptide GQ325794_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JS). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325795_SHBs_P-B Product feature CHAIN GQ325795_SHBs_P-B of FT:mat_peptide GQ325795_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LCS). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPXICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325796_SHBs_P-B Product feature CHAIN GQ325796_SHBs_P-B of FT:mat_peptide GQ325796_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LS). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQXSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ325797_SHBs_P-B Product feature CHAIN GQ325797_SHBs_P-B of FT:mat_peptide GQ325797_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LYC). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358136_SHBs_P-B Product feature CHAIN GQ358136_SHBs_P-B of FT:mat_peptide GQ358136_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358137_SHBs_P-B Product feature CHAIN GQ358137_SHBs_P-B of FT:mat_peptide GQ358137_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358138_SHBs_P-B Product feature CHAIN GQ358138_SHBs_P-B of FT:mat_peptide GQ358138_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358139_SHBs_P-B Product feature CHAIN GQ358139_SHBs_P-B of FT:mat_peptide GQ358139_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT032). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358140_SHBs_P-B Product feature CHAIN GQ358140_SHBs_P-B of FT:mat_peptide GQ358140_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358141_SHBs_P-B Product feature CHAIN GQ358141_SHBs_P-B of FT:mat_peptide GQ358141_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358142_SHBs_P-B Product feature CHAIN GQ358142_SHBs_P-B of FT:mat_peptide GQ358142_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358143_SHBs_P-B Product feature CHAIN GQ358143_SHBs_P-B of FT:mat_peptide GQ358143_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358144_SHBs_P-B Product feature CHAIN GQ358144_SHBs_P-B of FT:mat_peptide GQ358144_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASRLPRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLRGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLREWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358145_SHBs_P-B Product feature CHAIN GQ358145_SHBs_P-B of FT:mat_peptide GQ358145_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358146_SHBs_P-B Product feature CHAIN GQ358146_SHBs_P-B of FT:mat_peptide GQ358146_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358147_SHBs_P-B Product feature CHAIN GQ358147_SHBs_P-B of FT:mat_peptide GQ358147_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358148_SHBs_P-B Product feature CHAIN GQ358148_SHBs_P-B of FT:mat_peptide GQ358148_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358149_SHBs_P-B Product feature CHAIN GQ358149_SHBs_P-B of FT:mat_peptide GQ358149_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358150_SHBs_P-B Product feature CHAIN GQ358150_SHBs_P-B of FT:mat_peptide GQ358150_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ358151_SHBs_P-B Product feature CHAIN GQ358151_SHBs_P-B of FT:mat_peptide GQ358151_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ358152_SHBs_P-B Product feature CHAIN GQ358152_SHBs_P-B of FT:mat_peptide GQ358152_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377519_SHBs_P-B Product feature CHAIN GQ377519_SHBs_P-B of FT:mat_peptide GQ377519_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377525_SHBs_P-B Product feature CHAIN GQ377525_SHBs_P-B of FT:mat_peptide GQ377525_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377537_SHBs_P-B Product feature CHAIN GQ377537_SHBs_P-B of FT:mat_peptide GQ377537_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSGLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377542_SHBs_P-B Product feature CHAIN GQ377542_SHBs_P-B of FT:mat_peptide GQ377542_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377547_SHBs_P-B Product feature CHAIN GQ377547_SHBs_P-B of FT:mat_peptide GQ377547_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377558_SHBs_P-B Product feature CHAIN GQ377558_SHBs_P-B of FT:mat_peptide GQ377558_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377561_SHBs_P-B Product feature CHAIN GQ377561_SHBs_P-B of FT:mat_peptide GQ377561_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377566_SHBs_P-B Product feature CHAIN GQ377566_SHBs_P-B of FT:mat_peptide GQ377566_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377567_SHBs_P-B Product feature CHAIN GQ377567_SHBs_P-B of FT:mat_peptide GQ377567_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTTTGPCKTCTVPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377568_SHBs_P-B Product feature CHAIN GQ377568_SHBs_P-B of FT:mat_peptide GQ377568_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377569_SHBs_P-B Product feature CHAIN GQ377569_SHBs_P-B of FT:mat_peptide GQ377569_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377582_SHBs_P-B Product feature CHAIN GQ377582_SHBs_P-B of FT:mat_peptide GQ377582_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377587_SHBs_P-B Product feature CHAIN GQ377587_SHBs_P-B of FT:mat_peptide GQ377587_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377588_SHBs_P-B Product feature CHAIN GQ377588_SHBs_P-B of FT:mat_peptide GQ377588_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377606_SHBs_P-B Product feature CHAIN GQ377606_SHBs_P-B of FT:mat_peptide GQ377606_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377610_SHBs_P-B Product feature CHAIN GQ377610_SHBs_P-B of FT:mat_peptide GQ377610_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ377612_SHBs_P-B Product feature CHAIN GQ377612_SHBs_P-B of FT:mat_peptide GQ377612_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377622_SHBs_P-B Product feature CHAIN GQ377622_SHBs_P-B of FT:mat_peptide GQ377622_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377625_SHBs_P-B Product feature CHAIN GQ377625_SHBs_P-B of FT:mat_peptide GQ377625_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377629_SHBs_P-B Product feature CHAIN GQ377629_SHBs_P-B of FT:mat_peptide GQ377629_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377638_SHBs_P-B Product feature CHAIN GQ377638_SHBs_P-B of FT:mat_peptide GQ377638_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377639_SHBs_P-B Product feature CHAIN GQ377639_SHBs_P-B of FT:mat_peptide GQ377639_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377641_SHBs_P-B Product feature CHAIN GQ377641_SHBs_P-B of FT:mat_peptide GQ377641_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377643_SHBs_P-B Product feature CHAIN GQ377643_SHBs_P-B of FT:mat_peptide GQ377643_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ377644_SHBs_P-B Product feature CHAIN GQ377644_SHBs_P-B of FT:mat_peptide GQ377644_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWELASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWAYT
>gnl|hbvpro|GQ475340_SHBs_P-B Product feature CHAIN GQ475340_SHBs_P-B of FT:mat_peptide GQ475340_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486038_SHBs_P-B Product feature CHAIN GQ486038_SHBs_P-B of FT:mat_peptide GQ486038_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNLQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486050_SHBs_P-B Product feature CHAIN GQ486050_SHBs_P-B of FT:mat_peptide GQ486050_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGETPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWFWGPRLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486057_SHBs_P-B Product feature CHAIN GQ486057_SHBs_P-B of FT:mat_peptide GQ486057_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTAAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486083_SHBs_P-B Product feature CHAIN GQ486083_SHBs_P-B of FT:mat_peptide GQ486083_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS48). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486084_SHBs_P-B Product feature CHAIN GQ486084_SHBs_P-B of FT:mat_peptide GQ486084_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS49). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486089_SHBs_P-B Product feature CHAIN GQ486089_SHBs_P-B of FT:mat_peptide GQ486089_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS54). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ486106_SHBs_P-B Product feature CHAIN GQ486106_SHBs_P-B of FT:mat_peptide GQ486106_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS71). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFLCLWVYM
>gnl|hbvpro|GQ486123_SHBs_P-B Product feature CHAIN GQ486123_SHBs_P-B of FT:mat_peptide GQ486123_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS88). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486141_SHBs_P-B Product feature CHAIN GQ486141_SHBs_P-B of FT:mat_peptide GQ486141_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS106). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486155_SHBs_P-B Product feature CHAIN GQ486155_SHBs_P-B of FT:mat_peptide GQ486155_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS120). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYX
>gnl|hbvpro|GQ486159_SHBs_P-B Product feature CHAIN GQ486159_SHBs_P-B of FT:mat_peptide GQ486159_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS124). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLXGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGXXPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTXSTGPCRTCTTPAQGTSMXXSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWXWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486161_SHBs_P-B Product feature CHAIN GQ486161_SHBs_P-B of FT:mat_peptide GQ486161_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS126). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSXLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486190_SHBs_P-B Product feature CHAIN GQ486190_SHBs_P-B of FT:mat_peptide GQ486190_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS155). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXXXVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXXPGSSXTSTGPCRTCTTXXQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486196_SHBs_P-B Product feature CHAIN GQ486196_SHBs_P-B of FT:mat_peptide GQ486196_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS161). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHLPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486219_SHBs_P-B Product feature CHAIN GQ486219_SHBs_P-B of FT:mat_peptide GQ486219_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS184). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486222_SHBs_P-B Product feature CHAIN GQ486222_SHBs_P-B of FT:mat_peptide GQ486222_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS187). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXGQNSQSQISSHSPTCCPPXCPGYRWMCLRRX
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486227_SHBs_P-B Product feature CHAIN GQ486227_SHBs_P-B of FT:mat_peptide GQ486227_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS192). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486228_SHBs_P-B Product feature CHAIN GQ486228_SHBs_P-B of FT:mat_peptide GQ486228_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS193). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGEIPVCXGQNSQSQISSHSXTCCPPICPGYRWMCLRRX
IXFLXILLLCLIFLXVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486233_SHBs_P-B Product feature CHAIN GQ486233_SHBs_P-B of FT:mat_peptide GQ486233_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS198). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSXISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486234_SHBs_P-B Product feature CHAIN GQ486234_SHBs_P-B of FT:mat_peptide GQ486234_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS199). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTACLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWGSVRFSWLSLLVPFVQWSVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486242_SHBs_P-B Product feature CHAIN GQ486242_SHBs_P-B of FT:mat_peptide GQ486242_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS207). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENXASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXXPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFXK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNILXPFMPLLPIFLCLWVYI
>gnl|hbvpro|GQ486245_SHBs_P-B Product feature CHAIN GQ486245_SHBs_P-B of FT:mat_peptide GQ486245_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS210). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486277_SHBs_P-B Product feature CHAIN GQ486277_SHBs_P-B of FT:mat_peptide GQ486277_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS242). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHXPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486291_SHBs_P-B Product feature CHAIN GQ486291_SHBs_P-B of FT:mat_peptide GQ486291_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS256). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNXLGXXPXCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILXPFMPLXPIFXCLWVYI
>gnl|hbvpro|GQ486300_SHBs_P-B Product feature CHAIN GQ486300_SHBs_P-B of FT:mat_peptide GQ486300_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS265). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYX
>gnl|hbvpro|GQ486334_SHBs_P-B Product feature CHAIN GQ486334_SHBs_P-B of FT:mat_peptide GQ486334_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS299). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486353_SHBs_P-B Product feature CHAIN GQ486353_SHBs_P-B of FT:mat_peptide GQ486353_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS318). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFXGGTPVCLGQNSQSQISXHSPTCCPPXCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSXXPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYNXLSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ486359_SHBs_P-B Product feature CHAIN GQ486359_SHBs_P-B of FT:mat_peptide GQ486359_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS324). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486364_SHBs_P-B Product feature CHAIN GQ486364_SHBs_P-B of FT:mat_peptide GQ486364_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS329). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMXWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486366_SHBs_P-B Product feature CHAIN GQ486366_SHBs_P-B of FT:mat_peptide GQ486366_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS331). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLICLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486371_SHBs_P-B Product feature CHAIN GQ486371_SHBs_P-B of FT:mat_peptide GQ486371_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS336). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHXPTCCPXICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASXRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486373_SHBs_P-B Product feature CHAIN GQ486373_SHBs_P-B of FT:mat_peptide GQ486373_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS338). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQXVFFLLTKILTIPQSLDSWWTSLSFLGDKPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCHIFLLVLLDYKGMLPVCPLIPGSSTTSTGPCRTCTTPAQNGSQFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPXVQWFVGLSPTVWLSVIWMIWYWGPXLYNTLSRFMPLLPIFLCLWVYI
>gnl|hbvpro|GQ486377_SHBs_P-B Product feature CHAIN GQ486377_SHBs_P-B of FT:mat_peptide GQ486377_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS342). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|GQ486385_SHBs_P-B Product feature CHAIN GQ486385_SHBs_P-B of FT:mat_peptide GQ486385_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS350). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLXFLGETPVCXGQNSQSQISSHSPTCCPXICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNXLSPFMPLLPIFLCLWVYI
>gnl|hbvpro|GQ486387_SHBs_P-B Product feature CHAIN GQ486387_SHBs_P-B of FT:mat_peptide GQ486387_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS352). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486395_SHBs_P-B Product feature CHAIN GQ486395_SHBs_P-B of FT:mat_peptide GQ486395_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS360). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486397_SHBs_P-B Product feature CHAIN GQ486397_SHBs_P-B of FT:mat_peptide GQ486397_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS362). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486400_SHBs_P-B Product feature CHAIN GQ486400_SHBs_P-B of FT:mat_peptide GQ486400_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS365). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWFWGPSLYNTLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486432_SHBs_P-B Product feature CHAIN GQ486432_SHBs_P-B of FT:mat_peptide GQ486432_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS397). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLFPIFFCLWVYI
>gnl|hbvpro|GQ486436_SHBs_P-B Product feature CHAIN GQ486436_SHBs_P-B of FT:mat_peptide GQ486436_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS401). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFXGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486443_SHBs_P-B Product feature CHAIN GQ486443_SHBs_P-B of FT:mat_peptide GQ486443_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS408). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRXMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486444_SHBs_P-B Product feature CHAIN GQ486444_SHBs_P-B of FT:mat_peptide GQ486444_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS409). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRXCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486447_SHBs_P-B Product feature CHAIN GQ486447_SHBs_P-B of FT:mat_peptide GQ486447_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS412). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486448_SHBs_P-B Product feature CHAIN GQ486448_SHBs_P-B of FT:mat_peptide GQ486448_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS413). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPXCCPXICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQXTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486449_SHBs_P-B Product feature CHAIN GQ486449_SHBs_P-B of FT:mat_peptide GQ486449_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS414). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTXPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486452_SHBs_P-B Product feature CHAIN GQ486452_SHBs_P-B of FT:mat_peptide GQ486452_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS417). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486455_SHBs_P-B Product feature CHAIN GQ486455_SHBs_P-B of FT:mat_peptide GQ486455_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS420). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASXLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486459_SHBs_P-B Product feature CHAIN GQ486459_SHBs_P-B of FT:mat_peptide GQ486459_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS424). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMXPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWXYI
>gnl|hbvpro|GQ486464_SHBs_P-B Product feature CHAIN GQ486464_SHBs_P-B of FT:mat_peptide GQ486464_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS429). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486494_SHBs_P-B Product feature CHAIN GQ486494_SHBs_P-B of FT:mat_peptide GQ486494_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS459). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486500_SHBs_P-B Product feature CHAIN GQ486500_SHBs_P-B of FT:mat_peptide GQ486500_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS465). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHXPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFXSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486501_SHBs_P-B Product feature CHAIN GQ486501_SHBs_P-B of FT:mat_peptide GQ486501_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS466). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486508_SHBs_P-B Product feature CHAIN GQ486508_SHBs_P-B of FT:mat_peptide GQ486508_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS473). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPXLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486512_SHBs_P-B Product feature CHAIN GQ486512_SHBs_P-B of FT:mat_peptide GQ486512_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS477). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFXLWVYI
>gnl|hbvpro|GQ486522_SHBs_P-B Product feature CHAIN GQ486522_SHBs_P-B of FT:mat_peptide GQ486522_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS487). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLXVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486523_SHBs_P-B Product feature CHAIN GQ486523_SHBs_P-B of FT:mat_peptide GQ486523_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS488). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRXMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486540_SHBs_P-B Product feature CHAIN GQ486540_SHBs_P-B of FT:mat_peptide GQ486540_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS505). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486558_SHBs_P-B Product feature CHAIN GQ486558_SHBs_P-B of FT:mat_peptide GQ486558_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS523). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486559_SHBs_P-B Product feature CHAIN GQ486559_SHBs_P-B of FT:mat_peptide GQ486559_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS524). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486569_SHBs_P-B Product feature CHAIN GQ486569_SHBs_P-B of FT:mat_peptide GQ486569_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS534). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486573_SHBs_P-B Product feature CHAIN GQ486573_SHBs_P-B of FT:mat_peptide GQ486573_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS538). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486584_SHBs_P-B Product feature CHAIN GQ486584_SHBs_P-B of FT:mat_peptide GQ486584_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS549). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486588_SHBs_P-B Product feature CHAIN GQ486588_SHBs_P-B of FT:mat_peptide GQ486588_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS553). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLXGTPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486620_SHBs_P-B Product feature CHAIN GQ486620_SHBs_P-B of FT:mat_peptide GQ486620_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS585). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486628_SHBs_P-B Product feature CHAIN GQ486628_SHBs_P-B of FT:mat_peptide GQ486628_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS593). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLXPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486629_SHBs_P-B Product feature CHAIN GQ486629_SHBs_P-B of FT:mat_peptide GQ486629_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS594). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486630_SHBs_P-B Product feature CHAIN GQ486630_SHBs_P-B of FT:mat_peptide GQ486630_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS595). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486633_SHBs_P-B Product feature CHAIN GQ486633_SHBs_P-B of FT:mat_peptide GQ486633_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS598). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486636_SHBs_P-B Product feature CHAIN GQ486636_SHBs_P-B of FT:mat_peptide GQ486636_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS601). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKIXTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFXLWVYI
>gnl|hbvpro|GQ486640_SHBs_P-B Product feature CHAIN GQ486640_SHBs_P-B of FT:mat_peptide GQ486640_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS605). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFXLLTKTLTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFXLWVYI
>gnl|hbvpro|GQ486644_SHBs_P-B Product feature CHAIN GQ486644_SHBs_P-B of FT:mat_peptide GQ486644_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS609). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXGQNSQSQISSHSPTCCPPICPGYRXMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPXLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486645_SHBs_P-B Product feature CHAIN GQ486645_SHBs_P-B of FT:mat_peptide GQ486645_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS610). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486657_SHBs_P-B Product feature CHAIN GQ486657_SHBs_P-B of FT:mat_peptide GQ486657_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS622). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486666_SHBs_P-B Product feature CHAIN GQ486666_SHBs_P-B of FT:mat_peptide GQ486666_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS631). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGXCXTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486679_SHBs_P-B Product feature CHAIN GQ486679_SHBs_P-B of FT:mat_peptide GQ486679_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS644). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTXAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486689_SHBs_P-B Product feature CHAIN GQ486689_SHBs_P-B of FT:mat_peptide GQ486689_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS654). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGXLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486720_SHBs_P-B Product feature CHAIN GQ486720_SHBs_P-B of FT:mat_peptide GQ486720_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS685). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486733_SHBs_P-B Product feature CHAIN GQ486733_SHBs_P-B of FT:mat_peptide GQ486733_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS698). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486739_SHBs_P-B Product feature CHAIN GQ486739_SHBs_P-B of FT:mat_peptide GQ486739_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS704). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486749_SHBs_P-B Product feature CHAIN GQ486749_SHBs_P-B of FT:mat_peptide GQ486749_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS714). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IXFLCILLLCLIFLXVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVXXMXWYWGPRLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486752_SHBs_P-B Product feature CHAIN GQ486752_SHBs_P-B of FT:mat_peptide GQ486752_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS717). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486761_SHBs_P-B Product feature CHAIN GQ486761_SHBs_P-B of FT:mat_peptide GQ486761_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS726). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSXISXHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486784_SHBs_P-B Product feature CHAIN GQ486784_SHBs_P-B of FT:mat_peptide GQ486784_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS749). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLVDYQGMLPVCPLIPGSTTTSTGSCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486787_SHBs_P-B Product feature CHAIN GQ486787_SHBs_P-B of FT:mat_peptide GQ486787_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS752). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWXSVRFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486788_SHBs_P-B Product feature CHAIN GQ486788_SHBs_P-B of FT:mat_peptide GQ486788_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS753). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486789_SHBs_P-B Product feature CHAIN GQ486789_SHBs_P-B of FT:mat_peptide GQ486789_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS754). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMXLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTXSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486792_SHBs_P-B Product feature CHAIN GQ486792_SHBs_P-B of FT:mat_peptide GQ486792_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS757). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCHGQNSQSQISSHSPTCCPPICPGXRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVXXMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486795_SHBs_P-B Product feature CHAIN GQ486795_SHBs_P-B of FT:mat_peptide GQ486795_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS760). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGXRWMCLRRF
IXFLCILLLCLIFLLVLLDXQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWALVRFSXLSLLVPFVQWFVGLSPTVWLSVIXMMWFWGPSLXNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486796_SHBs_P-B Product feature CHAIN GQ486796_SHBs_P-B of FT:mat_peptide GQ486796_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS761). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCXKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLXIFFCLWVYI
>gnl|hbvpro|GQ486797_SHBs_P-B Product feature CHAIN GQ486797_SHBs_P-B of FT:mat_peptide GQ486797_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS762). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSXAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWXSVIXMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486799_SHBs_P-B Product feature CHAIN GQ486799_SHBs_P-B of FT:mat_peptide GQ486799_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS764). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIXQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486801_SHBs_P-B Product feature CHAIN GQ486801_SHBs_P-B of FT:mat_peptide GQ486801_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS766). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486802_SHBs_P-B Product feature CHAIN GQ486802_SHBs_P-B of FT:mat_peptide GQ486802_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS767). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNXQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486804_SHBs_P-B Product feature CHAIN GQ486804_SHBs_P-B of FT:mat_peptide GQ486804_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS769). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPACLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWSWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486805_SHBs_P-B Product feature CHAIN GQ486805_SHBs_P-B of FT:mat_peptide GQ486805_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS770). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSXISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSXXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|GQ486823_SHBs_P-B Product feature CHAIN GQ486823_SHBs_P-B of FT:mat_peptide GQ486823_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS788). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486824_SHBs_P-B Product feature CHAIN GQ486824_SHBs_P-B of FT:mat_peptide GQ486824_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS789). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSXWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486832_SHBs_P-B Product feature CHAIN GQ486832_SHBs_P-B of FT:mat_peptide GQ486832_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS797). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQXLDXWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPXCPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAXAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486833_SHBs_P-B Product feature CHAIN GQ486833_SHBs_P-B of FT:mat_peptide GQ486833_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS798). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486841_SHBs_P-B Product feature CHAIN GQ486841_SHBs_P-B of FT:mat_peptide GQ486841_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS806). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GQ486847_SHBs_P-B Product feature CHAIN GQ486847_SHBs_P-B of FT:mat_peptide GQ486847_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS812). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486850_SHBs_P-B Product feature CHAIN GQ486850_SHBs_P-B of FT:mat_peptide GQ486850_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS815). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTXVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486852_SHBs_P-B Product feature CHAIN GQ486852_SHBs_P-B of FT:mat_peptide GQ486852_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS817). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSSLVPFVQWFXGLSPTVWLSVIWMMWYWGPRLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486860_SHBs_P-B Product feature CHAIN GQ486860_SHBs_P-B of FT:mat_peptide GQ486860_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS825). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|GQ486862_SHBs_P-B Product feature CHAIN GQ486862_SHBs_P-B of FT:mat_peptide GQ486862_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS827). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLXGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486863_SHBs_P-B Product feature CHAIN GQ486863_SHBs_P-B of FT:mat_peptide GQ486863_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS828). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLGQNSQSQXSSHSXTCCPPICPGYRWMCLRRX
IIFLCILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPXLXNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ486864_SHBs_P-B Product feature CHAIN GQ486864_SHBs_P-B of FT:mat_peptide GQ486864_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS829). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486865_SHBs_P-B Product feature CHAIN GQ486865_SHBs_P-B of FT:mat_peptide GQ486865_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS830). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFXGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLXXFFCLWVYI
>gnl|hbvpro|GQ486870_SHBs_P-B Product feature CHAIN GQ486870_SHBs_P-B of FT:mat_peptide GQ486870_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS835). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEXPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ486873_SHBs_P-B Product feature CHAIN GQ486873_SHBs_P-B of FT:mat_peptide GQ486873_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GS838). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IXFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924603_SHBs_P-B Product feature CHAIN GQ924603_SHBs_P-B of FT:mat_peptide GQ924603_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924605_SHBs_P-B Product feature CHAIN GQ924605_SHBs_P-B of FT:mat_peptide GQ924605_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924606_SHBs_P-B Product feature CHAIN GQ924606_SHBs_P-B of FT:mat_peptide GQ924606_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924607_SHBs_P-B Product feature CHAIN GQ924607_SHBs_P-B of FT:mat_peptide GQ924607_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLIGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924608_SHBs_P-B Product feature CHAIN GQ924608_SHBs_P-B of FT:mat_peptide GQ924608_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924610_SHBs_P-B Product feature CHAIN GQ924610_SHBs_P-B of FT:mat_peptide GQ924610_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ924611_SHBs_P-B Product feature CHAIN GQ924611_SHBs_P-B of FT:mat_peptide GQ924611_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924617_SHBs_P-B Product feature CHAIN GQ924617_SHBs_P-B of FT:mat_peptide GQ924617_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ924621_SHBs_P-B Product feature CHAIN GQ924621_SHBs_P-B of FT:mat_peptide GQ924621_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVHWFGGLSPTVWLSLIWMIWFWGPSLYNILSPFIPLFPIFFCLWVYI
>gnl|hbvpro|GQ924624_SHBs_P-B Product feature CHAIN GQ924624_SHBs_P-B of FT:mat_peptide GQ924624_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924625_SHBs_P-B Product feature CHAIN GQ924625_SHBs_P-B of FT:mat_peptide GQ924625_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924626_SHBs_P-B Product feature CHAIN GQ924626_SHBs_P-B of FT:mat_peptide GQ924626_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924627_SHBs_P-B Product feature CHAIN GQ924627_SHBs_P-B of FT:mat_peptide GQ924627_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924628_SHBs_P-B Product feature CHAIN GQ924628_SHBs_P-B of FT:mat_peptide GQ924628_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924630_SHBs_P-B Product feature CHAIN GQ924630_SHBs_P-B of FT:mat_peptide GQ924630_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLKPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILNPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924631_SHBs_P-B Product feature CHAIN GQ924631_SHBs_P-B of FT:mat_peptide GQ924631_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924632_SHBs_P-B Product feature CHAIN GQ924632_SHBs_P-B of FT:mat_peptide GQ924632_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924634_SHBs_P-B Product feature CHAIN GQ924634_SHBs_P-B of FT:mat_peptide GQ924634_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924635_SHBs_P-B Product feature CHAIN GQ924635_SHBs_P-B of FT:mat_peptide GQ924635_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924637_SHBs_P-B Product feature CHAIN GQ924637_SHBs_P-B of FT:mat_peptide GQ924637_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924638_SHBs_P-B Product feature CHAIN GQ924638_SHBs_P-B of FT:mat_peptide GQ924638_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFFWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924639_SHBs_P-B Product feature CHAIN GQ924639_SHBs_P-B of FT:mat_peptide GQ924639_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFFWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924640_SHBs_P-B Product feature CHAIN GQ924640_SHBs_P-B of FT:mat_peptide GQ924640_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924641_SHBs_P-B Product feature CHAIN GQ924641_SHBs_P-B of FT:mat_peptide GQ924641_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M76). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQVGFSLLTKILTIPQSLDSWWTSLSFLGGTPACLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924644_SHBs_P-B Product feature CHAIN GQ924644_SHBs_P-B of FT:mat_peptide GQ924644_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M79). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924645_SHBs_P-B Product feature CHAIN GQ924645_SHBs_P-B of FT:mat_peptide GQ924645_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFREGTPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924646_SHBs_P-B Product feature CHAIN GQ924646_SHBs_P-B of FT:mat_peptide GQ924646_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924647_SHBs_P-B Product feature CHAIN GQ924647_SHBs_P-B of FT:mat_peptide GQ924647_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVVLDCQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWAYI
>gnl|hbvpro|GQ924648_SHBs_P-B Product feature CHAIN GQ924648_SHBs_P-B of FT:mat_peptide GQ924648_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924651_SHBs_P-B Product feature CHAIN GQ924651_SHBs_P-B of FT:mat_peptide GQ924651_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924653_SHBs_P-B Product feature CHAIN GQ924653_SHBs_P-B of FT:mat_peptide GQ924653_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924654_SHBs_P-B Product feature CHAIN GQ924654_SHBs_P-B of FT:mat_peptide GQ924654_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GQ924656_SHBs_P-B Product feature CHAIN GQ924656_SHBs_P-B of FT:mat_peptide GQ924656_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078792_SHBs_P-B Product feature CHAIN GU078792_SHBs_P-B of FT:mat_peptide GU078792_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J64). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU078801_SHBs_P-B Product feature CHAIN GU078801_SHBs_P-B of FT:mat_peptide GU078801_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078805_SHBs_P-B Product feature CHAIN GU078805_SHBs_P-B of FT:mat_peptide GU078805_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J287). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFYLWVYI
>gnl|hbvpro|GU078806_SHBs_P-B Product feature CHAIN GU078806_SHBs_P-B of FT:mat_peptide GU078806_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J286). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAXGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078808_SHBs_P-B Product feature CHAIN GU078808_SHBs_P-B of FT:mat_peptide GU078808_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J283). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078821_SHBs_P-B Product feature CHAIN GU078821_SHBs_P-B of FT:mat_peptide GU078821_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J233). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU078828_SHBs_P-B Product feature CHAIN GU078828_SHBs_P-B of FT:mat_peptide GU078828_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J215). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078838_SHBs_P-B Product feature CHAIN GU078838_SHBs_P-B of FT:mat_peptide GU078838_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J201). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078845_SHBs_P-B Product feature CHAIN GU078845_SHBs_P-B of FT:mat_peptide GU078845_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078847_SHBs_P-B Product feature CHAIN GU078847_SHBs_P-B of FT:mat_peptide GU078847_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J167). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|GU078849_SHBs_P-B Product feature CHAIN GU078849_SHBs_P-B of FT:mat_peptide GU078849_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078851_SHBs_P-B Product feature CHAIN GU078851_SHBs_P-B of FT:mat_peptide GU078851_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J146). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078853_SHBs_P-B Product feature CHAIN GU078853_SHBs_P-B of FT:mat_peptide GU078853_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J142). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078854_SHBs_P-B Product feature CHAIN GU078854_SHBs_P-B of FT:mat_peptide GU078854_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU078862_SHBs_P-B Product feature CHAIN GU078862_SHBs_P-B of FT:mat_peptide GU078862_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J104). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079201_SHBs_P-B Product feature CHAIN GU079201_SHBs_P-B of FT:mat_peptide GU079201_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S126). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACPGQNSQSPISNHSPTCCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079202_SHBs_P-B Product feature CHAIN GU079202_SHBs_P-B of FT:mat_peptide GU079202_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S127). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079210_SHBs_P-B Product feature CHAIN GU079210_SHBs_P-B of FT:mat_peptide GU079210_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1435). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079221_SHBs_P-B Product feature CHAIN GU079221_SHBs_P-B of FT:mat_peptide GU079221_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S158). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079222_SHBs_P-B Product feature CHAIN GU079222_SHBs_P-B of FT:mat_peptide GU079222_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1583). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079227_SHBs_P-B Product feature CHAIN GU079227_SHBs_P-B of FT:mat_peptide GU079227_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S170). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079251_SHBs_P-B Product feature CHAIN GU079251_SHBs_P-B of FT:mat_peptide GU079251_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S223). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLGQNSQSPISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079268_SHBs_P-B Product feature CHAIN GU079268_SHBs_P-B of FT:mat_peptide GU079268_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MDNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079272_SHBs_P-B Product feature CHAIN GU079272_SHBs_P-B of FT:mat_peptide GU079272_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S2674). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|GU079278_SHBs_P-B Product feature CHAIN GU079278_SHBs_P-B of FT:mat_peptide GU079278_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S277). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079284_SHBs_P-B Product feature CHAIN GU079284_SHBs_P-B of FT:mat_peptide GU079284_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S288). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079298_SHBs_P-B Product feature CHAIN GU079298_SHBs_P-B of FT:mat_peptide GU079298_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S322). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYKGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079300_SHBs_P-B Product feature CHAIN GU079300_SHBs_P-B of FT:mat_peptide GU079300_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3236). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079320_SHBs_P-B Product feature CHAIN GU079320_SHBs_P-B of FT:mat_peptide GU079320_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S354). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079321_SHBs_P-B Product feature CHAIN GU079321_SHBs_P-B of FT:mat_peptide GU079321_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S355). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079325_SHBs_P-B Product feature CHAIN GU079325_SHBs_P-B of FT:mat_peptide GU079325_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S361). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079327_SHBs_P-B Product feature CHAIN GU079327_SHBs_P-B of FT:mat_peptide GU079327_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S365). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079328_SHBs_P-B Product feature CHAIN GU079328_SHBs_P-B of FT:mat_peptide GU079328_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S366). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079329_SHBs_P-B Product feature CHAIN GU079329_SHBs_P-B of FT:mat_peptide GU079329_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S37). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079340_SHBs_P-B Product feature CHAIN GU079340_SHBs_P-B of FT:mat_peptide GU079340_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S3812). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079350_SHBs_P-B Product feature CHAIN GU079350_SHBs_P-B of FT:mat_peptide GU079350_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S393). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWVWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079352_SHBs_P-B Product feature CHAIN GU079352_SHBs_P-B of FT:mat_peptide GU079352_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S396). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079358_SHBs_P-B Product feature CHAIN GU079358_SHBs_P-B of FT:mat_peptide GU079358_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFLCLWVYI
>gnl|hbvpro|GU079361_SHBs_P-B Product feature CHAIN GU079361_SHBs_P-B of FT:mat_peptide GU079361_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S413). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFMPLLPLFFCLWVYI
>gnl|hbvpro|GU079370_SHBs_P-B Product feature CHAIN GU079370_SHBs_P-B of FT:mat_peptide GU079370_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S43). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQCMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079372_SHBs_P-B Product feature CHAIN GU079372_SHBs_P-B of FT:mat_peptide GU079372_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S433). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPRLYTILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079382_SHBs_P-B Product feature CHAIN GU079382_SHBs_P-B of FT:mat_peptide GU079382_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S449). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079385_SHBs_P-B Product feature CHAIN GU079385_SHBs_P-B of FT:mat_peptide GU079385_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S451). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079397_SHBs_P-B Product feature CHAIN GU079397_SHBs_P-B of FT:mat_peptide GU079397_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S477). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MDNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079401_SHBs_P-B Product feature CHAIN GU079401_SHBs_P-B of FT:mat_peptide GU079401_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S486). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079403_SHBs_P-B Product feature CHAIN GU079403_SHBs_P-B of FT:mat_peptide GU079403_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S490). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMLMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079415_SHBs_P-B Product feature CHAIN GU079415_SHBs_P-B of FT:mat_peptide GU079415_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S504). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079428_SHBs_P-B Product feature CHAIN GU079428_SHBs_P-B of FT:mat_peptide GU079428_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S526). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079444_SHBs_P-B Product feature CHAIN GU079444_SHBs_P-B of FT:mat_peptide GU079444_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S553). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079445_SHBs_P-B Product feature CHAIN GU079445_SHBs_P-B of FT:mat_peptide GU079445_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S555). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079448_SHBs_P-B Product feature CHAIN GU079448_SHBs_P-B of FT:mat_peptide GU079448_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S560). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079449_SHBs_P-B Product feature CHAIN GU079449_SHBs_P-B of FT:mat_peptide GU079449_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S562). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079457_SHBs_P-B Product feature CHAIN GU079457_SHBs_P-B of FT:mat_peptide GU079457_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S575). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079463_SHBs_P-B Product feature CHAIN GU079463_SHBs_P-B of FT:mat_peptide GU079463_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S593). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU079489_SHBs_P-B Product feature CHAIN GU079489_SHBs_P-B of FT:mat_peptide GU079489_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S93). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU079491_SHBs_P-B Product feature CHAIN GU079491_SHBs_P-B of FT:mat_peptide GU079491_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S95). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQVMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU145102_SHBs_P-B Product feature CHAIN GU145102_SHBs_P-B of FT:mat_peptide GU145102_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 06A5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU332695_SHBs_P-B Product feature CHAIN GU332695_SHBs_P-B of FT:mat_peptide GU332695_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMD74). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU357842_SHBs_P-B Product feature CHAIN GU357842_SHBs_P-B of FT:mat_peptide GU357842_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSTFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFCCLWVYS
>gnl|hbvpro|GU358470_SHBs_P-B Product feature CHAIN GU358470_SHBs_P-B of FT:mat_peptide GU358470_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 06A26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTSCPPICPGYRWMCLRRF
IIFLCTLLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCKTCTSPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU358471_SHBs_P-B Product feature CHAIN GU358471_SHBs_P-B of FT:mat_peptide GU358471_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 06A26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTSCPPICPGYRWMCLRRF
IIFLCTLLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU358472_SHBs_P-B Product feature CHAIN GU358472_SHBs_P-B of FT:mat_peptide GU358472_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 06A26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAKGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYNILRPFMPLLPIFFGLWVYM
>gnl|hbvpro|GU358473_SHBs_P-B Product feature CHAIN GU358473_SHBs_P-B of FT:mat_peptide GU358473_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 06A26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFMPLLPIFFGLWVYM
>gnl|hbvpro|GU434372_SHBs_P-B Product feature CHAIN GU434372_SHBs_P-B of FT:mat_peptide GU434372_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNIWSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU434373_SHBs_P-B Product feature CHAIN GU434373_SHBs_P-B of FT:mat_peptide GU434373_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU451682_SHBs_P-B Product feature CHAIN GU451682_SHBs_P-B of FT:mat_peptide GU451682_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815548_SHBs_P-B Product feature CHAIN GU815548_SHBs_P-B of FT:mat_peptide GU815548_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815549_SHBs_P-B Product feature CHAIN GU815549_SHBs_P-B of FT:mat_peptide GU815549_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLPVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815550_SHBs_P-B Product feature CHAIN GU815550_SHBs_P-B of FT:mat_peptide GU815550_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815551_SHBs_P-B Product feature CHAIN GU815551_SHBs_P-B of FT:mat_peptide GU815551_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815552_SHBs_P-B Product feature CHAIN GU815552_SHBs_P-B of FT:mat_peptide GU815552_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815553_SHBs_P-B Product feature CHAIN GU815553_SHBs_P-B of FT:mat_peptide GU815553_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815554_SHBs_P-B Product feature CHAIN GU815554_SHBs_P-B of FT:mat_peptide GU815554_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVRPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815555_SHBs_P-B Product feature CHAIN GU815555_SHBs_P-B of FT:mat_peptide GU815555_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815556_SHBs_P-B Product feature CHAIN GU815556_SHBs_P-B of FT:mat_peptide GU815556_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815557_SHBs_P-B Product feature CHAIN GU815557_SHBs_P-B of FT:mat_peptide GU815557_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815558_SHBs_P-B Product feature CHAIN GU815558_SHBs_P-B of FT:mat_peptide GU815558_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815559_SHBs_P-B Product feature CHAIN GU815559_SHBs_P-B of FT:mat_peptide GU815559_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815560_SHBs_P-B Product feature CHAIN GU815560_SHBs_P-B of FT:mat_peptide GU815560_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815561_SHBs_P-B Product feature CHAIN GU815561_SHBs_P-B of FT:mat_peptide GU815561_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815562_SHBs_P-B Product feature CHAIN GU815562_SHBs_P-B of FT:mat_peptide GU815562_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815563_SHBs_P-B Product feature CHAIN GU815563_SHBs_P-B of FT:mat_peptide GU815563_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815564_SHBs_P-B Product feature CHAIN GU815564_SHBs_P-B of FT:mat_peptide GU815564_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815565_SHBs_P-B Product feature CHAIN GU815565_SHBs_P-B of FT:mat_peptide GU815565_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815566_SHBs_P-B Product feature CHAIN GU815566_SHBs_P-B of FT:mat_peptide GU815566_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815567_SHBs_P-B Product feature CHAIN GU815567_SHBs_P-B of FT:mat_peptide GU815567_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815568_SHBs_P-B Product feature CHAIN GU815568_SHBs_P-B of FT:mat_peptide GU815568_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815569_SHBs_P-B Product feature CHAIN GU815569_SHBs_P-B of FT:mat_peptide GU815569_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815570_SHBs_P-B Product feature CHAIN GU815570_SHBs_P-B of FT:mat_peptide GU815570_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815571_SHBs_P-B Product feature CHAIN GU815571_SHBs_P-B of FT:mat_peptide GU815571_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815572_SHBs_P-B Product feature CHAIN GU815572_SHBs_P-B of FT:mat_peptide GU815572_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815574_SHBs_P-B Product feature CHAIN GU815574_SHBs_P-B of FT:mat_peptide GU815574_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815575_SHBs_P-B Product feature CHAIN GU815575_SHBs_P-B of FT:mat_peptide GU815575_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815576_SHBs_P-B Product feature CHAIN GU815576_SHBs_P-B of FT:mat_peptide GU815576_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815577_SHBs_P-B Product feature CHAIN GU815577_SHBs_P-B of FT:mat_peptide GU815577_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815578_SHBs_P-B Product feature CHAIN GU815578_SHBs_P-B of FT:mat_peptide GU815578_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815579_SHBs_P-B Product feature CHAIN GU815579_SHBs_P-B of FT:mat_peptide GU815579_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815581_SHBs_P-B Product feature CHAIN GU815581_SHBs_P-B of FT:mat_peptide GU815581_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815583_SHBs_P-B Product feature CHAIN GU815583_SHBs_P-B of FT:mat_peptide GU815583_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815584_SHBs_P-B Product feature CHAIN GU815584_SHBs_P-B of FT:mat_peptide GU815584_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|GU815585_SHBs_P-B Product feature CHAIN GU815585_SHBs_P-B of FT:mat_peptide GU815585_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815586_SHBs_P-B Product feature CHAIN GU815586_SHBs_P-B of FT:mat_peptide GU815586_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815587_SHBs_P-B Product feature CHAIN GU815587_SHBs_P-B of FT:mat_peptide GU815587_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815588_SHBs_P-B Product feature CHAIN GU815588_SHBs_P-B of FT:mat_peptide GU815588_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815589_SHBs_P-B Product feature CHAIN GU815589_SHBs_P-B of FT:mat_peptide GU815589_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815590_SHBs_P-B Product feature CHAIN GU815590_SHBs_P-B of FT:mat_peptide GU815590_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815591_SHBs_P-B Product feature CHAIN GU815591_SHBs_P-B of FT:mat_peptide GU815591_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815593_SHBs_P-B Product feature CHAIN GU815593_SHBs_P-B of FT:mat_peptide GU815593_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815594_SHBs_P-B Product feature CHAIN GU815594_SHBs_P-B of FT:mat_peptide GU815594_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815595_SHBs_P-B Product feature CHAIN GU815595_SHBs_P-B of FT:mat_peptide GU815595_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815596_SHBs_P-B Product feature CHAIN GU815596_SHBs_P-B of FT:mat_peptide GU815596_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815597_SHBs_P-B Product feature CHAIN GU815597_SHBs_P-B of FT:mat_peptide GU815597_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815598_SHBs_P-B Product feature CHAIN GU815598_SHBs_P-B of FT:mat_peptide GU815598_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815599_SHBs_P-B Product feature CHAIN GU815599_SHBs_P-B of FT:mat_peptide GU815599_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815600_SHBs_P-B Product feature CHAIN GU815600_SHBs_P-B of FT:mat_peptide GU815600_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815601_SHBs_P-B Product feature CHAIN GU815601_SHBs_P-B of FT:mat_peptide GU815601_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815602_SHBs_P-B Product feature CHAIN GU815602_SHBs_P-B of FT:mat_peptide GU815602_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815603_SHBs_P-B Product feature CHAIN GU815603_SHBs_P-B of FT:mat_peptide GU815603_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815604_SHBs_P-B Product feature CHAIN GU815604_SHBs_P-B of FT:mat_peptide GU815604_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815605_SHBs_P-B Product feature CHAIN GU815605_SHBs_P-B of FT:mat_peptide GU815605_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815606_SHBs_P-B Product feature CHAIN GU815606_SHBs_P-B of FT:mat_peptide GU815606_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815607_SHBs_P-B Product feature CHAIN GU815607_SHBs_P-B of FT:mat_peptide GU815607_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
HLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815608_SHBs_P-B Product feature CHAIN GU815608_SHBs_P-B of FT:mat_peptide GU815608_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQVGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815609_SHBs_P-B Product feature CHAIN GU815609_SHBs_P-B of FT:mat_peptide GU815609_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815610_SHBs_P-B Product feature CHAIN GU815610_SHBs_P-B of FT:mat_peptide GU815610_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815612_SHBs_P-B Product feature CHAIN GU815612_SHBs_P-B of FT:mat_peptide GU815612_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815613_SHBs_P-B Product feature CHAIN GU815613_SHBs_P-B of FT:mat_peptide GU815613_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815614_SHBs_P-B Product feature CHAIN GU815614_SHBs_P-B of FT:mat_peptide GU815614_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815616_SHBs_P-B Product feature CHAIN GU815616_SHBs_P-B of FT:mat_peptide GU815616_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815617_SHBs_P-B Product feature CHAIN GU815617_SHBs_P-B of FT:mat_peptide GU815617_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSPYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815618_SHBs_P-B Product feature CHAIN GU815618_SHBs_P-B of FT:mat_peptide GU815618_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPMCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815619_SHBs_P-B Product feature CHAIN GU815619_SHBs_P-B of FT:mat_peptide GU815619_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815620_SHBs_P-B Product feature CHAIN GU815620_SHBs_P-B of FT:mat_peptide GU815620_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815621_SHBs_P-B Product feature CHAIN GU815621_SHBs_P-B of FT:mat_peptide GU815621_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815622_SHBs_P-B Product feature CHAIN GU815622_SHBs_P-B of FT:mat_peptide GU815622_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSPYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815623_SHBs_P-B Product feature CHAIN GU815623_SHBs_P-B of FT:mat_peptide GU815623_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815624_SHBs_P-B Product feature CHAIN GU815624_SHBs_P-B of FT:mat_peptide GU815624_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815625_SHBs_P-B Product feature CHAIN GU815625_SHBs_P-B of FT:mat_peptide GU815625_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVSFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815626_SHBs_P-B Product feature CHAIN GU815626_SHBs_P-B of FT:mat_peptide GU815626_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815627_SHBs_P-B Product feature CHAIN GU815627_SHBs_P-B of FT:mat_peptide GU815627_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815628_SHBs_P-B Product feature CHAIN GU815628_SHBs_P-B of FT:mat_peptide GU815628_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815629_SHBs_P-B Product feature CHAIN GU815629_SHBs_P-B of FT:mat_peptide GU815629_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815630_SHBs_P-B Product feature CHAIN GU815630_SHBs_P-B of FT:mat_peptide GU815630_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815631_SHBs_P-B Product feature CHAIN GU815631_SHBs_P-B of FT:mat_peptide GU815631_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815632_SHBs_P-B Product feature CHAIN GU815632_SHBs_P-B of FT:mat_peptide GU815632_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815633_SHBs_P-B Product feature CHAIN GU815633_SHBs_P-B of FT:mat_peptide GU815633_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPCMPLLPIFFCLWVYI
>gnl|hbvpro|GU815635_SHBs_P-B Product feature CHAIN GU815635_SHBs_P-B of FT:mat_peptide GU815635_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815636_SHBs_P-B Product feature CHAIN GU815636_SHBs_P-B of FT:mat_peptide GU815636_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815637_SHBs_P-B Product feature CHAIN GU815637_SHBs_P-B of FT:mat_peptide GU815637_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815638_SHBs_P-B Product feature CHAIN GU815638_SHBs_P-B of FT:mat_peptide GU815638_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815639_SHBs_P-B Product feature CHAIN GU815639_SHBs_P-B of FT:mat_peptide GU815639_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLEPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815640_SHBs_P-B Product feature CHAIN GU815640_SHBs_P-B of FT:mat_peptide GU815640_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815641_SHBs_P-B Product feature CHAIN GU815641_SHBs_P-B of FT:mat_peptide GU815641_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815642_SHBs_P-B Product feature CHAIN GU815642_SHBs_P-B of FT:mat_peptide GU815642_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815643_SHBs_P-B Product feature CHAIN GU815643_SHBs_P-B of FT:mat_peptide GU815643_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815644_SHBs_P-B Product feature CHAIN GU815644_SHBs_P-B of FT:mat_peptide GU815644_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDCHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815645_SHBs_P-B Product feature CHAIN GU815645_SHBs_P-B of FT:mat_peptide GU815645_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPARGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815646_SHBs_P-B Product feature CHAIN GU815646_SHBs_P-B of FT:mat_peptide GU815646_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815647_SHBs_P-B Product feature CHAIN GU815647_SHBs_P-B of FT:mat_peptide GU815647_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815648_SHBs_P-B Product feature CHAIN GU815648_SHBs_P-B of FT:mat_peptide GU815648_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815649_SHBs_P-B Product feature CHAIN GU815649_SHBs_P-B of FT:mat_peptide GU815649_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815650_SHBs_P-B Product feature CHAIN GU815650_SHBs_P-B of FT:mat_peptide GU815650_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815651_SHBs_P-B Product feature CHAIN GU815651_SHBs_P-B of FT:mat_peptide GU815651_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGSFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815652_SHBs_P-B Product feature CHAIN GU815652_SHBs_P-B of FT:mat_peptide GU815652_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815653_SHBs_P-B Product feature CHAIN GU815653_SHBs_P-B of FT:mat_peptide GU815653_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815654_SHBs_P-B Product feature CHAIN GU815654_SHBs_P-B of FT:mat_peptide GU815654_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815656_SHBs_P-B Product feature CHAIN GU815656_SHBs_P-B of FT:mat_peptide GU815656_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQRFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815657_SHBs_P-B Product feature CHAIN GU815657_SHBs_P-B of FT:mat_peptide GU815657_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IILLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGPSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815658_SHBs_P-B Product feature CHAIN GU815658_SHBs_P-B of FT:mat_peptide GU815658_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFPWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815659_SHBs_P-B Product feature CHAIN GU815659_SHBs_P-B of FT:mat_peptide GU815659_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815660_SHBs_P-B Product feature CHAIN GU815660_SHBs_P-B of FT:mat_peptide GU815660_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815661_SHBs_P-B Product feature CHAIN GU815661_SHBs_P-B of FT:mat_peptide GU815661_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815662_SHBs_P-B Product feature CHAIN GU815662_SHBs_P-B of FT:mat_peptide GU815662_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815663_SHBs_P-B Product feature CHAIN GU815663_SHBs_P-B of FT:mat_peptide GU815663_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815664_SHBs_P-B Product feature CHAIN GU815664_SHBs_P-B of FT:mat_peptide GU815664_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815665_SHBs_P-B Product feature CHAIN GU815665_SHBs_P-B of FT:mat_peptide GU815665_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815666_SHBs_P-B Product feature CHAIN GU815666_SHBs_P-B of FT:mat_peptide GU815666_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815667_SHBs_P-B Product feature CHAIN GU815667_SHBs_P-B of FT:mat_peptide GU815667_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815668_SHBs_P-B Product feature CHAIN GU815668_SHBs_P-B of FT:mat_peptide GU815668_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815669_SHBs_P-B Product feature CHAIN GU815669_SHBs_P-B of FT:mat_peptide GU815669_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815670_SHBs_P-B Product feature CHAIN GU815670_SHBs_P-B of FT:mat_peptide GU815670_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLILLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815672_SHBs_P-B Product feature CHAIN GU815672_SHBs_P-B of FT:mat_peptide GU815672_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815673_SHBs_P-B Product feature CHAIN GU815673_SHBs_P-B of FT:mat_peptide GU815673_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815674_SHBs_P-B Product feature CHAIN GU815674_SHBs_P-B of FT:mat_peptide GU815674_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815675_SHBs_P-B Product feature CHAIN GU815675_SHBs_P-B of FT:mat_peptide GU815675_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815676_SHBs_P-B Product feature CHAIN GU815676_SHBs_P-B of FT:mat_peptide GU815676_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815677_SHBs_P-B Product feature CHAIN GU815677_SHBs_P-B of FT:mat_peptide GU815677_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815678_SHBs_P-B Product feature CHAIN GU815678_SHBs_P-B of FT:mat_peptide GU815678_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWPSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815679_SHBs_P-B Product feature CHAIN GU815679_SHBs_P-B of FT:mat_peptide GU815679_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815680_SHBs_P-B Product feature CHAIN GU815680_SHBs_P-B of FT:mat_peptide GU815680_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815681_SHBs_P-B Product feature CHAIN GU815681_SHBs_P-B of FT:mat_peptide GU815681_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYT
>gnl|hbvpro|GU815683_SHBs_P-B Product feature CHAIN GU815683_SHBs_P-B of FT:mat_peptide GU815683_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815684_SHBs_P-B Product feature CHAIN GU815684_SHBs_P-B of FT:mat_peptide GU815684_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815685_SHBs_P-B Product feature CHAIN GU815685_SHBs_P-B of FT:mat_peptide GU815685_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815686_SHBs_P-B Product feature CHAIN GU815686_SHBs_P-B of FT:mat_peptide GU815686_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815687_SHBs_P-B Product feature CHAIN GU815687_SHBs_P-B of FT:mat_peptide GU815687_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815688_SHBs_P-B Product feature CHAIN GU815688_SHBs_P-B of FT:mat_peptide GU815688_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815689_SHBs_P-B Product feature CHAIN GU815689_SHBs_P-B of FT:mat_peptide GU815689_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815691_SHBs_P-B Product feature CHAIN GU815691_SHBs_P-B of FT:mat_peptide GU815691_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815692_SHBs_P-B Product feature CHAIN GU815692_SHBs_P-B of FT:mat_peptide GU815692_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815693_SHBs_P-B Product feature CHAIN GU815693_SHBs_P-B of FT:mat_peptide GU815693_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815694_SHBs_P-B Product feature CHAIN GU815694_SHBs_P-B of FT:mat_peptide GU815694_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815695_SHBs_P-B Product feature CHAIN GU815695_SHBs_P-B of FT:mat_peptide GU815695_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815696_SHBs_P-B Product feature CHAIN GU815696_SHBs_P-B of FT:mat_peptide GU815696_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815697_SHBs_P-B Product feature CHAIN GU815697_SHBs_P-B of FT:mat_peptide GU815697_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815698_SHBs_P-B Product feature CHAIN GU815698_SHBs_P-B of FT:mat_peptide GU815698_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815699_SHBs_P-B Product feature CHAIN GU815699_SHBs_P-B of FT:mat_peptide GU815699_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815700_SHBs_P-B Product feature CHAIN GU815700_SHBs_P-B of FT:mat_peptide GU815700_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815701_SHBs_P-B Product feature CHAIN GU815701_SHBs_P-B of FT:mat_peptide GU815701_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815702_SHBs_P-B Product feature CHAIN GU815702_SHBs_P-B of FT:mat_peptide GU815702_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815703_SHBs_P-B Product feature CHAIN GU815703_SHBs_P-B of FT:mat_peptide GU815703_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815704_SHBs_P-B Product feature CHAIN GU815704_SHBs_P-B of FT:mat_peptide GU815704_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815705_SHBs_P-B Product feature CHAIN GU815705_SHBs_P-B of FT:mat_peptide GU815705_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815706_SHBs_P-B Product feature CHAIN GU815706_SHBs_P-B of FT:mat_peptide GU815706_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815707_SHBs_P-B Product feature CHAIN GU815707_SHBs_P-B of FT:mat_peptide GU815707_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815708_SHBs_P-B Product feature CHAIN GU815708_SHBs_P-B of FT:mat_peptide GU815708_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815709_SHBs_P-B Product feature CHAIN GU815709_SHBs_P-B of FT:mat_peptide GU815709_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815710_SHBs_P-B Product feature CHAIN GU815710_SHBs_P-B of FT:mat_peptide GU815710_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
TIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFYLWVSI
>gnl|hbvpro|GU815711_SHBs_P-B Product feature CHAIN GU815711_SHBs_P-B of FT:mat_peptide GU815711_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMSLLPIFFCLWVYI
>gnl|hbvpro|GU815712_SHBs_P-B Product feature CHAIN GU815712_SHBs_P-B of FT:mat_peptide GU815712_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815713_SHBs_P-B Product feature CHAIN GU815713_SHBs_P-B of FT:mat_peptide GU815713_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVLFVQWFVGLSPTVRLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815715_SHBs_P-B Product feature CHAIN GU815715_SHBs_P-B of FT:mat_peptide GU815715_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815716_SHBs_P-B Product feature CHAIN GU815716_SHBs_P-B of FT:mat_peptide GU815716_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815717_SHBs_P-B Product feature CHAIN GU815717_SHBs_P-B of FT:mat_peptide GU815717_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815718_SHBs_P-B Product feature CHAIN GU815718_SHBs_P-B of FT:mat_peptide GU815718_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGPSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815719_SHBs_P-B Product feature CHAIN GU815719_SHBs_P-B of FT:mat_peptide GU815719_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815720_SHBs_P-B Product feature CHAIN GU815720_SHBs_P-B of FT:mat_peptide GU815720_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815721_SHBs_P-B Product feature CHAIN GU815721_SHBs_P-B of FT:mat_peptide GU815721_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815722_SHBs_P-B Product feature CHAIN GU815722_SHBs_P-B of FT:mat_peptide GU815722_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWLVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815723_SHBs_P-B Product feature CHAIN GU815723_SHBs_P-B of FT:mat_peptide GU815723_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPESSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815724_SHBs_P-B Product feature CHAIN GU815724_SHBs_P-B of FT:mat_peptide GU815724_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815725_SHBs_P-B Product feature CHAIN GU815725_SHBs_P-B of FT:mat_peptide GU815725_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815726_SHBs_P-B Product feature CHAIN GU815726_SHBs_P-B of FT:mat_peptide GU815726_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815727_SHBs_P-B Product feature CHAIN GU815727_SHBs_P-B of FT:mat_peptide GU815727_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815728_SHBs_P-B Product feature CHAIN GU815728_SHBs_P-B of FT:mat_peptide GU815728_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815729_SHBs_P-B Product feature CHAIN GU815729_SHBs_P-B of FT:mat_peptide GU815729_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815730_SHBs_P-B Product feature CHAIN GU815730_SHBs_P-B of FT:mat_peptide GU815730_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815731_SHBs_P-B Product feature CHAIN GU815731_SHBs_P-B of FT:mat_peptide GU815731_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815732_SHBs_P-B Product feature CHAIN GU815732_SHBs_P-B of FT:mat_peptide GU815732_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815733_SHBs_P-B Product feature CHAIN GU815733_SHBs_P-B of FT:mat_peptide GU815733_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815734_SHBs_P-B Product feature CHAIN GU815734_SHBs_P-B of FT:mat_peptide GU815734_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815735_SHBs_P-B Product feature CHAIN GU815735_SHBs_P-B of FT:mat_peptide GU815735_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSSFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815736_SHBs_P-B Product feature CHAIN GU815736_SHBs_P-B of FT:mat_peptide GU815736_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815737_SHBs_P-B Product feature CHAIN GU815737_SHBs_P-B of FT:mat_peptide GU815737_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815738_SHBs_P-B Product feature CHAIN GU815738_SHBs_P-B of FT:mat_peptide GU815738_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815739_SHBs_P-B Product feature CHAIN GU815739_SHBs_P-B of FT:mat_peptide GU815739_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815740_SHBs_P-B Product feature CHAIN GU815740_SHBs_P-B of FT:mat_peptide GU815740_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815742_SHBs_P-B Product feature CHAIN GU815742_SHBs_P-B of FT:mat_peptide GU815742_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815743_SHBs_P-B Product feature CHAIN GU815743_SHBs_P-B of FT:mat_peptide GU815743_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815744_SHBs_P-B Product feature CHAIN GU815744_SHBs_P-B of FT:mat_peptide GU815744_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815745_SHBs_P-B Product feature CHAIN GU815745_SHBs_P-B of FT:mat_peptide GU815745_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815746_SHBs_P-B Product feature CHAIN GU815746_SHBs_P-B of FT:mat_peptide GU815746_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815747_SHBs_P-B Product feature CHAIN GU815747_SHBs_P-B of FT:mat_peptide GU815747_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815748_SHBs_P-B Product feature CHAIN GU815748_SHBs_P-B of FT:mat_peptide GU815748_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815749_SHBs_P-B Product feature CHAIN GU815749_SHBs_P-B of FT:mat_peptide GU815749_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815750_SHBs_P-B Product feature CHAIN GU815750_SHBs_P-B of FT:mat_peptide GU815750_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815751_SHBs_P-B Product feature CHAIN GU815751_SHBs_P-B of FT:mat_peptide GU815751_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815752_SHBs_P-B Product feature CHAIN GU815752_SHBs_P-B of FT:mat_peptide GU815752_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSVFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815753_SHBs_P-B Product feature CHAIN GU815753_SHBs_P-B of FT:mat_peptide GU815753_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815754_SHBs_P-B Product feature CHAIN GU815754_SHBs_P-B of FT:mat_peptide GU815754_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815755_SHBs_P-B Product feature CHAIN GU815755_SHBs_P-B of FT:mat_peptide GU815755_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815756_SHBs_P-B Product feature CHAIN GU815756_SHBs_P-B of FT:mat_peptide GU815756_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815757_SHBs_P-B Product feature CHAIN GU815757_SHBs_P-B of FT:mat_peptide GU815757_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815759_SHBs_P-B Product feature CHAIN GU815759_SHBs_P-B of FT:mat_peptide GU815759_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815760_SHBs_P-B Product feature CHAIN GU815760_SHBs_P-B of FT:mat_peptide GU815760_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815761_SHBs_P-B Product feature CHAIN GU815761_SHBs_P-B of FT:mat_peptide GU815761_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815762_SHBs_P-B Product feature CHAIN GU815762_SHBs_P-B of FT:mat_peptide GU815762_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815764_SHBs_P-B Product feature CHAIN GU815764_SHBs_P-B of FT:mat_peptide GU815764_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU815765_SHBs_P-B Product feature CHAIN GU815765_SHBs_P-B of FT:mat_peptide GU815765_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815766_SHBs_P-B Product feature CHAIN GU815766_SHBs_P-B of FT:mat_peptide GU815766_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815767_SHBs_P-B Product feature CHAIN GU815767_SHBs_P-B of FT:mat_peptide GU815767_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815768_SHBs_P-B Product feature CHAIN GU815768_SHBs_P-B of FT:mat_peptide GU815768_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815769_SHBs_P-B Product feature CHAIN GU815769_SHBs_P-B of FT:mat_peptide GU815769_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815770_SHBs_P-B Product feature CHAIN GU815770_SHBs_P-B of FT:mat_peptide GU815770_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKACTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815771_SHBs_P-B Product feature CHAIN GU815771_SHBs_P-B of FT:mat_peptide GU815771_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815772_SHBs_P-B Product feature CHAIN GU815772_SHBs_P-B of FT:mat_peptide GU815772_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815773_SHBs_P-B Product feature CHAIN GU815773_SHBs_P-B of FT:mat_peptide GU815773_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|GU815774_SHBs_P-B Product feature CHAIN GU815774_SHBs_P-B of FT:mat_peptide GU815774_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGISMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815775_SHBs_P-B Product feature CHAIN GU815775_SHBs_P-B of FT:mat_peptide GU815775_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815776_SHBs_P-B Product feature CHAIN GU815776_SHBs_P-B of FT:mat_peptide GU815776_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFSCLWVYI
>gnl|hbvpro|GU815777_SHBs_P-B Product feature CHAIN GU815777_SHBs_P-B of FT:mat_peptide GU815777_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815778_SHBs_P-B Product feature CHAIN GU815778_SHBs_P-B of FT:mat_peptide GU815778_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815779_SHBs_P-B Product feature CHAIN GU815779_SHBs_P-B of FT:mat_peptide GU815779_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFRLWVYI
>gnl|hbvpro|GU815780_SHBs_P-B Product feature CHAIN GU815780_SHBs_P-B of FT:mat_peptide GU815780_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815781_SHBs_P-B Product feature CHAIN GU815781_SHBs_P-B of FT:mat_peptide GU815781_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815782_SHBs_P-B Product feature CHAIN GU815782_SHBs_P-B of FT:mat_peptide GU815782_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|GU815783_SHBs_P-B Product feature CHAIN GU815783_SHBs_P-B of FT:mat_peptide GU815783_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTAPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652134_SHBs_P-B Product feature CHAIN HE652134_SHBs_P-B of FT:mat_peptide HE652134_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652136_SHBs_P-B Product feature CHAIN HE652136_SHBs_P-B of FT:mat_peptide HE652136_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HE652137_SHBs_P-B Product feature CHAIN HE652137_SHBs_P-B of FT:mat_peptide HE652137_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652138_SHBs_P-B Product feature CHAIN HE652138_SHBs_P-B of FT:mat_peptide HE652138_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652139_SHBs_P-B Product feature CHAIN HE652139_SHBs_P-B of FT:mat_peptide HE652139_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGSCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652140_SHBs_P-B Product feature CHAIN HE652140_SHBs_P-B of FT:mat_peptide HE652140_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILGPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652141_SHBs_P-B Product feature CHAIN HE652141_SHBs_P-B of FT:mat_peptide HE652141_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652143_SHBs_P-B Product feature CHAIN HE652143_SHBs_P-B of FT:mat_peptide HE652143_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652144_SHBs_P-B Product feature CHAIN HE652144_SHBs_P-B of FT:mat_peptide HE652144_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWERASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652145_SHBs_P-B Product feature CHAIN HE652145_SHBs_P-B of FT:mat_peptide HE652145_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652146_SHBs_P-B Product feature CHAIN HE652146_SHBs_P-B of FT:mat_peptide HE652146_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HE652147_SHBs_P-B Product feature CHAIN HE652147_SHBs_P-B of FT:mat_peptide HE652147_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652148_SHBs_P-B Product feature CHAIN HE652148_SHBs_P-B of FT:mat_peptide HE652148_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRLMCPRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652150_SHBs_P-B Product feature CHAIN HE652150_SHBs_P-B of FT:mat_peptide HE652150_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HE652151_SHBs_P-B Product feature CHAIN HE652151_SHBs_P-B of FT:mat_peptide HE652151_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652153_SHBs_P-B Product feature CHAIN HE652153_SHBs_P-B of FT:mat_peptide HE652153_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTPMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652154_SHBs_P-B Product feature CHAIN HE652154_SHBs_P-B of FT:mat_peptide HE652154_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLYILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652158_SHBs_P-B Product feature CHAIN HE652158_SHBs_P-B of FT:mat_peptide HE652158_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652159_SHBs_P-B Product feature CHAIN HE652159_SHBs_P-B of FT:mat_peptide HE652159_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|HE652160_SHBs_P-B Product feature CHAIN HE652160_SHBs_P-B of FT:mat_peptide HE652160_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|HE652161_SHBs_P-B Product feature CHAIN HE652161_SHBs_P-B of FT:mat_peptide HE652161_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|HE652162_SHBs_P-B Product feature CHAIN HE652162_SHBs_P-B of FT:mat_peptide HE652162_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|HE652163_SHBs_P-B Product feature CHAIN HE652163_SHBs_P-B of FT:mat_peptide HE652163_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|HE652164_SHBs_P-B Product feature CHAIN HE652164_SHBs_P-B of FT:mat_peptide HE652164_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPISNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTTPAQGTSMIPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLSFFLWVYI
>gnl|hbvpro|HE652165_SHBs_P-B Product feature CHAIN HE652165_SHBs_P-B of FT:mat_peptide HE652165_SHBs_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGHLLVLQAGFFLLTKILT