HBVdb

Dataset for protein HBc of genotype C

[Download (right click)] [Alignment] [Repertoires]

2801 sequence(s)

>gnl|hbvpro|AB014360_HBc_P-C Product feature CHAIN AB014360_HBc_P-C of FT:mat_peptide AB014360_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D01HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014361_HBc_P-C Product feature CHAIN AB014361_HBc_P-C of FT:mat_peptide AB014361_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 02D02HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPNAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014362_HBc_P-C Product feature CHAIN AB014362_HBc_P-C of FT:mat_peptide AB014362_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03D03HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014363_HBc_P-C Product feature CHAIN AB014363_HBc_P-C of FT:mat_peptide AB014363_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04D04HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVCEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB014364_HBc_P-C Product feature CHAIN AB014364_HBc_P-C of FT:mat_peptide AB014364_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 05D05HCC). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALHREALESPGHCTPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014365_HBc_P-C Product feature CHAIN AB014365_HBc_P-C of FT:mat_peptide AB014365_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D06HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014367_HBc_P-C Product feature CHAIN AB014367_HBc_P-C of FT:mat_peptide AB014367_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08D08HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|AB014368_HBc_P-C Product feature CHAIN AB014368_HBc_P-C of FT:mat_peptide AB014368_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09D09HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014369_HBc_P-C Product feature CHAIN AB014369_HBc_P-C of FT:mat_peptide AB014369_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10D10HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014371_HBc_P-C Product feature CHAIN AB014371_HBc_P-C of FT:mat_peptide AB014371_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 12D12HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB014372_HBc_P-C Product feature CHAIN AB014372_HBc_P-C of FT:mat_peptide AB014372_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13D13HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014373_HBc_P-C Product feature CHAIN AB014373_HBc_P-C of FT:mat_peptide AB014373_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14D14HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014374_HBc_P-C Product feature CHAIN AB014374_HBc_P-C of FT:mat_peptide AB014374_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15D15HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014376_HBc_P-C Product feature CHAIN AB014376_HBc_P-C of FT:mat_peptide AB014376_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17T02HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014377_HBc_P-C Product feature CHAIN AB014377_HBc_P-C of FT:mat_peptide AB014377_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18T03HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTSGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014378_HBc_P-C Product feature CHAIN AB014378_HBc_P-C of FT:mat_peptide AB014378_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19Y01HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTPYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014379_HBc_P-C Product feature CHAIN AB014379_HBc_P-C of FT:mat_peptide AB014379_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 20Y02HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014380_HBc_P-C Product feature CHAIN AB014380_HBc_P-C of FT:mat_peptide AB014380_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21Y03HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014381_HBc_P-C Product feature CHAIN AB014381_HBc_P-C of FT:mat_peptide AB014381_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 22Y04HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014382_HBc_P-C Product feature CHAIN AB014382_HBc_P-C of FT:mat_peptide AB014382_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23Y05HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014383_HBc_P-C Product feature CHAIN AB014383_HBc_P-C of FT:mat_peptide AB014383_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24Y06HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014384_HBc_P-C Product feature CHAIN AB014384_HBc_P-C of FT:mat_peptide AB014384_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 25Y07HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014385_HBc_P-C Product feature CHAIN AB014385_HBc_P-C of FT:mat_peptide AB014385_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26Y08HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014386_HBc_P-C Product feature CHAIN AB014386_HBc_P-C of FT:mat_peptide AB014386_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27Y09HCC). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSSLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB014387_HBc_P-C Product feature CHAIN AB014387_HBc_P-C of FT:mat_peptide AB014387_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28Y10HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB014388_HBc_P-C Product feature CHAIN AB014388_HBc_P-C of FT:mat_peptide AB014388_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29Y11HCC). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014390_HBc_P-C Product feature CHAIN AB014390_HBc_P-C of FT:mat_peptide AB014390_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 31Y13HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014391_HBc_P-C Product feature CHAIN AB014391_HBc_P-C of FT:mat_peptide AB014391_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 32Y14HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014392_HBc_P-C Product feature CHAIN AB014392_HBc_P-C of FT:mat_peptide AB014392_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 33Y15HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014393_HBc_P-C Product feature CHAIN AB014393_HBc_P-C of FT:mat_peptide AB014393_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 34Y16HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESSEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014394_HBc_P-C Product feature CHAIN AB014394_HBc_P-C of FT:mat_peptide AB014394_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35Y17HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLADPA
SRDLVVNYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB014395_HBc_P-C Product feature CHAIN AB014395_HBc_P-C of FT:mat_peptide AB014395_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 36Y18HCC). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014396_HBc_P-C Product feature CHAIN AB014396_HBc_P-C of FT:mat_peptide AB014396_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37Y19HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014397_HBc_P-C Product feature CHAIN AB014397_HBc_P-C of FT:mat_peptide AB014397_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38Y20HCC). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB014398_HBc_P-C Product feature CHAIN AB014398_HBc_P-C of FT:mat_peptide AB014398_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 39Y21HCC). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETCVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB014399_HBc_P-C Product feature CHAIN AB014399_HBc_P-C of FT:mat_peptide AB014399_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 40Y22HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026811_HBc_P-C Product feature CHAIN AB026811_HBc_P-C of FT:mat_peptide AB026811_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Feb.). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026812_HBc_P-C Product feature CHAIN AB026812_HBc_P-C of FT:mat_peptide AB026812_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;98.May). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026813_HBc_P-C Product feature CHAIN AB026813_HBc_P-C of FT:mat_peptide AB026813_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Sep.). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026814_HBc_P-C Product feature CHAIN AB026814_HBc_P-C of FT:mat_peptide AB026814_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Donor 3;98.May). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026815_HBc_P-C Product feature CHAIN AB026815_HBc_P-C of FT:mat_peptide AB026815_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 2:full). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031262_HBc_P-C Product feature CHAIN AB031262_HBc_P-C of FT:mat_peptide AB031262_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV VietA-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033550_HBc_P-C Product feature CHAIN AB033550_HBc_P-C of FT:mat_peptide AB033550_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NDR260). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033551_HBc_P-C Product feature CHAIN AB033551_HBc_P-C of FT:mat_peptide AB033551_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK300). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033552_HBc_P-C Product feature CHAIN AB033552_HBc_P-C of FT:mat_peptide AB033552_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK494). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033553_HBc_P-C Product feature CHAIN AB033553_HBc_P-C of FT:mat_peptide AB033553_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK619). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033556_HBc_P-C Product feature CHAIN AB033556_HBc_P-C of FT:mat_peptide AB033556_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AK66). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB042282_HBc_P-C Product feature CHAIN AB042282_HBc_P-C of FT:mat_peptide AB042282_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMNLATWVGSNLEDPA
SRELLVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB042283_HBc_P-C Product feature CHAIN AB042283_HBc_P-C of FT:mat_peptide AB042283_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB042284_HBc_P-C Product feature CHAIN AB042284_HBc_P-C of FT:mat_peptide AB042284_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLXTASALYREALQSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB042285_HBc_P-C Product feature CHAIN AB042285_HBc_P-C of FT:mat_peptide AB042285_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYLEALESPEHCSPHHTALRQAILCWDELMKLATWVGGNLDDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB049610_HBc_P-C Product feature CHAIN AB049610_HBc_P-C of FT:mat_peptide AB049610_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV AN29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMDLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB050018_HBc_P-C Product feature CHAIN AB050018_HBc_P-C of FT:mat_peptide AB050018_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB074047_HBc_P-C Product feature CHAIN AB074047_HBc_P-C of FT:mat_peptide AB074047_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRSRRSQSRGSQC
>gnl|hbvpro|AB074755_HBc_P-C Product feature CHAIN AB074755_HBc_P-C of FT:mat_peptide AB074755_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESSEHCSPHHTALRQAILCWGEMMNLATWVGSNLQDPA
SRELVVSYVNVNMGLNIRQLLWFHISCLTFGTETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB074756_HBc_P-C Product feature CHAIN AB074756_HBc_P-C of FT:mat_peptide AB074756_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th55). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESSEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB105173_HBc_P-C Product feature CHAIN AB105173_HBc_P-C of FT:mat_peptide AB105173_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALETPEHSSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB105174_HBc_P-C Product feature CHAIN AB105174_HBc_P-C of FT:mat_peptide AB105174_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 60). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB106895_HBc_P-C Product feature CHAIN AB106895_HBc_P-C of FT:mat_peptide AB106895_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pHB4-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111112_HBc_P-C Product feature CHAIN AB111112_HBc_P-C of FT:mat_peptide AB111112_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHXSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111114_HBc_P-C Product feature CHAIN AB111114_HBc_P-C of FT:mat_peptide AB111114_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111116_HBc_P-C Product feature CHAIN AB111116_HBc_P-C of FT:mat_peptide AB111116_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111117_HBc_P-C Product feature CHAIN AB111117_HBc_P-C of FT:mat_peptide AB111117_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111118_HBc_P-C Product feature CHAIN AB111118_HBc_P-C of FT:mat_peptide AB111118_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWAELMNLATWVGSNLEDPA
SRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRQGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111119_HBc_P-C Product feature CHAIN AB111119_HBc_P-C of FT:mat_peptide AB111119_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111120_HBc_P-C Product feature CHAIN AB111120_HBc_P-C of FT:mat_peptide AB111120_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111121_HBc_P-C Product feature CHAIN AB111121_HBc_P-C of FT:mat_peptide AB111121_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111122_HBc_P-C Product feature CHAIN AB111122_HBc_P-C of FT:mat_peptide AB111122_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEMMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111123_HBc_P-C Product feature CHAIN AB111123_HBc_P-C of FT:mat_peptide AB111123_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111124_HBc_P-C Product feature CHAIN AB111124_HBc_P-C of FT:mat_peptide AB111124_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111125_HBc_P-C Product feature CHAIN AB111125_HBc_P-C of FT:mat_peptide AB111125_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111946_HBc_P-C Product feature CHAIN AB111946_HBc_P-C of FT:mat_peptide AB111946_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT103). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALFREALESPEHCTPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112063_HBc_P-C Product feature CHAIN AB112063_HBc_P-C of FT:mat_peptide AB112063_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALFREALESPEHCTPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB112065_HBc_P-C Product feature CHAIN AB112065_HBc_P-C of FT:mat_peptide AB112065_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT140). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNSEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112066_HBc_P-C Product feature CHAIN AB112066_HBc_P-C of FT:mat_peptide AB112066_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY624). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVLSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRKRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112348_HBc_P-C Product feature CHAIN AB112348_HBc_P-C of FT:mat_peptide AB112348_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY656). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKVFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112408_HBc_P-C Product feature CHAIN AB112408_HBc_P-C of FT:mat_peptide AB112408_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY683). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASEELLSFLPSDYFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112471_HBc_P-C Product feature CHAIN AB112471_HBc_P-C of FT:mat_peptide AB112471_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH123). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPNKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112472_HBc_P-C Product feature CHAIN AB112472_HBc_P-C of FT:mat_peptide AB112472_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH124). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPNKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRI
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB113875_HBc_P-C Product feature CHAIN AB113875_HBc_P-C of FT:mat_peptide AB113875_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFMPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB113876_HBc_P-C Product feature CHAIN AB113876_HBc_P-C of FT:mat_peptide AB113876_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFMPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB113878_HBc_P-C Product feature CHAIN AB113878_HBc_P-C of FT:mat_peptide AB113878_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESQEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB113879_HBc_P-C Product feature CHAIN AB113879_HBc_P-C of FT:mat_peptide AB113879_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB115417_HBc_P-C Product feature CHAIN AB115417_HBc_P-C of FT:mat_peptide AB115417_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPNKEFGASVELLSFLPSDFFPSMRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB115418_HBc_P-C Product feature CHAIN AB115418_HBc_P-C of FT:mat_peptide AB115418_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O55). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPNKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYGNGNMGLKLRHLLWVHNSWLTFGRETGLEYLVSSGVWIRTPTAYRPPNAPILSTLPETAVVRPRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB117758_HBc_P-C Product feature CHAIN AB117758_HBc_P-C of FT:mat_peptide AB117758_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CB10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB176642_HBc_P-C Product feature CHAIN AB176642_HBc_P-C of FT:mat_peptide AB176642_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-115). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLXDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVRQRGRSLRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|AB176643_HBc_P-C Product feature CHAIN AB176643_HBc_P-C of FT:mat_peptide AB176643_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-NK1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB182589_HBc_P-C Product feature CHAIN AB182589_HBc_P-C of FT:mat_peptide AB182589_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CH:Mat-Ko). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHGSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195930_HBc_P-C Product feature CHAIN AB195930_HBc_P-C of FT:mat_peptide AB195930_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESQEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195931_HBc_P-C Product feature CHAIN AB195931_HBc_P-C of FT:mat_peptide AB195931_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESQEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195932_HBc_P-C Product feature CHAIN AB195932_HBc_P-C of FT:mat_peptide AB195932_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESQEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195936_HBc_P-C Product feature CHAIN AB195936_HBc_P-C of FT:mat_peptide AB195936_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195937_HBc_P-C Product feature CHAIN AB195937_HBc_P-C of FT:mat_peptide AB195937_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195938_HBc_P-C Product feature CHAIN AB195938_HBc_P-C of FT:mat_peptide AB195938_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195942_HBc_P-C Product feature CHAIN AB195942_HBc_P-C of FT:mat_peptide AB195942_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195943_HBc_P-C Product feature CHAIN AB195943_HBc_P-C of FT:mat_peptide AB195943_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195944_HBc_P-C Product feature CHAIN AB195944_HBc_P-C of FT:mat_peptide AB195944_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195945_HBc_P-C Product feature CHAIN AB195945_HBc_P-C of FT:mat_peptide AB195945_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|AB195946_HBc_P-C Product feature CHAIN AB195946_HBc_P-C of FT:mat_peptide AB195946_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB195947_HBc_P-C Product feature CHAIN AB195947_HBc_P-C of FT:mat_peptide AB195947_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195948_HBc_P-C Product feature CHAIN AB195948_HBc_P-C of FT:mat_peptide AB195948_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195949_HBc_P-C Product feature CHAIN AB195949_HBc_P-C of FT:mat_peptide AB195949_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195952_HBc_P-C Product feature CHAIN AB195952_HBc_P-C of FT:mat_peptide AB195952_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHICCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195953_HBc_P-C Product feature CHAIN AB195953_HBc_P-C of FT:mat_peptide AB195953_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHICCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195954_HBc_P-C Product feature CHAIN AB195954_HBc_P-C of FT:mat_peptide AB195954_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHICCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198076_HBc_P-C Product feature CHAIN AB198076_HBc_P-C of FT:mat_peptide AB198076_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198077_HBc_P-C Product feature CHAIN AB198077_HBc_P-C of FT:mat_peptide AB198077_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198078_HBc_P-C Product feature CHAIN AB198078_HBc_P-C of FT:mat_peptide AB198078_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198079_HBc_P-C Product feature CHAIN AB198079_HBc_P-C of FT:mat_peptide AB198079_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198080_HBc_P-C Product feature CHAIN AB198080_HBc_P-C of FT:mat_peptide AB198080_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198081_HBc_P-C Product feature CHAIN AB198081_HBc_P-C of FT:mat_peptide AB198081_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198082_HBc_P-C Product feature CHAIN AB198082_HBc_P-C of FT:mat_peptide AB198082_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198083_HBc_P-C Product feature CHAIN AB198083_HBc_P-C of FT:mat_peptide AB198083_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB202071_HBc_P-C Product feature CHAIN AB202071_HBc_P-C of FT:mat_peptide AB202071_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIMCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB202072_HBc_P-C Product feature CHAIN AB202072_HBc_P-C of FT:mat_peptide AB202072_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205123_HBc_P-C Product feature CHAIN AB205123_HBc_P-C of FT:mat_peptide AB205123_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CN578-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205124_HBc_P-C Product feature CHAIN AB205124_HBc_P-C of FT:mat_peptide AB205124_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TJ3-1-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205125_HBc_P-C Product feature CHAIN AB205125_HBc_P-C of FT:mat_peptide AB205125_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VH34-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222714_HBc_P-C Product feature CHAIN AB222714_HBc_P-C of FT:mat_peptide AB222714_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222715_HBc_P-C Product feature CHAIN AB222715_HBc_P-C of FT:mat_peptide AB222715_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7M). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241110_HBc_P-C Product feature CHAIN AB241110_HBc_P-C of FT:mat_peptide AB241110_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC03). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241111_HBc_P-C Product feature CHAIN AB241111_HBc_P-C of FT:mat_peptide AB241111_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246344_HBc_P-C Product feature CHAIN AB246344_HBc_P-C of FT:mat_peptide AB246344_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246345_HBc_P-C Product feature CHAIN AB246345_HBc_P-C of FT:mat_peptide AB246345_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246346_HBc_P-C Product feature CHAIN AB246346_HBc_P-C of FT:mat_peptide AB246346_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB247916_HBc_P-C Product feature CHAIN AB247916_HBc_P-C of FT:mat_peptide AB247916_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB250109_HBc_P-C Product feature CHAIN AB250109_HBc_P-C of FT:mat_peptide AB250109_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IH030213). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB288026_HBc_P-C Product feature CHAIN AB288026_HBc_P-C of FT:mat_peptide AB288026_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALREAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB298720_HBc_P-C Product feature CHAIN AB298720_HBc_P-C of FT:mat_peptide AB298720_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1S). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB298721_HBc_P-C Product feature CHAIN AB298721_HBc_P-C of FT:mat_peptide AB298721_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1C). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB299858_HBc_P-C Product feature CHAIN AB299858_HBc_P-C of FT:mat_peptide AB299858_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300359_HBc_P-C Product feature CHAIN AB300359_HBc_P-C of FT:mat_peptide AB300359_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300360_HBc_P-C Product feature CHAIN AB300360_HBc_P-C of FT:mat_peptide AB300360_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTALALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB300361_HBc_P-C Product feature CHAIN AB300361_HBc_P-C of FT:mat_peptide AB300361_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGGSVEPLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRTQSRESQC
>gnl|hbvpro|AB300362_HBc_P-C Product feature CHAIN AB300362_HBc_P-C of FT:mat_peptide AB300362_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300363_HBc_P-C Product feature CHAIN AB300363_HBc_P-C of FT:mat_peptide AB300363_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300365_HBc_P-C Product feature CHAIN AB300365_HBc_P-C of FT:mat_peptide AB300365_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300368_HBc_P-C Product feature CHAIN AB300368_HBc_P-C of FT:mat_peptide AB300368_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300372_HBc_P-C Product feature CHAIN AB300372_HBc_P-C of FT:mat_peptide AB300372_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient14). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300373_HBc_P-C Product feature CHAIN AB300373_HBc_P-C of FT:mat_peptide AB300373_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient15). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVVCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPVLSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB362932_HBc_P-C Product feature CHAIN AB362932_HBc_P-C of FT:mat_peptide AB362932_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB365451_HBc_P-C Product feature CHAIN AB365451_HBc_P-C of FT:mat_peptide AB365451_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL196). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367392_HBc_P-C Product feature CHAIN AB367392_HBc_P-C of FT:mat_peptide AB367392_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSVRDLIDTASALYREALESPEHHSPHHTALRQGILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367394_HBc_P-C Product feature CHAIN AB367394_HBc_P-C of FT:mat_peptide AB367394_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 3/Adefovir-treated Pt. 8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367395_HBc_P-C Product feature CHAIN AB367395_HBc_P-C of FT:mat_peptide AB367395_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367396_HBc_P-C Product feature CHAIN AB367396_HBc_P-C of FT:mat_peptide AB367396_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367397_HBc_P-C Product feature CHAIN AB367397_HBc_P-C of FT:mat_peptide AB367397_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367398_HBc_P-C Product feature CHAIN AB367398_HBc_P-C of FT:mat_peptide AB367398_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 7/Adefovir-treated Pt. 20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367399_HBc_P-C Product feature CHAIN AB367399_HBc_P-C of FT:mat_peptide AB367399_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 8/Adefovir-treated Pt. 29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367401_HBc_P-C Product feature CHAIN AB367401_HBc_P-C of FT:mat_peptide AB367401_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 10/Adefovir-treated Pt. 9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB367402_HBc_P-C Product feature CHAIN AB367402_HBc_P-C of FT:mat_peptide AB367402_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367403_HBc_P-C Product feature CHAIN AB367403_HBc_P-C of FT:mat_peptide AB367403_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 12/Adefovir-treated Pt. 17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367404_HBc_P-C Product feature CHAIN AB367404_HBc_P-C of FT:mat_peptide AB367404_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 13/Adefovir-treated Pt. 22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367405_HBc_P-C Product feature CHAIN AB367405_HBc_P-C of FT:mat_peptide AB367405_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 14/Adefovir-treated Pt. 25). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|AB367406_HBc_P-C Product feature CHAIN AB367406_HBc_P-C of FT:mat_peptide AB367406_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 15/Adefovir-treated Pt. 7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB367407_HBc_P-C Product feature CHAIN AB367407_HBc_P-C of FT:mat_peptide AB367407_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 16/Adefovir-treated Pt. 11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367408_HBc_P-C Product feature CHAIN AB367408_HBc_P-C of FT:mat_peptide AB367408_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 17/Adefovir-treated Pt. 14). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367409_HBc_P-C Product feature CHAIN AB367409_HBc_P-C of FT:mat_peptide AB367409_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 18). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367410_HBc_P-C Product feature CHAIN AB367410_HBc_P-C of FT:mat_peptide AB367410_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 19/Adefovir-treated Pt. 19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367411_HBc_P-C Product feature CHAIN AB367411_HBc_P-C of FT:mat_peptide AB367411_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367412_HBc_P-C Product feature CHAIN AB367412_HBc_P-C of FT:mat_peptide AB367412_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367413_HBc_P-C Product feature CHAIN AB367413_HBc_P-C of FT:mat_peptide AB367413_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 22/Adefovir-treated Pt. 4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRELIDTASALYREALESPEHCSPHHTALRQALLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367414_HBc_P-C Product feature CHAIN AB367414_HBc_P-C of FT:mat_peptide AB367414_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 23/Adefovir-treated Pt. 3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367416_HBc_P-C Product feature CHAIN AB367416_HBc_P-C of FT:mat_peptide AB367416_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367417_HBc_P-C Product feature CHAIN AB367417_HBc_P-C of FT:mat_peptide AB367417_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367418_HBc_P-C Product feature CHAIN AB367418_HBc_P-C of FT:mat_peptide AB367418_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 27/Adefovir-treated Pt. 21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367420_HBc_P-C Product feature CHAIN AB367420_HBc_P-C of FT:mat_peptide AB367420_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB367421_HBc_P-C Product feature CHAIN AB367421_HBc_P-C of FT:mat_peptide AB367421_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 30). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQW
>gnl|hbvpro|AB367422_HBc_P-C Product feature CHAIN AB367422_HBc_P-C of FT:mat_peptide AB367422_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 31/Adefovir-treated Pt. 12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367423_HBc_P-C Product feature CHAIN AB367423_HBc_P-C of FT:mat_peptide AB367423_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 32/Adefovir-treated Pt. 28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367424_HBc_P-C Product feature CHAIN AB367424_HBc_P-C of FT:mat_peptide AB367424_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367425_HBc_P-C Product feature CHAIN AB367425_HBc_P-C of FT:mat_peptide AB367425_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 34/Adefovir-treated Pt. 15). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNAGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367426_HBc_P-C Product feature CHAIN AB367426_HBc_P-C of FT:mat_peptide AB367426_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 35). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCITFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB367427_HBc_P-C Product feature CHAIN AB367427_HBc_P-C of FT:mat_peptide AB367427_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 36/Adefovir-treated Pt. 18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB367428_HBc_P-C Product feature CHAIN AB367428_HBc_P-C of FT:mat_peptide AB367428_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 37/Adefovir-treated Pt. 10). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367429_HBc_P-C Product feature CHAIN AB367429_HBc_P-C of FT:mat_peptide AB367429_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 38). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB367430_HBc_P-C Product feature CHAIN AB367430_HBc_P-C of FT:mat_peptide AB367430_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 39/Adefovir-treated Pt. 5). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367431_HBc_P-C Product feature CHAIN AB367431_HBc_P-C of FT:mat_peptide AB367431_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB367432_HBc_P-C Product feature CHAIN AB367432_HBc_P-C of FT:mat_peptide AB367432_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGANLDDPA
SRESVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367433_HBc_P-C Product feature CHAIN AB367433_HBc_P-C of FT:mat_peptide AB367433_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 42/Adefovir-treated Pt. 27). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSRSRESQC
>gnl|hbvpro|AB367434_HBc_P-C Product feature CHAIN AB367434_HBc_P-C of FT:mat_peptide AB367434_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 43/Adefovir-treated Pt. 26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGMSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367435_HBc_P-C Product feature CHAIN AB367435_HBc_P-C of FT:mat_peptide AB367435_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 44/Adefovir-treated Pt. 23). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB367801_HBc_P-C Product feature CHAIN AB367801_HBc_P-C of FT:mat_peptide AB367801_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 30). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCITFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB367802_HBc_P-C Product feature CHAIN AB367802_HBc_P-C of FT:mat_peptide AB367802_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 16). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367803_HBc_P-C Product feature CHAIN AB367803_HBc_P-C of FT:mat_peptide AB367803_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRMSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367804_HBc_P-C Product feature CHAIN AB367804_HBc_P-C of FT:mat_peptide AB367804_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGANLDDPA
SRESVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB426467_HBc_P-C Product feature CHAIN AB426467_HBc_P-C of FT:mat_peptide AB426467_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471848_HBc_P-C Product feature CHAIN AB471848_HBc_P-C of FT:mat_peptide AB471848_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471849_HBc_P-C Product feature CHAIN AB471849_HBc_P-C of FT:mat_peptide AB471849_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471850_HBc_P-C Product feature CHAIN AB471850_HBc_P-C of FT:mat_peptide AB471850_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471851_HBc_P-C Product feature CHAIN AB471851_HBc_P-C of FT:mat_peptide AB471851_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2NK-F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471852_HBc_P-C Product feature CHAIN AB471852_HBc_P-C of FT:mat_peptide AB471852_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471853_HBc_P-C Product feature CHAIN AB471853_HBc_P-C of FT:mat_peptide AB471853_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB485808_HBc_P-C Product feature CHAIN AB485808_HBc_P-C of FT:mat_peptide AB485808_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-IT). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB485809_HBc_P-C Product feature CHAIN AB485809_HBc_P-C of FT:mat_peptide AB485809_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASSELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB485810_HBc_P-C Product feature CHAIN AB485810_HBc_P-C of FT:mat_peptide AB485810_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASSELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLGTWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB640730_HBc_P-C Product feature CHAIN AB640730_HBc_P-C of FT:mat_peptide AB640730_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ehime-EPCH-HBV-C1-HN). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB642095_HBc_P-C Product feature CHAIN AB642095_HBc_P-C of FT:mat_peptide AB642095_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2000-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPAAYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB642097_HBc_P-C Product feature CHAIN AB642097_HBc_P-C of FT:mat_peptide AB642097_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2003-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTAAALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLXDPA
SRELVVSYVNVNMGLKLRQILWFHISCLMFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|AB642099_HBc_P-C Product feature CHAIN AB642099_HBc_P-C of FT:mat_peptide AB642099_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2005-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB642100_HBc_P-C Product feature CHAIN AB642100_HBc_P-C of FT:mat_peptide AB642100_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2006-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670237_HBc_P-C Product feature CHAIN AB670237_HBc_P-C of FT:mat_peptide AB670237_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREAXESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670238_HBc_P-C Product feature CHAIN AB670238_HBc_P-C of FT:mat_peptide AB670238_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670239_HBc_P-C Product feature CHAIN AB670239_HBc_P-C of FT:mat_peptide AB670239_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670240_HBc_P-C Product feature CHAIN AB670240_HBc_P-C of FT:mat_peptide AB670240_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670241_HBc_P-C Product feature CHAIN AB670241_HBc_P-C of FT:mat_peptide AB670241_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB670242_HBc_P-C Product feature CHAIN AB670242_HBc_P-C of FT:mat_peptide AB670242_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|AB670243_HBc_P-C Product feature CHAIN AB670243_HBc_P-C of FT:mat_peptide AB670243_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670246_HBc_P-C Product feature CHAIN AB670246_HBc_P-C of FT:mat_peptide AB670246_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAIVCWGELMNLATWVGSNLEDQA
SRDSVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670247_HBc_P-C Product feature CHAIN AB670247_HBc_P-C of FT:mat_peptide AB670247_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670249_HBc_P-C Product feature CHAIN AB670249_HBc_P-C of FT:mat_peptide AB670249_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670252_HBc_P-C Product feature CHAIN AB670252_HBc_P-C of FT:mat_peptide AB670252_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670253_HBc_P-C Product feature CHAIN AB670253_HBc_P-C of FT:mat_peptide AB670253_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670254_HBc_P-C Product feature CHAIN AB670254_HBc_P-C of FT:mat_peptide AB670254_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.18). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670255_HBc_P-C Product feature CHAIN AB670255_HBc_P-C of FT:mat_peptide AB670255_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.19). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAVLCWGELMSLATWVGSNLEDPA
SREAVVNYVNVNMGLKFRQLLWFHVSCLTFGRQTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670256_HBc_P-C Product feature CHAIN AB670256_HBc_P-C of FT:mat_peptide AB670256_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670258_HBc_P-C Product feature CHAIN AB670258_HBc_P-C of FT:mat_peptide AB670258_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670259_HBc_P-C Product feature CHAIN AB670259_HBc_P-C of FT:mat_peptide AB670259_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPADFFPSXRDLLDTATALYREALESREHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|AB670260_HBc_P-C Product feature CHAIN AB670260_HBc_P-C of FT:mat_peptide AB670260_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.24). Complete genome. [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEESS
RELVVSYVNVHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXRCRGRSPRRRTP
SPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB670261_HBc_P-C Product feature CHAIN AB670261_HBc_P-C of FT:mat_peptide AB670261_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670262_HBc_P-C Product feature CHAIN AB670262_HBc_P-C of FT:mat_peptide AB670262_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SREVVVSYVNVNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB670263_HBc_P-C Product feature CHAIN AB670263_HBc_P-C of FT:mat_peptide AB670263_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLXDPA
SRELVVXHVNVNMGLKIRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB670264_HBc_P-C Product feature CHAIN AB670264_HBc_P-C of FT:mat_peptide AB670264_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB670265_HBc_P-C Product feature CHAIN AB670265_HBc_P-C of FT:mat_peptide AB670265_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESNC
>gnl|hbvpro|AB670266_HBc_P-C Product feature CHAIN AB670266_HBc_P-C of FT:mat_peptide AB670266_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670267_HBc_P-C Product feature CHAIN AB670267_HBc_P-C of FT:mat_peptide AB670267_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670268_HBc_P-C Product feature CHAIN AB670268_HBc_P-C of FT:mat_peptide AB670268_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.32). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVXYVNVNMGXKXRPLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB670269_HBc_P-C Product feature CHAIN AB670269_HBc_P-C of FT:mat_peptide AB670269_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670270_HBc_P-C Product feature CHAIN AB670270_HBc_P-C of FT:mat_peptide AB670270_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVNHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB670272_HBc_P-C Product feature CHAIN AB670272_HBc_P-C of FT:mat_peptide AB670272_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYPEALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESNC
>gnl|hbvpro|AB670273_HBc_P-C Product feature CHAIN AB670273_HBc_P-C of FT:mat_peptide AB670273_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|AB670274_HBc_P-C Product feature CHAIN AB670274_HBc_P-C of FT:mat_peptide AB670274_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNLATWVGGNLDDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTXVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|AB670275_HBc_P-C Product feature CHAIN AB670275_HBc_P-C of FT:mat_peptide AB670275_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670276_HBc_P-C Product feature CHAIN AB670276_HBc_P-C of FT:mat_peptide AB670276_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670277_HBc_P-C Product feature CHAIN AB670277_HBc_P-C of FT:mat_peptide AB670277_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670278_HBc_P-C Product feature CHAIN AB670278_HBc_P-C of FT:mat_peptide AB670278_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670279_HBc_P-C Product feature CHAIN AB670279_HBc_P-C of FT:mat_peptide AB670279_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670281_HBc_P-C Product feature CHAIN AB670281_HBc_P-C of FT:mat_peptide AB670281_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPX
SRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670282_HBc_P-C Product feature CHAIN AB670282_HBc_P-C of FT:mat_peptide AB670282_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670283_HBc_P-C Product feature CHAIN AB670283_HBc_P-C of FT:mat_peptide AB670283_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670285_HBc_P-C Product feature CHAIN AB670285_HBc_P-C of FT:mat_peptide AB670285_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYXEALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLLIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670287_HBc_P-C Product feature CHAIN AB670287_HBc_P-C of FT:mat_peptide AB670287_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670289_HBc_P-C Product feature CHAIN AB670289_HBc_P-C of FT:mat_peptide AB670289_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670290_HBc_P-C Product feature CHAIN AB670290_HBc_P-C of FT:mat_peptide AB670290_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670291_HBc_P-C Product feature CHAIN AB670291_HBc_P-C of FT:mat_peptide AB670291_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670292_HBc_P-C Product feature CHAIN AB670292_HBc_P-C of FT:mat_peptide AB670292_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670294_HBc_P-C Product feature CHAIN AB670294_HBc_P-C of FT:mat_peptide AB670294_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.21). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670295_HBc_P-C Product feature CHAIN AB670295_HBc_P-C of FT:mat_peptide AB670295_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASAELVSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAIICWGELMNLATWVGGNLDDQA
SRDLVVSYVNVNMGLKLRQILWFHLSCLMFGRDTVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670297_HBc_P-C Product feature CHAIN AB670297_HBc_P-C of FT:mat_peptide AB670297_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670298_HBc_P-C Product feature CHAIN AB670298_HBc_P-C of FT:mat_peptide AB670298_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESREHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670300_HBc_P-C Product feature CHAIN AB670300_HBc_P-C of FT:mat_peptide AB670300_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB670301_HBc_P-C Product feature CHAIN AB670301_HBc_P-C of FT:mat_peptide AB670301_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670302_HBc_P-C Product feature CHAIN AB670302_HBc_P-C of FT:mat_peptide AB670302_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670304_HBc_P-C Product feature CHAIN AB670304_HBc_P-C of FT:mat_peptide AB670304_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.31). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRTLLWFHISCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670305_HBc_P-C Product feature CHAIN AB670305_HBc_P-C of FT:mat_peptide AB670305_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670306_HBc_P-C Product feature CHAIN AB670306_HBc_P-C of FT:mat_peptide AB670306_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTXVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB670307_HBc_P-C Product feature CHAIN AB670307_HBc_P-C of FT:mat_peptide AB670307_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.34). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670308_HBc_P-C Product feature CHAIN AB670308_HBc_P-C of FT:mat_peptide AB670308_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.35). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVNHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB670309_HBc_P-C Product feature CHAIN AB670309_HBc_P-C of FT:mat_peptide AB670309_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.36). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEETA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670310_HBc_P-C Product feature CHAIN AB670310_HBc_P-C of FT:mat_peptide AB670310_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670311_HBc_P-C Product feature CHAIN AB670311_HBc_P-C of FT:mat_peptide AB670311_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB675674_HBc_P-C Product feature CHAIN AB675674_HBc_P-C of FT:mat_peptide AB675674_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB675675_HBc_P-C Product feature CHAIN AB675675_HBc_P-C of FT:mat_peptide AB675675_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB675677_HBc_P-C Product feature CHAIN AB675677_HBc_P-C of FT:mat_peptide AB675677_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697490_HBc_P-C Product feature CHAIN AB697490_HBc_P-C of FT:mat_peptide AB697490_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697494_HBc_P-C Product feature CHAIN AB697494_HBc_P-C of FT:mat_peptide AB697494_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No9). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697500_HBc_P-C Product feature CHAIN AB697500_HBc_P-C of FT:mat_peptide AB697500_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697502_HBc_P-C Product feature CHAIN AB697502_HBc_P-C of FT:mat_peptide AB697502_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPQDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDPS
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697510_HBc_P-C Product feature CHAIN AB697510_HBc_P-C of FT:mat_peptide AB697510_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHLSCITFGREIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB900099_HBc_P-C Product feature CHAIN AB900099_HBc_P-C of FT:mat_peptide AB900099_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB900109_HBc_P-C Product feature CHAIN AB900109_HBc_P-C of FT:mat_peptide AB900109_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASSQLLSFLPADFFPSVRDLLDTASALYGEALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLDDQG
SRELVVGYVNVNMGLKFRQLLWFHISCXTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB900113_HBc_P-C Product feature CHAIN AB900113_HBc_P-C of FT:mat_peptide AB900113_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHLSCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB900115_HBc_P-C Product feature CHAIN AB900115_HBc_P-C of FT:mat_peptide AB900115_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTASALYREALESSEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB900116_HBc_P-C Product feature CHAIN AB900116_HBc_P-C of FT:mat_peptide AB900116_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB931170_HBc_P-C Product feature CHAIN AB931170_HBc_P-C of FT:mat_peptide AB931170_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2P_HB11-0921). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB931171_HBc_P-C Product feature CHAIN AB931171_HBc_P-C of FT:mat_peptide AB931171_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2S_HB11-0922). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB971714_HBc_P-C Product feature CHAIN AB971714_HBc_P-C of FT:mat_peptide AB971714_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1026). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB971715_HBc_P-C Product feature CHAIN AB971715_HBc_P-C of FT:mat_peptide AB971715_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1027). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF068756_HBc_P-C Product feature CHAIN AF068756_HBc_P-C of FT:mat_peptide AF068756_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF182802_HBc_P-C Product feature CHAIN AF182802_HBc_P-C of FT:mat_peptide AF182802_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRQGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF182803_HBc_P-C Product feature CHAIN AF182803_HBc_P-C of FT:mat_peptide AF182803_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF182804_HBc_P-C Product feature CHAIN AF182804_HBc_P-C of FT:mat_peptide AF182804_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF182805_HBc_P-C Product feature CHAIN AF182805_HBc_P-C of FT:mat_peptide AF182805_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AF223954_HBc_P-C Product feature CHAIN AF223954_HBc_P-C of FT:mat_peptide AF223954_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223955_HBc_P-C Product feature CHAIN AF223955_HBc_P-C of FT:mat_peptide AF223955_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223956_HBc_P-C Product feature CHAIN AF223956_HBc_P-C of FT:mat_peptide AF223956_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223957_HBc_P-C Product feature CHAIN AF223957_HBc_P-C of FT:mat_peptide AF223957_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223958_HBc_P-C Product feature CHAIN AF223958_HBc_P-C of FT:mat_peptide AF223958_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223959_HBc_P-C Product feature CHAIN AF223959_HBc_P-C of FT:mat_peptide AF223959_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223960_HBc_P-C Product feature CHAIN AF223960_HBc_P-C of FT:mat_peptide AF223960_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRZSQC
>gnl|hbvpro|AF223961_HBc_P-C Product feature CHAIN AF223961_HBc_P-C of FT:mat_peptide AF223961_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVXHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF241410_HBc_P-C Product feature CHAIN AF241410_HBc_P-C of FT:mat_peptide AF241410_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3270). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF241411_HBc_P-C Product feature CHAIN AF241411_HBc_P-C of FT:mat_peptide AF241411_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8290). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF286594_HBc_P-C Product feature CHAIN AF286594_HBc_P-C of FT:mat_peptide AF286594_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF323463_HBc_P-C Product feature CHAIN AF323463_HBc_P-C of FT:mat_peptide AF323463_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Korean A1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPQNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AF324081_HBc_P-C Product feature CHAIN AF324081_HBc_P-C of FT:mat_peptide AF324081_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A37). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324084_HBc_P-C Product feature CHAIN AF324084_HBc_P-C of FT:mat_peptide AF324084_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A41). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREYQC
>gnl|hbvpro|AF363961_HBc_P-C Product feature CHAIN AF363961_HBc_P-C of FT:mat_peptide AF363961_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPYAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384364_HBc_P-C Product feature CHAIN AF384364_HBc_P-C of FT:mat_peptide AF384364_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384365_HBc_P-C Product feature CHAIN AF384365_HBc_P-C of FT:mat_peptide AF384365_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384366_HBc_P-C Product feature CHAIN AF384366_HBc_P-C of FT:mat_peptide AF384366_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384367_HBc_P-C Product feature CHAIN AF384367_HBc_P-C of FT:mat_peptide AF384367_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFRISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384371_HBc_P-C Product feature CHAIN AF384371_HBc_P-C of FT:mat_peptide AF384371_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384372_HBc_P-C Product feature CHAIN AF384372_HBc_P-C of FT:mat_peptide AF384372_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-A6). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411408_HBc_P-C Product feature CHAIN AF411408_HBc_P-C of FT:mat_peptide AF411408_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411410_HBc_P-C Product feature CHAIN AF411410_HBc_P-C of FT:mat_peptide AF411410_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411411_HBc_P-C Product feature CHAIN AF411411_HBc_P-C of FT:mat_peptide AF411411_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411412_HBc_P-C Product feature CHAIN AF411412_HBc_P-C of FT:mat_peptide AF411412_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPRHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF458664_HBc_P-C Product feature CHAIN AF458664_HBc_P-C of FT:mat_peptide AF458664_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF458665_HBc_P-C Product feature CHAIN AF458665_HBc_P-C of FT:mat_peptide AF458665_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C733). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQP
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF461357_HBc_P-C Product feature CHAIN AF461357_HBc_P-C of FT:mat_peptide AF461357_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVASYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF461363_HBc_P-C Product feature CHAIN AF461363_HBc_P-C of FT:mat_peptide AF461363_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVASYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF473543_HBc_P-C Product feature CHAIN AF473543_HBc_P-C of FT:mat_peptide AF473543_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2e). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF533983_HBc_P-C Product feature CHAIN AF533983_HBc_P-C of FT:mat_peptide AF533983_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ748098_HBc_P-C Product feature CHAIN AJ748098_HBc_P-C of FT:mat_peptide AJ748098_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient Z1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011097_HBc_P-C Product feature CHAIN AP011097_HBc_P-C of FT:mat_peptide AP011097_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011098_HBc_P-C Product feature CHAIN AP011098_HBc_P-C of FT:mat_peptide AP011098_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011099_HBc_P-C Product feature CHAIN AP011099_HBc_P-C of FT:mat_peptide AP011099_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011100_HBc_P-C Product feature CHAIN AP011100_HBc_P-C of FT:mat_peptide AP011100_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011101_HBc_P-C Product feature CHAIN AP011101_HBc_P-C of FT:mat_peptide AP011101_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011106_HBc_P-C Product feature CHAIN AP011106_HBc_P-C of FT:mat_peptide AP011106_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011107_HBc_P-C Product feature CHAIN AP011107_HBc_P-C of FT:mat_peptide AP011107_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY057947_HBc_P-C Product feature CHAIN AY057947_HBc_P-C of FT:mat_peptide AY057947_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet705). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY066028_HBc_P-C Product feature CHAIN AY066028_HBc_P-C of FT:mat_peptide AY066028_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167090_HBc_P-C Product feature CHAIN AY167090_HBc_P-C of FT:mat_peptide AY167090_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167091_HBc_P-C Product feature CHAIN AY167091_HBc_P-C of FT:mat_peptide AY167091_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPANAPILSTLPETTVIRGRSRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167092_HBc_P-C Product feature CHAIN AY167092_HBc_P-C of FT:mat_peptide AY167092_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Id). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY167096_HBc_P-C Product feature CHAIN AY167096_HBc_P-C of FT:mat_peptide AY167096_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IIIa). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY167099_HBc_P-C Product feature CHAIN AY167099_HBc_P-C of FT:mat_peptide AY167099_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IVb). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206376_HBc_P-C Product feature CHAIN AY206376_HBc_P-C of FT:mat_peptide AY206376_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELISFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206378_HBc_P-C Product feature CHAIN AY206378_HBc_P-C of FT:mat_peptide AY206378_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAVVCWGELVNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY206379_HBc_P-C Product feature CHAIN AY206379_HBc_P-C of FT:mat_peptide AY206379_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELISFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206381_HBc_P-C Product feature CHAIN AY206381_HBc_P-C of FT:mat_peptide AY206381_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVIRRRGRSPRRRT
PSPHRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY206382_HBc_P-C Product feature CHAIN AY206382_HBc_P-C of FT:mat_peptide AY206382_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206384_HBc_P-C Product feature CHAIN AY206384_HBc_P-C of FT:mat_peptide AY206384_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206385_HBc_P-C Product feature CHAIN AY206385_HBc_P-C of FT:mat_peptide AY206385_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206386_HBc_P-C Product feature CHAIN AY206386_HBc_P-C of FT:mat_peptide AY206386_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWMRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206389_HBc_P-C Product feature CHAIN AY206389_HBc_P-C of FT:mat_peptide AY206389_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206392_HBc_P-C Product feature CHAIN AY206392_HBc_P-C of FT:mat_peptide AY206392_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGKETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|AY220699_HBc_P-C Product feature CHAIN AY220699_HBc_P-C of FT:mat_peptide AY220699_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETMLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY220700_HBc_P-C Product feature CHAIN AY220700_HBc_P-C of FT:mat_peptide AY220700_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY220702_HBc_P-C Product feature CHAIN AY220702_HBc_P-C of FT:mat_peptide AY220702_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTAAALYREALDSPEHCSPHHTALRQAIQCWGEVMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKMRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY247031_HBc_P-C Product feature CHAIN AY247031_HBc_P-C of FT:mat_peptide AY247031_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY247032_HBc_P-C Product feature CHAIN AY247032_HBc_P-C of FT:mat_peptide AY247032_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB95). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPT
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269099_HBc_P-C Product feature CHAIN AY269099_HBc_P-C of FT:mat_peptide AY269099_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269140_HBc_P-C Product feature CHAIN AY269140_HBc_P-C of FT:mat_peptide AY269140_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESAEHCTAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY306136_HBc_P-C Product feature CHAIN AY306136_HBc_P-C of FT:mat_peptide AY306136_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H85). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIGPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPT
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596107_HBc_P-C Product feature CHAIN AY596107_HBc_P-C of FT:mat_peptide AY596107_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596108_HBc_P-C Product feature CHAIN AY596108_HBc_P-C of FT:mat_peptide AY596108_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641558_HBc_P-C Product feature CHAIN AY641558_HBc_P-C of FT:mat_peptide AY641558_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He74). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDRLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641559_HBc_P-C Product feature CHAIN AY641559_HBc_P-C of FT:mat_peptide AY641559_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641560_HBc_P-C Product feature CHAIN AY641560_HBc_P-C of FT:mat_peptide AY641560_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He100). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641561_HBc_P-C Product feature CHAIN AY641561_HBc_P-C of FT:mat_peptide AY641561_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He127). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641562_HBc_P-C Product feature CHAIN AY641562_HBc_P-C of FT:mat_peptide AY641562_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641563_HBc_P-C Product feature CHAIN AY641563_HBc_P-C of FT:mat_peptide AY641563_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY862869_HBc_P-C Product feature CHAIN AY862869_HBc_P-C of FT:mat_peptide AY862869_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H8). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00630_HBc_P-C Product feature CHAIN D00630_HBc_P-C of FT:mat_peptide D00630_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSVGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|D12980_HBc_P-C Product feature CHAIN D12980_HBc_P-C of FT:mat_peptide D12980_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D23680_HBc_P-C Product feature CHAIN D23680_HBc_P-C of FT:mat_peptide D23680_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B4-HBVST1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D23681_HBc_P-C Product feature CHAIN D23681_HBc_P-C of FT:mat_peptide D23681_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C4-HBVST2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D23682_HBc_P-C Product feature CHAIN D23682_HBc_P-C of FT:mat_peptide D23682_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B5-HBVKO1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELVSFLPSDFFPSIRDLLDTAAALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLMFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D23683_HBc_P-C Product feature CHAIN D23683_HBc_P-C of FT:mat_peptide D23683_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C5-HBVKO2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELVSFLPSDFFPSIRDLLDTAAALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLMFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D23684_HBc_P-C Product feature CHAIN D23684_HBc_P-C of FT:mat_peptide D23684_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C6-TKB588). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D28880_HBc_P-C Product feature CHAIN D28880_HBc_P-C of FT:mat_peptide D28880_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Plasma 1992-085-9434). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|D50517_HBc_P-C Product feature CHAIN D50517_HBc_P-C of FT:mat_peptide D50517_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFMPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVPEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D50518_HBc_P-C Product feature CHAIN D50518_HBc_P-C of FT:mat_peptide D50518_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFMPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVPEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D50519_HBc_P-C Product feature CHAIN D50519_HBc_P-C of FT:mat_peptide D50519_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D50520_HBc_P-C Product feature CHAIN D50520_HBc_P-C of FT:mat_peptide D50520_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089756_HBc_P-C Product feature CHAIN DQ089756_HBc_P-C of FT:mat_peptide DQ089756_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK75). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQGILCWGELMNLATWVGGNLDDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089757_HBc_P-C Product feature CHAIN DQ089757_HBc_P-C of FT:mat_peptide DQ089757_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2342). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGXNLXDPA
SREXVVSYVNVNMGLKXRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ089758_HBc_P-C Product feature CHAIN DQ089758_HBc_P-C of FT:mat_peptide DQ089758_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1733). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089759_HBc_P-C Product feature CHAIN DQ089759_HBc_P-C of FT:mat_peptide DQ089759_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1512). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRXLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089760_HBc_P-C Product feature CHAIN DQ089760_HBc_P-C of FT:mat_peptide DQ089760_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK454). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNWEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089761_HBc_P-C Product feature CHAIN DQ089761_HBc_P-C of FT:mat_peptide DQ089761_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK515). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ089762_HBc_P-C Product feature CHAIN DQ089762_HBc_P-C of FT:mat_peptide DQ089762_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1644). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|DQ089763_HBc_P-C Product feature CHAIN DQ089763_HBc_P-C of FT:mat_peptide DQ089763_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1048). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089764_HBc_P-C Product feature CHAIN DQ089764_HBc_P-C of FT:mat_peptide DQ089764_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK967). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|DQ089765_HBc_P-C Product feature CHAIN DQ089765_HBc_P-C of FT:mat_peptide DQ089765_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK428). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089766_HBc_P-C Product feature CHAIN DQ089766_HBc_P-C of FT:mat_peptide DQ089766_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK553). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089767_HBc_P-C Product feature CHAIN DQ089767_HBc_P-C of FT:mat_peptide DQ089767_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1663). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAXVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089768_HBc_P-C Product feature CHAIN DQ089768_HBc_P-C of FT:mat_peptide DQ089768_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1814). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASSELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMNLATWVGSNLEDPG
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089769_HBc_P-C Product feature CHAIN DQ089769_HBc_P-C of FT:mat_peptide DQ089769_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK430). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089770_HBc_P-C Product feature CHAIN DQ089770_HBc_P-C of FT:mat_peptide DQ089770_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1272). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRARSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089771_HBc_P-C Product feature CHAIN DQ089771_HBc_P-C of FT:mat_peptide DQ089771_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1629). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ089772_HBc_P-C Product feature CHAIN DQ089772_HBc_P-C of FT:mat_peptide DQ089772_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK910). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSYHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089773_HBc_P-C Product feature CHAIN DQ089773_HBc_P-C of FT:mat_peptide DQ089773_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1193). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRHLLWFHISCLTFGRETVLEYLVSFGVWIPTPPAYRPPNAPILSTLPETTVXRRRGSSPRRRT
PSPRRRSSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089775_HBc_P-C Product feature CHAIN DQ089775_HBc_P-C of FT:mat_peptide DQ089775_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK290). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAIVCWGELMNLATWVGSNLDDPA
SREVVVNYVNVNMGLKIRQILWFHISCLTFGRQTVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089776_HBc_P-C Product feature CHAIN DQ089776_HBc_P-C of FT:mat_peptide DQ089776_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK884). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDQG
SRDLVVSYVNVNMGLKVRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089777_HBc_P-C Product feature CHAIN DQ089777_HBc_P-C of FT:mat_peptide DQ089777_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1159). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDQX
SRELVVSYVNVNMGLKVRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089778_HBc_P-C Product feature CHAIN DQ089778_HBc_P-C of FT:mat_peptide DQ089778_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1442). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089779_HBc_P-C Product feature CHAIN DQ089779_HBc_P-C of FT:mat_peptide DQ089779_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK554). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089780_HBc_P-C Product feature CHAIN DQ089780_HBc_P-C of FT:mat_peptide DQ089780_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK947). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|DQ089781_HBc_P-C Product feature CHAIN DQ089781_HBc_P-C of FT:mat_peptide DQ089781_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1476). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089782_HBc_P-C Product feature CHAIN DQ089782_HBc_P-C of FT:mat_peptide DQ089782_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2032). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFWPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089783_HBc_P-C Product feature CHAIN DQ089783_HBc_P-C of FT:mat_peptide DQ089783_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1402). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089784_HBc_P-C Product feature CHAIN DQ089784_HBc_P-C of FT:mat_peptide DQ089784_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1285). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTPPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089785_HBc_P-C Product feature CHAIN DQ089785_HBc_P-C of FT:mat_peptide DQ089785_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1386). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASQELISFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLDDPA
SRDAVVSYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|DQ089786_HBc_P-C Product feature CHAIN DQ089786_HBc_P-C of FT:mat_peptide DQ089786_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2074). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRPLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRQRGRSLRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089787_HBc_P-C Product feature CHAIN DQ089787_HBc_P-C of FT:mat_peptide DQ089787_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK352). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGEVMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089788_HBc_P-C Product feature CHAIN DQ089788_HBc_P-C of FT:mat_peptide DQ089788_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK820). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLETASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ089789_HBc_P-C Product feature CHAIN DQ089789_HBc_P-C of FT:mat_peptide DQ089789_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK926). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089790_HBc_P-C Product feature CHAIN DQ089790_HBc_P-C of FT:mat_peptide DQ089790_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1248). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNDNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRXPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089791_HBc_P-C Product feature CHAIN DQ089791_HBc_P-C of FT:mat_peptide DQ089791_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1205). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089792_HBc_P-C Product feature CHAIN DQ089792_HBc_P-C of FT:mat_peptide DQ089792_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK870). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNXNMGLKXRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089793_HBc_P-C Product feature CHAIN DQ089793_HBc_P-C of FT:mat_peptide DQ089793_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK343). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089794_HBc_P-C Product feature CHAIN DQ089794_HBc_P-C of FT:mat_peptide DQ089794_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1896). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|DQ089795_HBc_P-C Product feature CHAIN DQ089795_HBc_P-C of FT:mat_peptide DQ089795_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1465). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089796_HBc_P-C Product feature CHAIN DQ089796_HBc_P-C of FT:mat_peptide DQ089796_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK751). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089797_HBc_P-C Product feature CHAIN DQ089797_HBc_P-C of FT:mat_peptide DQ089797_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1169). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089799_HBc_P-C Product feature CHAIN DQ089799_HBc_P-C of FT:mat_peptide DQ089799_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK734). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089800_HBc_P-C Product feature CHAIN DQ089800_HBc_P-C of FT:mat_peptide DQ089800_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK741). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089801_HBc_P-C Product feature CHAIN DQ089801_HBc_P-C of FT:mat_peptide DQ089801_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2100). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089802_HBc_P-C Product feature CHAIN DQ089802_HBc_P-C of FT:mat_peptide DQ089802_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1371). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089803_HBc_P-C Product feature CHAIN DQ089803_HBc_P-C of FT:mat_peptide DQ089803_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK931). Complete genome. [Hepadnaviridae] (length=183 residues).
MDNDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089804_HBc_P-C Product feature CHAIN DQ089804_HBc_P-C of FT:mat_peptide DQ089804_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK262). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGCSAQLLSFLPSDFFPSIRDLLDTATALYGEALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144553_HBc_P-C Product feature CHAIN DQ144553_HBc_P-C of FT:mat_peptide DQ144553_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cq2-A2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144603_HBc_P-C Product feature CHAIN DQ144603_HBc_P-C of FT:mat_peptide DQ144603_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cq5-14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144604_HBc_P-C Product feature CHAIN DQ144604_HBc_P-C of FT:mat_peptide DQ144604_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cq5-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ246215_HBc_P-C Product feature CHAIN DQ246215_HBc_P-C of FT:mat_peptide DQ246215_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315781_HBc_P-C Product feature CHAIN DQ315781_HBc_P-C of FT:mat_peptide DQ315781_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0398). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315782_HBc_P-C Product feature CHAIN DQ315782_HBc_P-C of FT:mat_peptide DQ315782_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0423). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315783_HBc_P-C Product feature CHAIN DQ315783_HBc_P-C of FT:mat_peptide DQ315783_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI03188). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ361526_HBc_P-C Product feature CHAIN DQ361526_HBc_P-C of FT:mat_peptide DQ361526_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NK-586). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETGVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ361534_HBc_P-C Product feature CHAIN DQ361534_HBc_P-C of FT:mat_peptide DQ361534_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CR-081). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ377160_HBc_P-C Product feature CHAIN DQ377160_HBc_P-C of FT:mat_peptide DQ377160_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT16). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFLSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377161_HBc_P-C Product feature CHAIN DQ377161_HBc_P-C of FT:mat_peptide DQ377161_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377162_HBc_P-C Product feature CHAIN DQ377162_HBc_P-C of FT:mat_peptide DQ377162_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|DQ377163_HBc_P-C Product feature CHAIN DQ377163_HBc_P-C of FT:mat_peptide DQ377163_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377164_HBc_P-C Product feature CHAIN DQ377164_HBc_P-C of FT:mat_peptide DQ377164_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377165_HBc_P-C Product feature CHAIN DQ377165_HBc_P-C of FT:mat_peptide DQ377165_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ478885_HBc_P-C Product feature CHAIN DQ478885_HBc_P-C of FT:mat_peptide DQ478885_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|DQ478899_HBc_P-C Product feature CHAIN DQ478899_HBc_P-C of FT:mat_peptide DQ478899_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRPQSPRRRRSQSRESQC
>gnl|hbvpro|DQ478900_HBc_P-C Product feature CHAIN DQ478900_HBc_P-C of FT:mat_peptide DQ478900_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H172). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|DQ478901_HBc_P-C Product feature CHAIN DQ478901_HBc_P-C of FT:mat_peptide DQ478901_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H155). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ536410_HBc_P-C Product feature CHAIN DQ536410_HBc_P-C of FT:mat_peptide DQ536410_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFRISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ536411_HBc_P-C Product feature CHAIN DQ536411_HBc_P-C of FT:mat_peptide DQ536411_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|DQ536413_HBc_P-C Product feature CHAIN DQ536413_HBc_P-C of FT:mat_peptide DQ536413_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|DQ536414_HBc_P-C Product feature CHAIN DQ536414_HBc_P-C of FT:mat_peptide DQ536414_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|DQ683578_HBc_P-C Product feature CHAIN DQ683578_HBc_P-C of FT:mat_peptide DQ683578_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ890381_HBc_P-C Product feature CHAIN DQ890381_HBc_P-C of FT:mat_peptide DQ890381_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRCRQQGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ922649_HBc_P-C Product feature CHAIN DQ922649_HBc_P-C of FT:mat_peptide DQ922649_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRGRT
PSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|DQ922650_HBc_P-C Product feature CHAIN DQ922650_HBc_P-C of FT:mat_peptide DQ922650_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ922651_HBc_P-C Product feature CHAIN DQ922651_HBc_P-C of FT:mat_peptide DQ922651_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSQHHATLRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVCIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ975272_HBc_P-C Product feature CHAIN DQ975272_HBc_P-C of FT:mat_peptide DQ975272_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVDVNMGLKLRQLQWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ975273_HBc_P-C Product feature CHAIN DQ975273_HBc_P-C of FT:mat_peptide DQ975273_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ975274_HBc_P-C Product feature CHAIN DQ975274_HBc_P-C of FT:mat_peptide DQ975274_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGPKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTLLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ980549_HBc_P-C Product feature CHAIN DQ980549_HBc_P-C of FT:mat_peptide DQ980549_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYREALESPEHCSPHHTALRQAILCWAEVTNLATWVGSNLEDLA
SRELVVNYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ980550_HBc_P-C Product feature CHAIN DQ980550_HBc_P-C of FT:mat_peptide DQ980550_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ980551_HBc_P-C Product feature CHAIN DQ980551_HBc_P-C of FT:mat_peptide DQ980551_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWLRTPPAYRPPNAPILSTLPETAVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ986376_HBc_P-C Product feature CHAIN DQ986376_HBc_P-C of FT:mat_peptide DQ986376_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ993690_HBc_P-C Product feature CHAIN DQ993690_HBc_P-C of FT:mat_peptide DQ993690_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 204-1113-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993691_HBc_P-C Product feature CHAIN DQ993691_HBc_P-C of FT:mat_peptide DQ993691_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0803-Nature2.2-unSero). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993692_HBc_P-C Product feature CHAIN DQ993692_HBc_P-C of FT:mat_peptide DQ993692_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0810-Nature2.1-unSero). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993693_HBc_P-C Product feature CHAIN DQ993693_HBc_P-C of FT:mat_peptide DQ993693_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 232-1125-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF137802_HBc_P-C Product feature CHAIN EF137802_HBc_P-C of FT:mat_peptide EF137802_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF137803_HBc_P-C Product feature CHAIN EF137803_HBc_P-C of FT:mat_peptide EF137803_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRSRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EF197911_HBc_P-C Product feature CHAIN EF197911_HBc_P-C of FT:mat_peptide EF197911_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|EF384201_HBc_P-C Product feature CHAIN EF384201_HBc_P-C of FT:mat_peptide EF384201_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-02). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPSYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494377_HBc_P-C Product feature CHAIN EF494377_HBc_P-C of FT:mat_peptide EF494377_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW1138). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAFRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EF494379_HBc_P-C Product feature CHAIN EF494379_HBc_P-C of FT:mat_peptide EF494379_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW8585). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF536065_HBc_P-C Product feature CHAIN EF536065_HBc_P-C of FT:mat_peptide EF536065_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF536066_HBc_P-C Product feature CHAIN EF536066_HBc_P-C of FT:mat_peptide EF536066_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF688062_HBc_P-C Product feature CHAIN EF688062_HBc_P-C of FT:mat_peptide EF688062_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ28-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305540_HBc_P-C Product feature CHAIN EU305540_HBc_P-C of FT:mat_peptide EU305540_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-123). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305541_HBc_P-C Product feature CHAIN EU305541_HBc_P-C of FT:mat_peptide EU305541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-190). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305542_HBc_P-C Product feature CHAIN EU305542_HBc_P-C of FT:mat_peptide EU305542_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-1251). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306673_HBc_P-C Product feature CHAIN EU306673_HBc_P-C of FT:mat_peptide EU306673_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306685_HBc_P-C Product feature CHAIN EU306685_HBc_P-C of FT:mat_peptide EU306685_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306687_HBc_P-C Product feature CHAIN EU306687_HBc_P-C of FT:mat_peptide EU306687_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEPPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306688_HBc_P-C Product feature CHAIN EU306688_HBc_P-C of FT:mat_peptide EU306688_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306689_HBc_P-C Product feature CHAIN EU306689_HBc_P-C of FT:mat_peptide EU306689_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306690_HBc_P-C Product feature CHAIN EU306690_HBc_P-C of FT:mat_peptide EU306690_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306691_HBc_P-C Product feature CHAIN EU306691_HBc_P-C of FT:mat_peptide EU306691_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306694_HBc_P-C Product feature CHAIN EU306694_HBc_P-C of FT:mat_peptide EU306694_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306713_HBc_P-C Product feature CHAIN EU306713_HBc_P-C of FT:mat_peptide EU306713_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306714_HBc_P-C Product feature CHAIN EU306714_HBc_P-C of FT:mat_peptide EU306714_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306719_HBc_P-C Product feature CHAIN EU306719_HBc_P-C of FT:mat_peptide EU306719_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSALPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306720_HBc_P-C Product feature CHAIN EU306720_HBc_P-C of FT:mat_peptide EU306720_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306721_HBc_P-C Product feature CHAIN EU306721_HBc_P-C of FT:mat_peptide EU306721_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306722_HBc_P-C Product feature CHAIN EU306722_HBc_P-C of FT:mat_peptide EU306722_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SMELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306725_HBc_P-C Product feature CHAIN EU306725_HBc_P-C of FT:mat_peptide EU306725_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU306727_HBc_P-C Product feature CHAIN EU306727_HBc_P-C of FT:mat_peptide EU306727_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306729_HBc_P-C Product feature CHAIN EU306729_HBc_P-C of FT:mat_peptide EU306729_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU410079_HBc_P-C Product feature CHAIN EU410079_HBc_P-C of FT:mat_peptide EU410079_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKXRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU410080_HBc_P-C Product feature CHAIN EU410080_HBc_P-C of FT:mat_peptide EU410080_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU410081_HBc_P-C Product feature CHAIN EU410081_HBc_P-C of FT:mat_peptide EU410081_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph80). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439005_HBc_P-C Product feature CHAIN EU439005_HBc_P-C of FT:mat_peptide EU439005_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439013_HBc_P-C Product feature CHAIN EU439013_HBc_P-C of FT:mat_peptide EU439013_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLETASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLKYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|EU439015_HBc_P-C Product feature CHAIN EU439015_HBc_P-C of FT:mat_peptide EU439015_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU498227_HBc_P-C Product feature CHAIN EU498227_HBc_P-C of FT:mat_peptide EU498227_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JL). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVTYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU522068_HBc_P-C Product feature CHAIN EU522068_HBc_P-C of FT:mat_peptide EU522068_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU522069_HBc_P-C Product feature CHAIN EU522069_HBc_P-C of FT:mat_peptide EU522069_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5T). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLTFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU522071_HBc_P-C Product feature CHAIN EU522071_HBc_P-C of FT:mat_peptide EU522071_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 7T). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU547559_HBc_P-C Product feature CHAIN EU547559_HBc_P-C of FT:mat_peptide EU547559_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC02). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASPKLLSFLPSDFFPSIHDLLYTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDXA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU547562_HBc_P-C Product feature CHAIN EU547562_HBc_P-C of FT:mat_peptide EU547562_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC05). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGGNLQDPT
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRARCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|EU554535_HBc_P-C Product feature CHAIN EU554535_HBc_P-C of FT:mat_peptide EU554535_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554536_HBc_P-C Product feature CHAIN EU554536_HBc_P-C of FT:mat_peptide EU554536_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRHAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554537_HBc_P-C Product feature CHAIN EU554537_HBc_P-C of FT:mat_peptide EU554537_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554538_HBc_P-C Product feature CHAIN EU554538_HBc_P-C of FT:mat_peptide EU554538_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554539_HBc_P-C Product feature CHAIN EU554539_HBc_P-C of FT:mat_peptide EU554539_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554540_HBc_P-C Product feature CHAIN EU554540_HBc_P-C of FT:mat_peptide EU554540_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S304-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTGSALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU554541_HBc_P-C Product feature CHAIN EU554541_HBc_P-C of FT:mat_peptide EU554541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEYCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554542_HBc_P-C Product feature CHAIN EU554542_HBc_P-C of FT:mat_peptide EU554542_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU560438_HBc_P-C Product feature CHAIN EU560438_HBc_P-C of FT:mat_peptide EU560438_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2-B74). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWVRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU560439_HBc_P-C Product feature CHAIN EU560439_HBc_P-C of FT:mat_peptide EU560439_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-B74). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU560440_HBc_P-C Product feature CHAIN EU560440_HBc_P-C of FT:mat_peptide EU560440_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-S869). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU560441_HBc_P-C Product feature CHAIN EU560441_HBc_P-C of FT:mat_peptide EU560441_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4-S869). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562215_HBc_P-C Product feature CHAIN EU562215_HBc_P-C of FT:mat_peptide EU562215_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562216_HBc_P-C Product feature CHAIN EU562216_HBc_P-C of FT:mat_peptide EU562216_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562217_HBc_P-C Product feature CHAIN EU562217_HBc_P-C of FT:mat_peptide EU562217_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562218_HBc_P-C Product feature CHAIN EU562218_HBc_P-C of FT:mat_peptide EU562218_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570067_HBc_P-C Product feature CHAIN EU570067_HBc_P-C of FT:mat_peptide EU570067_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18-S541). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILLTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570068_HBc_P-C Product feature CHAIN EU570068_HBc_P-C of FT:mat_peptide EU570068_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26-S541). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570072_HBc_P-C Product feature CHAIN EU570072_HBc_P-C of FT:mat_peptide EU570072_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-B74). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQCW
>gnl|hbvpro|EU570073_HBc_P-C Product feature CHAIN EU570073_HBc_P-C of FT:mat_peptide EU570073_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8-S698). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRDSQC
>gnl|hbvpro|EU570074_HBc_P-C Product feature CHAIN EU570074_HBc_P-C of FT:mat_peptide EU570074_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11-S698). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRDSQC
>gnl|hbvpro|EU579442_HBc_P-C Product feature CHAIN EU579442_HBc_P-C of FT:mat_peptide EU579442_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU579443_HBc_P-C Product feature CHAIN EU579443_HBc_P-C of FT:mat_peptide EU579443_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDSA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589336_HBc_P-C Product feature CHAIN EU589336_HBc_P-C of FT:mat_peptide EU589336_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1175-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDSA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRTPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589340_HBc_P-C Product feature CHAIN EU589340_HBc_P-C of FT:mat_peptide EU589340_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589341_HBc_P-C Product feature CHAIN EU589341_HBc_P-C of FT:mat_peptide EU589341_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589342_HBc_P-C Product feature CHAIN EU589342_HBc_P-C of FT:mat_peptide EU589342_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-13). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589345_HBc_P-C Product feature CHAIN EU589345_HBc_P-C of FT:mat_peptide EU589345_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S624-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU670263_HBc_P-C Product feature CHAIN EU670263_HBc_P-C of FT:mat_peptide EU670263_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU717212_HBc_P-C Product feature CHAIN EU717212_HBc_P-C of FT:mat_peptide EU717212_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D26K-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPNAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU717214_HBc_P-C Product feature CHAIN EU717214_HBc_P-C of FT:mat_peptide EU717214_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G62K-8). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASRELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLNFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRGSQSPRRRRSQSRQSQC
>gnl|hbvpro|EU717215_HBc_P-C Product feature CHAIN EU717215_HBc_P-C of FT:mat_peptide EU717215_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q67K-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU717217_HBc_P-C Product feature CHAIN EU717217_HBc_P-C of FT:mat_peptide EU717217_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q53K-4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796069_HBc_P-C Product feature CHAIN EU796069_HBc_P-C of FT:mat_peptide EU796069_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU796070_HBc_P-C Product feature CHAIN EU796070_HBc_P-C of FT:mat_peptide EU796070_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796072_HBc_P-C Product feature CHAIN EU796072_HBc_P-C of FT:mat_peptide EU796072_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871969_HBc_P-C Product feature CHAIN EU871969_HBc_P-C of FT:mat_peptide EU871969_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871970_HBc_P-C Product feature CHAIN EU871970_HBc_P-C of FT:mat_peptide EU871970_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU871971_HBc_P-C Product feature CHAIN EU871971_HBc_P-C of FT:mat_peptide EU871971_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871972_HBc_P-C Product feature CHAIN EU871972_HBc_P-C of FT:mat_peptide EU871972_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU871973_HBc_P-C Product feature CHAIN EU871973_HBc_P-C of FT:mat_peptide EU871973_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-99-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU871974_HBc_P-C Product feature CHAIN EU871974_HBc_P-C of FT:mat_peptide EU871974_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871975_HBc_P-C Product feature CHAIN EU871975_HBc_P-C of FT:mat_peptide EU871975_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871976_HBc_P-C Product feature CHAIN EU871976_HBc_P-C of FT:mat_peptide EU871976_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-04-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871977_HBc_P-C Product feature CHAIN EU871977_HBc_P-C of FT:mat_peptide EU871977_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871980_HBc_P-C Product feature CHAIN EU871980_HBc_P-C of FT:mat_peptide EU871980_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-01-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871982_HBc_P-C Product feature CHAIN EU871982_HBc_P-C of FT:mat_peptide EU871982_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-96-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871998_HBc_P-C Product feature CHAIN EU871998_HBc_P-C of FT:mat_peptide EU871998_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-00-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU872000_HBc_P-C Product feature CHAIN EU872000_HBc_P-C of FT:mat_peptide EU872000_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCTHHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVGCVNVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU872001_HBc_P-C Product feature CHAIN EU872001_HBc_P-C of FT:mat_peptide EU872001_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCTAHHTALRQAILCWGELMNLATWVGSNLDDPG
SRDLVVSYVNVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU872002_HBc_P-C Product feature CHAIN EU872002_HBc_P-C of FT:mat_peptide EU872002_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCTHHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVGYVNVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU872003_HBc_P-C Product feature CHAIN EU872003_HBc_P-C of FT:mat_peptide EU872003_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCTAHHTALRQAILCWGELMNLATWVGSNLDDPG
SRDLVVSYVNVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU872004_HBc_P-C Product feature CHAIN EU872004_HBc_P-C of FT:mat_peptide EU872004_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCTHHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVGYANVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU872005_HBc_P-C Product feature CHAIN EU872005_HBc_P-C of FT:mat_peptide EU872005_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-96-1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASRELLSFLPSDFFPPVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLNFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|EU872008_HBc_P-C Product feature CHAIN EU872008_HBc_P-C of FT:mat_peptide EU872008_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252A-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU872010_HBc_P-C Product feature CHAIN EU872010_HBc_P-C of FT:mat_peptide EU872010_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-92-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU872013_HBc_P-C Product feature CHAIN EU872013_HBc_P-C of FT:mat_peptide EU872013_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-6). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPADFFPSIRDLLDTASALYRETLESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU881996_HBc_P-C Product feature CHAIN EU881996_HBc_P-C of FT:mat_peptide EU881996_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916210_HBc_P-C Product feature CHAIN EU916210_HBc_P-C of FT:mat_peptide EU916210_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2.4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVVLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916211_HBc_P-C Product feature CHAIN EU916211_HBc_P-C of FT:mat_peptide EU916211_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQW
>gnl|hbvpro|EU916212_HBc_P-C Product feature CHAIN EU916212_HBc_P-C of FT:mat_peptide EU916212_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGGETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916213_HBc_P-C Product feature CHAIN EU916213_HBc_P-C of FT:mat_peptide EU916213_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQW
>gnl|hbvpro|EU916214_HBc_P-C Product feature CHAIN EU916214_HBc_P-C of FT:mat_peptide EU916214_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.4). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRW
>gnl|hbvpro|EU916215_HBc_P-C Product feature CHAIN EU916215_HBc_P-C of FT:mat_peptide EU916215_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916216_HBc_P-C Product feature CHAIN EU916216_HBc_P-C of FT:mat_peptide EU916216_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916217_HBc_P-C Product feature CHAIN EU916217_HBc_P-C of FT:mat_peptide EU916217_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916218_HBc_P-C Product feature CHAIN EU916218_HBc_P-C of FT:mat_peptide EU916218_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916223_HBc_P-C Product feature CHAIN EU916223_HBc_P-C of FT:mat_peptide EU916223_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916224_HBc_P-C Product feature CHAIN EU916224_HBc_P-C of FT:mat_peptide EU916224_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916225_HBc_P-C Product feature CHAIN EU916225_HBc_P-C of FT:mat_peptide EU916225_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916226_HBc_P-C Product feature CHAIN EU916226_HBc_P-C of FT:mat_peptide EU916226_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDIYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQVILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916227_HBc_P-C Product feature CHAIN EU916227_HBc_P-C of FT:mat_peptide EU916227_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASAPYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PPPRRRWSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916229_HBc_P-C Product feature CHAIN EU916229_HBc_P-C of FT:mat_peptide EU916229_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916233_HBc_P-C Product feature CHAIN EU916233_HBc_P-C of FT:mat_peptide EU916233_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRPQSRESQC
>gnl|hbvpro|EU916234_HBc_P-C Product feature CHAIN EU916234_HBc_P-C of FT:mat_peptide EU916234_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916237_HBc_P-C Product feature CHAIN EU916237_HBc_P-C of FT:mat_peptide EU916237_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916238_HBc_P-C Product feature CHAIN EU916238_HBc_P-C of FT:mat_peptide EU916238_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQF
>gnl|hbvpro|EU919165_HBc_P-C Product feature CHAIN EU919165_HBc_P-C of FT:mat_peptide EU919165_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient24). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU919168_HBc_P-C Product feature CHAIN EU919168_HBc_P-C of FT:mat_peptide EU919168_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU919169_HBc_P-C Product feature CHAIN EU919169_HBc_P-C of FT:mat_peptide EU919169_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRESVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939536_HBc_P-C Product feature CHAIN EU939536_HBc_P-C of FT:mat_peptide EU939536_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939537_HBc_P-C Product feature CHAIN EU939537_HBc_P-C of FT:mat_peptide EU939537_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939538_HBc_P-C Product feature CHAIN EU939538_HBc_P-C of FT:mat_peptide EU939538_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRXLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939539_HBc_P-C Product feature CHAIN EU939539_HBc_P-C of FT:mat_peptide EU939539_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFFPSARDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEEQA
SRDLVVSYVNVNMGIKMRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|EU939540_HBc_P-C Product feature CHAIN EU939540_HBc_P-C of FT:mat_peptide EU939540_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939541_HBc_P-C Product feature CHAIN EU939541_HBc_P-C of FT:mat_peptide EU939541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLENPA
SRELVVSYVNVNMGLKIKQLLWFHISCLTFGKKTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRQGRSPKKKT
PSPRKQRSQSPRRKKSQSRESQC
>gnl|hbvpro|EU939542_HBc_P-C Product feature CHAIN EU939542_HBc_P-C of FT:mat_peptide EU939542_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRESVVGYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRQRGRPTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939543_HBc_P-C Product feature CHAIN EU939543_HBc_P-C of FT:mat_peptide EU939543_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939544_HBc_P-C Product feature CHAIN EU939544_HBc_P-C of FT:mat_peptide EU939544_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPT
SREAVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939545_HBc_P-C Product feature CHAIN EU939545_HBc_P-C of FT:mat_peptide EU939545_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939546_HBc_P-C Product feature CHAIN EU939546_HBc_P-C of FT:mat_peptide EU939546_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU939548_HBc_P-C Product feature CHAIN EU939548_HBc_P-C of FT:mat_peptide EU939548_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C46). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVGYVNTNMGLKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPTAYRPVNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939549_HBc_P-C Product feature CHAIN EU939549_HBc_P-C of FT:mat_peptide EU939549_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C49). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939550_HBc_P-C Product feature CHAIN EU939550_HBc_P-C of FT:mat_peptide EU939550_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C55). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939552_HBc_P-C Product feature CHAIN EU939552_HBc_P-C of FT:mat_peptide EU939552_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIKQLLWFHISCLTFGKETVLEYLVSFGVWIPTPPAYRPPNAPILSTLPETTVVKQPGRSPRKRT
PSPRKRRSQSPRRKRSQSRESQC
>gnl|hbvpro|EU939553_HBc_P-C Product feature CHAIN EU939553_HBc_P-C of FT:mat_peptide EU939553_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C60). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939554_HBc_P-C Product feature CHAIN EU939554_HBc_P-C of FT:mat_peptide EU939554_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C61). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939556_HBc_P-C Product feature CHAIN EU939556_HBc_P-C of FT:mat_peptide EU939556_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU939557_HBc_P-C Product feature CHAIN EU939557_HBc_P-C of FT:mat_peptide EU939557_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C65). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939558_HBc_P-C Product feature CHAIN EU939558_HBc_P-C of FT:mat_peptide EU939558_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C66). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|EU939560_HBc_P-C Product feature CHAIN EU939560_HBc_P-C of FT:mat_peptide EU939560_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C69). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939561_HBc_P-C Product feature CHAIN EU939561_HBc_P-C of FT:mat_peptide EU939561_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C70). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939562_HBc_P-C Product feature CHAIN EU939562_HBc_P-C of FT:mat_peptide EU939562_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C75). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHCY
>gnl|hbvpro|EU939563_HBc_P-C Product feature CHAIN EU939563_HBc_P-C of FT:mat_peptide EU939563_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939564_HBc_P-C Product feature CHAIN EU939564_HBc_P-C of FT:mat_peptide EU939564_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C77). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939567_HBc_P-C Product feature CHAIN EU939567_HBc_P-C of FT:mat_peptide EU939567_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C91). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQANLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939568_HBc_P-C Product feature CHAIN EU939568_HBc_P-C of FT:mat_peptide EU939568_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C93). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASGELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939569_HBc_P-C Product feature CHAIN EU939569_HBc_P-C of FT:mat_peptide EU939569_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C102). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU939570_HBc_P-C Product feature CHAIN EU939570_HBc_P-C of FT:mat_peptide EU939570_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C103). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939571_HBc_P-C Product feature CHAIN EU939571_HBc_P-C of FT:mat_peptide EU939571_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C104). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|EU939572_HBc_P-C Product feature CHAIN EU939572_HBc_P-C of FT:mat_peptide EU939572_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939573_HBc_P-C Product feature CHAIN EU939573_HBc_P-C of FT:mat_peptide EU939573_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939574_HBc_P-C Product feature CHAIN EU939574_HBc_P-C of FT:mat_peptide EU939574_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939576_HBc_P-C Product feature CHAIN EU939576_HBc_P-C of FT:mat_peptide EU939576_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C115). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939578_HBc_P-C Product feature CHAIN EU939578_HBc_P-C of FT:mat_peptide EU939578_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C119). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939579_HBc_P-C Product feature CHAIN EU939579_HBc_P-C of FT:mat_peptide EU939579_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEAPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939580_HBc_P-C Product feature CHAIN EU939580_HBc_P-C of FT:mat_peptide EU939580_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939582_HBc_P-C Product feature CHAIN EU939582_HBc_P-C of FT:mat_peptide EU939582_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939583_HBc_P-C Product feature CHAIN EU939583_HBc_P-C of FT:mat_peptide EU939583_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B31). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRCRGRSARRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939584_HBc_P-C Product feature CHAIN EU939584_HBc_P-C of FT:mat_peptide EU939584_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B107). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939585_HBc_P-C Product feature CHAIN EU939585_HBc_P-C of FT:mat_peptide EU939585_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B126). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU939586_HBc_P-C Product feature CHAIN EU939586_HBc_P-C of FT:mat_peptide EU939586_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B142). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAFLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPHRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939587_HBc_P-C Product feature CHAIN EU939587_HBc_P-C of FT:mat_peptide EU939587_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAFALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939588_HBc_P-C Product feature CHAIN EU939588_HBc_P-C of FT:mat_peptide EU939588_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939590_HBc_P-C Product feature CHAIN EU939590_HBc_P-C of FT:mat_peptide EU939590_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939591_HBc_P-C Product feature CHAIN EU939591_HBc_P-C of FT:mat_peptide EU939591_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C131). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939592_HBc_P-C Product feature CHAIN EU939592_HBc_P-C of FT:mat_peptide EU939592_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C141). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939593_HBc_P-C Product feature CHAIN EU939593_HBc_P-C of FT:mat_peptide EU939593_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939594_HBc_P-C Product feature CHAIN EU939594_HBc_P-C of FT:mat_peptide EU939594_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C146). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939595_HBc_P-C Product feature CHAIN EU939595_HBc_P-C of FT:mat_peptide EU939595_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C147). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939596_HBc_P-C Product feature CHAIN EU939596_HBc_P-C of FT:mat_peptide EU939596_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C149). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|EU939597_HBc_P-C Product feature CHAIN EU939597_HBc_P-C of FT:mat_peptide EU939597_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C151). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939599_HBc_P-C Product feature CHAIN EU939599_HBc_P-C of FT:mat_peptide EU939599_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C172). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVEVTNLATWVGSNLEDPA
SRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRIRRSQSPRRTRSQSRESKC
>gnl|hbvpro|EU939600_HBc_P-C Product feature CHAIN EU939600_HBc_P-C of FT:mat_peptide EU939600_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C176). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939601_HBc_P-C Product feature CHAIN EU939601_HBc_P-C of FT:mat_peptide EU939601_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C177). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESQEHWSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU939603_HBc_P-C Product feature CHAIN EU939603_HBc_P-C of FT:mat_peptide EU939603_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C183). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPQNAPILSTLPETTVVRQRGRSIRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939604_HBc_P-C Product feature CHAIN EU939604_HBc_P-C of FT:mat_peptide EU939604_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C192). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939605_HBc_P-C Product feature CHAIN EU939605_HBc_P-C of FT:mat_peptide EU939605_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C200). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSILPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|EU939607_HBc_P-C Product feature CHAIN EU939607_HBc_P-C of FT:mat_peptide EU939607_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939609_HBc_P-C Product feature CHAIN EU939609_HBc_P-C of FT:mat_peptide EU939609_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C209). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939610_HBc_P-C Product feature CHAIN EU939610_HBc_P-C of FT:mat_peptide EU939610_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C211). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939611_HBc_P-C Product feature CHAIN EU939611_HBc_P-C of FT:mat_peptide EU939611_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C212). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939612_HBc_P-C Product feature CHAIN EU939612_HBc_P-C of FT:mat_peptide EU939612_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C213). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939613_HBc_P-C Product feature CHAIN EU939613_HBc_P-C of FT:mat_peptide EU939613_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C214). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939614_HBc_P-C Product feature CHAIN EU939614_HBc_P-C of FT:mat_peptide EU939614_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C217). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939615_HBc_P-C Product feature CHAIN EU939615_HBc_P-C of FT:mat_peptide EU939615_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939617_HBc_P-C Product feature CHAIN EU939617_HBc_P-C of FT:mat_peptide EU939617_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C229). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIRQRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939618_HBc_P-C Product feature CHAIN EU939618_HBc_P-C of FT:mat_peptide EU939618_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C230). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939619_HBc_P-C Product feature CHAIN EU939619_HBc_P-C of FT:mat_peptide EU939619_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C233). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939625_HBc_P-C Product feature CHAIN EU939625_HBc_P-C of FT:mat_peptide EU939625_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C167). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|EU939626_HBc_P-C Product feature CHAIN EU939626_HBc_P-C of FT:mat_peptide EU939626_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D158). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939640_HBc_P-C Product feature CHAIN EU939640_HBc_P-C of FT:mat_peptide EU939640_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C239). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939641_HBc_P-C Product feature CHAIN EU939641_HBc_P-C of FT:mat_peptide EU939641_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D18). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALHREALESPEXCTPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939642_HBc_P-C Product feature CHAIN EU939642_HBc_P-C of FT:mat_peptide EU939642_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D20). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPLDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939643_HBc_P-C Product feature CHAIN EU939643_HBc_P-C of FT:mat_peptide EU939643_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D32). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939644_HBc_P-C Product feature CHAIN EU939644_HBc_P-C of FT:mat_peptide EU939644_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939647_HBc_P-C Product feature CHAIN EU939647_HBc_P-C of FT:mat_peptide EU939647_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D90). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939648_HBc_P-C Product feature CHAIN EU939648_HBc_P-C of FT:mat_peptide EU939648_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D96). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU939651_HBc_P-C Product feature CHAIN EU939651_HBc_P-C of FT:mat_peptide EU939651_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D104). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVTYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939652_HBc_P-C Product feature CHAIN EU939652_HBc_P-C of FT:mat_peptide EU939652_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D107). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939653_HBc_P-C Product feature CHAIN EU939653_HBc_P-C of FT:mat_peptide EU939653_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELISFLPNDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939655_HBc_P-C Product feature CHAIN EU939655_HBc_P-C of FT:mat_peptide EU939655_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQATLCWVELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939656_HBc_P-C Product feature CHAIN EU939656_HBc_P-C of FT:mat_peptide EU939656_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D117). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQATLCWVELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939657_HBc_P-C Product feature CHAIN EU939657_HBc_P-C of FT:mat_peptide EU939657_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D139). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMNLATWVGGNLDDPA
SREAVVNYVNVNMGLKLRQILWFHISCLTFGRTTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939658_HBc_P-C Product feature CHAIN EU939658_HBc_P-C of FT:mat_peptide EU939658_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D142). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALETPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRPGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939659_HBc_P-C Product feature CHAIN EU939659_HBc_P-C of FT:mat_peptide EU939659_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ023566_HBc_P-C Product feature CHAIN FJ023566_HBc_P-C of FT:mat_peptide FJ023566_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0026). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNTPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023567_HBc_P-C Product feature CHAIN FJ023567_HBc_P-C of FT:mat_peptide FJ023567_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0026). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023568_HBc_P-C Product feature CHAIN FJ023568_HBc_P-C of FT:mat_peptide FJ023568_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0026). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023571_HBc_P-C Product feature CHAIN FJ023571_HBc_P-C of FT:mat_peptide FJ023571_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0197). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023587_HBc_P-C Product feature CHAIN FJ023587_HBc_P-C of FT:mat_peptide FJ023587_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023589_HBc_P-C Product feature CHAIN FJ023589_HBc_P-C of FT:mat_peptide FJ023589_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023590_HBc_P-C Product feature CHAIN FJ023590_HBc_P-C of FT:mat_peptide FJ023590_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023591_HBc_P-C Product feature CHAIN FJ023591_HBc_P-C of FT:mat_peptide FJ023591_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023624_HBc_P-C Product feature CHAIN FJ023624_HBc_P-C of FT:mat_peptide FJ023624_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3733). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSFEDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023625_HBc_P-C Product feature CHAIN FJ023625_HBc_P-C of FT:mat_peptide FJ023625_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3733). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILPTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023639_HBc_P-C Product feature CHAIN FJ023639_HBc_P-C of FT:mat_peptide FJ023639_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-0968). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023640_HBc_P-C Product feature CHAIN FJ023640_HBc_P-C of FT:mat_peptide FJ023640_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1206). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYGPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023641_HBc_P-C Product feature CHAIN FJ023641_HBc_P-C of FT:mat_peptide FJ023641_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1237). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023642_HBc_P-C Product feature CHAIN FJ023642_HBc_P-C of FT:mat_peptide FJ023642_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1257). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023643_HBc_P-C Product feature CHAIN FJ023643_HBc_P-C of FT:mat_peptide FJ023643_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1306). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023644_HBc_P-C Product feature CHAIN FJ023644_HBc_P-C of FT:mat_peptide FJ023644_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1318). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023645_HBc_P-C Product feature CHAIN FJ023645_HBc_P-C of FT:mat_peptide FJ023645_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0071). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023646_HBc_P-C Product feature CHAIN FJ023646_HBc_P-C of FT:mat_peptide FJ023646_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0201). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023647_HBc_P-C Product feature CHAIN FJ023647_HBc_P-C of FT:mat_peptide FJ023647_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0214). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023648_HBc_P-C Product feature CHAIN FJ023648_HBc_P-C of FT:mat_peptide FJ023648_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0273). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023649_HBc_P-C Product feature CHAIN FJ023649_HBc_P-C of FT:mat_peptide FJ023649_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0289). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023650_HBc_P-C Product feature CHAIN FJ023650_HBc_P-C of FT:mat_peptide FJ023650_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0341). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023651_HBc_P-C Product feature CHAIN FJ023651_HBc_P-C of FT:mat_peptide FJ023651_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0391). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALFREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHVSCLMFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023652_HBc_P-C Product feature CHAIN FJ023652_HBc_P-C of FT:mat_peptide FJ023652_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0648). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVRPRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023653_HBc_P-C Product feature CHAIN FJ023653_HBc_P-C of FT:mat_peptide FJ023653_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0909). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023654_HBc_P-C Product feature CHAIN FJ023654_HBc_P-C of FT:mat_peptide FJ023654_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1412). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023655_HBc_P-C Product feature CHAIN FJ023655_HBc_P-C of FT:mat_peptide FJ023655_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0754). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SREVVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023656_HBc_P-C Product feature CHAIN FJ023656_HBc_P-C of FT:mat_peptide FJ023656_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0938). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023657_HBc_P-C Product feature CHAIN FJ023657_HBc_P-C of FT:mat_peptide FJ023657_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0987). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023658_HBc_P-C Product feature CHAIN FJ023658_HBc_P-C of FT:mat_peptide FJ023658_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-1116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023677_HBc_P-C Product feature CHAIN FJ023677_HBc_P-C of FT:mat_peptide FJ023677_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1/I2_M04-0309). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLASWVGGNLEDPA
SRDLVVNYVNVNMGLKLKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSHRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032331_HBc_P-C Product feature CHAIN FJ032331_HBc_P-C of FT:mat_peptide FJ032331_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S193-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032332_HBc_P-C Product feature CHAIN FJ032332_HBc_P-C of FT:mat_peptide FJ032332_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-10). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032333_HBc_P-C Product feature CHAIN FJ032333_HBc_P-C of FT:mat_peptide FJ032333_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032334_HBc_P-C Product feature CHAIN FJ032334_HBc_P-C of FT:mat_peptide FJ032334_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S445-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|FJ032336_HBc_P-C Product feature CHAIN FJ032336_HBc_P-C of FT:mat_peptide FJ032336_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032338_HBc_P-C Product feature CHAIN FJ032338_HBc_P-C of FT:mat_peptide FJ032338_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGESMNLATWAGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFRRETVLEYLVSFGVWIRTPHAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032339_HBc_P-C Product feature CHAIN FJ032339_HBc_P-C of FT:mat_peptide FJ032339_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032340_HBc_P-C Product feature CHAIN FJ032340_HBc_P-C of FT:mat_peptide FJ032340_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032341_HBc_P-C Product feature CHAIN FJ032341_HBc_P-C of FT:mat_peptide FJ032341_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032345_HBc_P-C Product feature CHAIN FJ032345_HBc_P-C of FT:mat_peptide FJ032345_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032346_HBc_P-C Product feature CHAIN FJ032346_HBc_P-C of FT:mat_peptide FJ032346_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032347_HBc_P-C Product feature CHAIN FJ032347_HBc_P-C of FT:mat_peptide FJ032347_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032350_HBc_P-C Product feature CHAIN FJ032350_HBc_P-C of FT:mat_peptide FJ032350_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032351_HBc_P-C Product feature CHAIN FJ032351_HBc_P-C of FT:mat_peptide FJ032351_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032355_HBc_P-C Product feature CHAIN FJ032355_HBc_P-C of FT:mat_peptide FJ032355_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032356_HBc_P-C Product feature CHAIN FJ032356_HBc_P-C of FT:mat_peptide FJ032356_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032359_HBc_P-C Product feature CHAIN FJ032359_HBc_P-C of FT:mat_peptide FJ032359_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032360_HBc_P-C Product feature CHAIN FJ032360_HBc_P-C of FT:mat_peptide FJ032360_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032361_HBc_P-C Product feature CHAIN FJ032361_HBc_P-C of FT:mat_peptide FJ032361_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ151413_HBc_P-C Product feature CHAIN FJ151413_HBc_P-C of FT:mat_peptide FJ151413_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDLFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVFEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|FJ349225_HBc_P-C Product feature CHAIN FJ349225_HBc_P-C of FT:mat_peptide FJ349225_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H94). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386574_HBc_P-C Product feature CHAIN FJ386574_HBc_P-C of FT:mat_peptide FJ386574_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1743). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386575_HBc_P-C Product feature CHAIN FJ386575_HBc_P-C of FT:mat_peptide FJ386575_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1745). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386576_HBc_P-C Product feature CHAIN FJ386576_HBc_P-C of FT:mat_peptide FJ386576_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1746). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386577_HBc_P-C Product feature CHAIN FJ386577_HBc_P-C of FT:mat_peptide FJ386577_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1747). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386579_HBc_P-C Product feature CHAIN FJ386579_HBc_P-C of FT:mat_peptide FJ386579_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1762). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPLDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386587_HBc_P-C Product feature CHAIN FJ386587_HBc_P-C of FT:mat_peptide FJ386587_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1812). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386588_HBc_P-C Product feature CHAIN FJ386588_HBc_P-C of FT:mat_peptide FJ386588_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1828). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386589_HBc_P-C Product feature CHAIN FJ386589_HBc_P-C of FT:mat_peptide FJ386589_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1830). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386591_HBc_P-C Product feature CHAIN FJ386591_HBc_P-C of FT:mat_peptide FJ386591_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1869). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386594_HBc_P-C Product feature CHAIN FJ386594_HBc_P-C of FT:mat_peptide FJ386594_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1878). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386595_HBc_P-C Product feature CHAIN FJ386595_HBc_P-C of FT:mat_peptide FJ386595_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1879). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386596_HBc_P-C Product feature CHAIN FJ386596_HBc_P-C of FT:mat_peptide FJ386596_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1887). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386597_HBc_P-C Product feature CHAIN FJ386597_HBc_P-C of FT:mat_peptide FJ386597_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1888). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386598_HBc_P-C Product feature CHAIN FJ386598_HBc_P-C of FT:mat_peptide FJ386598_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1889). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386601_HBc_P-C Product feature CHAIN FJ386601_HBc_P-C of FT:mat_peptide FJ386601_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1912). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386602_HBc_P-C Product feature CHAIN FJ386602_HBc_P-C of FT:mat_peptide FJ386602_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1914). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386603_HBc_P-C Product feature CHAIN FJ386603_HBc_P-C of FT:mat_peptide FJ386603_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1949). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386604_HBc_P-C Product feature CHAIN FJ386604_HBc_P-C of FT:mat_peptide FJ386604_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1950). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386605_HBc_P-C Product feature CHAIN FJ386605_HBc_P-C of FT:mat_peptide FJ386605_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1965). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386607_HBc_P-C Product feature CHAIN FJ386607_HBc_P-C of FT:mat_peptide FJ386607_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1967). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386609_HBc_P-C Product feature CHAIN FJ386609_HBc_P-C of FT:mat_peptide FJ386609_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386611_HBc_P-C Product feature CHAIN FJ386611_HBc_P-C of FT:mat_peptide FJ386611_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2018). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPHAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386612_HBc_P-C Product feature CHAIN FJ386612_HBc_P-C of FT:mat_peptide FJ386612_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386613_HBc_P-C Product feature CHAIN FJ386613_HBc_P-C of FT:mat_peptide FJ386613_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2039). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386616_HBc_P-C Product feature CHAIN FJ386616_HBc_P-C of FT:mat_peptide FJ386616_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2064). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386617_HBc_P-C Product feature CHAIN FJ386617_HBc_P-C of FT:mat_peptide FJ386617_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2093). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPFDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386618_HBc_P-C Product feature CHAIN FJ386618_HBc_P-C of FT:mat_peptide FJ386618_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2111). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386619_HBc_P-C Product feature CHAIN FJ386619_HBc_P-C of FT:mat_peptide FJ386619_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2119). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386620_HBc_P-C Product feature CHAIN FJ386620_HBc_P-C of FT:mat_peptide FJ386620_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2121). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386623_HBc_P-C Product feature CHAIN FJ386623_HBc_P-C of FT:mat_peptide FJ386623_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386624_HBc_P-C Product feature CHAIN FJ386624_HBc_P-C of FT:mat_peptide FJ386624_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2187). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386625_HBc_P-C Product feature CHAIN FJ386625_HBc_P-C of FT:mat_peptide FJ386625_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2190). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386626_HBc_P-C Product feature CHAIN FJ386626_HBc_P-C of FT:mat_peptide FJ386626_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2205). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRQCRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386627_HBc_P-C Product feature CHAIN FJ386627_HBc_P-C of FT:mat_peptide FJ386627_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2242). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386628_HBc_P-C Product feature CHAIN FJ386628_HBc_P-C of FT:mat_peptide FJ386628_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386629_HBc_P-C Product feature CHAIN FJ386629_HBc_P-C of FT:mat_peptide FJ386629_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2286). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386630_HBc_P-C Product feature CHAIN FJ386630_HBc_P-C of FT:mat_peptide FJ386630_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2336). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|FJ386631_HBc_P-C Product feature CHAIN FJ386631_HBc_P-C of FT:mat_peptide FJ386631_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2359). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386632_HBc_P-C Product feature CHAIN FJ386632_HBc_P-C of FT:mat_peptide FJ386632_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2370). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386637_HBc_P-C Product feature CHAIN FJ386637_HBc_P-C of FT:mat_peptide FJ386637_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2151). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386638_HBc_P-C Product feature CHAIN FJ386638_HBc_P-C of FT:mat_peptide FJ386638_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2015). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDXLDTASALHREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386639_HBc_P-C Product feature CHAIN FJ386639_HBc_P-C of FT:mat_peptide FJ386639_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1929). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386640_HBc_P-C Product feature CHAIN FJ386640_HBc_P-C of FT:mat_peptide FJ386640_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2168). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|FJ386641_HBc_P-C Product feature CHAIN FJ386641_HBc_P-C of FT:mat_peptide FJ386641_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2236). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386644_HBc_P-C Product feature CHAIN FJ386644_HBc_P-C of FT:mat_peptide FJ386644_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S737). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPFEFFLSIRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386645_HBc_P-C Product feature CHAIN FJ386645_HBc_P-C of FT:mat_peptide FJ386645_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S897). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386647_HBc_P-C Product feature CHAIN FJ386647_HBc_P-C of FT:mat_peptide FJ386647_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2400). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386650_HBc_P-C Product feature CHAIN FJ386650_HBc_P-C of FT:mat_peptide FJ386650_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2468). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386651_HBc_P-C Product feature CHAIN FJ386651_HBc_P-C of FT:mat_peptide FJ386651_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2476). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386652_HBc_P-C Product feature CHAIN FJ386652_HBc_P-C of FT:mat_peptide FJ386652_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2518). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386653_HBc_P-C Product feature CHAIN FJ386653_HBc_P-C of FT:mat_peptide FJ386653_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|FJ386657_HBc_P-C Product feature CHAIN FJ386657_HBc_P-C of FT:mat_peptide FJ386657_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386659_HBc_P-C Product feature CHAIN FJ386659_HBc_P-C of FT:mat_peptide FJ386659_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S219). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386661_HBc_P-C Product feature CHAIN FJ386661_HBc_P-C of FT:mat_peptide FJ386661_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S251). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|FJ386662_HBc_P-C Product feature CHAIN FJ386662_HBc_P-C of FT:mat_peptide FJ386662_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S269). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELINLATWVGSNVEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386663_HBc_P-C Product feature CHAIN FJ386663_HBc_P-C of FT:mat_peptide FJ386663_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S307). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLIDTASALHREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386664_HBc_P-C Product feature CHAIN FJ386664_HBc_P-C of FT:mat_peptide FJ386664_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S310). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386665_HBc_P-C Product feature CHAIN FJ386665_HBc_P-C of FT:mat_peptide FJ386665_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386667_HBc_P-C Product feature CHAIN FJ386667_HBc_P-C of FT:mat_peptide FJ386667_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S379). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386670_HBc_P-C Product feature CHAIN FJ386670_HBc_P-C of FT:mat_peptide FJ386670_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S454). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|FJ386671_HBc_P-C Product feature CHAIN FJ386671_HBc_P-C of FT:mat_peptide FJ386671_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S586). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386672_HBc_P-C Product feature CHAIN FJ386672_HBc_P-C of FT:mat_peptide FJ386672_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S606). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGSSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386673_HBc_P-C Product feature CHAIN FJ386673_HBc_P-C of FT:mat_peptide FJ386673_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S633). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386677_HBc_P-C Product feature CHAIN FJ386677_HBc_P-C of FT:mat_peptide FJ386677_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1104). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386678_HBc_P-C Product feature CHAIN FJ386678_HBc_P-C of FT:mat_peptide FJ386678_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1147). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386679_HBc_P-C Product feature CHAIN FJ386679_HBc_P-C of FT:mat_peptide FJ386679_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1217). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ386685_HBc_P-C Product feature CHAIN FJ386685_HBc_P-C of FT:mat_peptide FJ386685_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1568). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASXELLSFLPSDFFPSIRDLXDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386687_HBc_P-C Product feature CHAIN FJ386687_HBc_P-C of FT:mat_peptide FJ386687_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1600). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386689_HBc_P-C Product feature CHAIN FJ386689_HBc_P-C of FT:mat_peptide FJ386689_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1649). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ518810_HBc_P-C Product feature CHAIN FJ518810_HBc_P-C of FT:mat_peptide FJ518810_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIQDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ518813_HBc_P-C Product feature CHAIN FJ518813_HBc_P-C of FT:mat_peptide FJ518813_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562218_HBc_P-C Product feature CHAIN FJ562218_HBc_P-C of FT:mat_peptide FJ562218_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562220_HBc_P-C Product feature CHAIN FJ562220_HBc_P-C of FT:mat_peptide FJ562220_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I12). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVGHVNGNMGLKIRQLMWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562221_HBc_P-C Product feature CHAIN FJ562221_HBc_P-C of FT:mat_peptide FJ562221_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562225_HBc_P-C Product feature CHAIN FJ562225_HBc_P-C of FT:mat_peptide FJ562225_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVQHLLDTASALYREALESPEHCSPHHTALRQAILCWGEVMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562228_HBc_P-C Product feature CHAIN FJ562228_HBc_P-C of FT:mat_peptide FJ562228_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQQ
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562230_HBc_P-C Product feature CHAIN FJ562230_HBc_P-C of FT:mat_peptide FJ562230_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562232_HBc_P-C Product feature CHAIN FJ562232_HBc_P-C of FT:mat_peptide FJ562232_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562233_HBc_P-C Product feature CHAIN FJ562233_HBc_P-C of FT:mat_peptide FJ562233_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562235_HBc_P-C Product feature CHAIN FJ562235_HBc_P-C of FT:mat_peptide FJ562235_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562238_HBc_P-C Product feature CHAIN FJ562238_HBc_P-C of FT:mat_peptide FJ562238_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I62). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAAVCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562239_HBc_P-C Product feature CHAIN FJ562239_HBc_P-C of FT:mat_peptide FJ562239_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I64). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562241_HBc_P-C Product feature CHAIN FJ562241_HBc_P-C of FT:mat_peptide FJ562241_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ562242_HBc_P-C Product feature CHAIN FJ562242_HBc_P-C of FT:mat_peptide FJ562242_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I68). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ562243_HBc_P-C Product feature CHAIN FJ562243_HBc_P-C of FT:mat_peptide FJ562243_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I71). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562244_HBc_P-C Product feature CHAIN FJ562244_HBc_P-C of FT:mat_peptide FJ562244_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I72). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562245_HBc_P-C Product feature CHAIN FJ562245_HBc_P-C of FT:mat_peptide FJ562245_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I73). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562248_HBc_P-C Product feature CHAIN FJ562248_HBc_P-C of FT:mat_peptide FJ562248_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAIVCWGELMNLATWVGSNLEDPA
SRELVVGYVKVNMGLKRGQKSWFHISCPTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562249_HBc_P-C Product feature CHAIN FJ562249_HBc_P-C of FT:mat_peptide FJ562249_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I79). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562250_HBc_P-C Product feature CHAIN FJ562250_HBc_P-C of FT:mat_peptide FJ562250_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I83). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGREVVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562251_HBc_P-C Product feature CHAIN FJ562251_HBc_P-C of FT:mat_peptide FJ562251_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRPPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562252_HBc_P-C Product feature CHAIN FJ562252_HBc_P-C of FT:mat_peptide FJ562252_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I85). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ562255_HBc_P-C Product feature CHAIN FJ562255_HBc_P-C of FT:mat_peptide FJ562255_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I92). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562256_HBc_P-C Product feature CHAIN FJ562256_HBc_P-C of FT:mat_peptide FJ562256_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I95). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDTYKPFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562258_HBc_P-C Product feature CHAIN FJ562258_HBc_P-C of FT:mat_peptide FJ562258_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I97). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562261_HBc_P-C Product feature CHAIN FJ562261_HBc_P-C of FT:mat_peptide FJ562261_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I109). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ562264_HBc_P-C Product feature CHAIN FJ562264_HBc_P-C of FT:mat_peptide FJ562264_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPTIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ562265_HBc_P-C Product feature CHAIN FJ562265_HBc_P-C of FT:mat_peptide FJ562265_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562266_HBc_P-C Product feature CHAIN FJ562266_HBc_P-C of FT:mat_peptide FJ562266_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I118). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ562268_HBc_P-C Product feature CHAIN FJ562268_HBc_P-C of FT:mat_peptide FJ562268_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I121). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562269_HBc_P-C Product feature CHAIN FJ562269_HBc_P-C of FT:mat_peptide FJ562269_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I122). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562270_HBc_P-C Product feature CHAIN FJ562270_HBc_P-C of FT:mat_peptide FJ562270_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I123). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRHAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ562272_HBc_P-C Product feature CHAIN FJ562272_HBc_P-C of FT:mat_peptide FJ562272_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I125). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562273_HBc_P-C Product feature CHAIN FJ562273_HBc_P-C of FT:mat_peptide FJ562273_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I127). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELTNLATWVGSNLEDPA
SRELVVGYVNGNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562274_HBc_P-C Product feature CHAIN FJ562274_HBc_P-C of FT:mat_peptide FJ562274_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I128). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562275_HBc_P-C Product feature CHAIN FJ562275_HBc_P-C of FT:mat_peptide FJ562275_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562276_HBc_P-C Product feature CHAIN FJ562276_HBc_P-C of FT:mat_peptide FJ562276_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I130). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562279_HBc_P-C Product feature CHAIN FJ562279_HBc_P-C of FT:mat_peptide FJ562279_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I140). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562280_HBc_P-C Product feature CHAIN FJ562280_HBc_P-C of FT:mat_peptide FJ562280_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I141). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562281_HBc_P-C Product feature CHAIN FJ562281_HBc_P-C of FT:mat_peptide FJ562281_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I143). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562282_HBc_P-C Product feature CHAIN FJ562282_HBc_P-C of FT:mat_peptide FJ562282_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562283_HBc_P-C Product feature CHAIN FJ562283_HBc_P-C of FT:mat_peptide FJ562283_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I145). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562284_HBc_P-C Product feature CHAIN FJ562284_HBc_P-C of FT:mat_peptide FJ562284_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I146). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562285_HBc_P-C Product feature CHAIN FJ562285_HBc_P-C of FT:mat_peptide FJ562285_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I147). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562286_HBc_P-C Product feature CHAIN FJ562286_HBc_P-C of FT:mat_peptide FJ562286_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I149). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNGNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562288_HBc_P-C Product feature CHAIN FJ562288_HBc_P-C of FT:mat_peptide FJ562288_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I153). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562290_HBc_P-C Product feature CHAIN FJ562290_HBc_P-C of FT:mat_peptide FJ562290_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I162). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562291_HBc_P-C Product feature CHAIN FJ562291_HBc_P-C of FT:mat_peptide FJ562291_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I163). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ562293_HBc_P-C Product feature CHAIN FJ562293_HBc_P-C of FT:mat_peptide FJ562293_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I167). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562295_HBc_P-C Product feature CHAIN FJ562295_HBc_P-C of FT:mat_peptide FJ562295_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I169). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562297_HBc_P-C Product feature CHAIN FJ562297_HBc_P-C of FT:mat_peptide FJ562297_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I172). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562298_HBc_P-C Product feature CHAIN FJ562298_HBc_P-C of FT:mat_peptide FJ562298_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I174). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562299_HBc_P-C Product feature CHAIN FJ562299_HBc_P-C of FT:mat_peptide FJ562299_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I175). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562300_HBc_P-C Product feature CHAIN FJ562300_HBc_P-C of FT:mat_peptide FJ562300_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I182). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKPFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562301_HBc_P-C Product feature CHAIN FJ562301_HBc_P-C of FT:mat_peptide FJ562301_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I185). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562304_HBc_P-C Product feature CHAIN FJ562304_HBc_P-C of FT:mat_peptide FJ562304_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I190). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562306_HBc_P-C Product feature CHAIN FJ562306_HBc_P-C of FT:mat_peptide FJ562306_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I196). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRHAILCWGELMNLATWVGGNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562307_HBc_P-C Product feature CHAIN FJ562307_HBc_P-C of FT:mat_peptide FJ562307_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I197). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562308_HBc_P-C Product feature CHAIN FJ562308_HBc_P-C of FT:mat_peptide FJ562308_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I199). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPNAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562318_HBc_P-C Product feature CHAIN FJ562318_HBc_P-C of FT:mat_peptide FJ562318_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I211). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562319_HBc_P-C Product feature CHAIN FJ562319_HBc_P-C of FT:mat_peptide FJ562319_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I212). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562320_HBc_P-C Product feature CHAIN FJ562320_HBc_P-C of FT:mat_peptide FJ562320_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I213). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562323_HBc_P-C Product feature CHAIN FJ562323_HBc_P-C of FT:mat_peptide FJ562323_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I217). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562324_HBc_P-C Product feature CHAIN FJ562324_HBc_P-C of FT:mat_peptide FJ562324_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I219). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562325_HBc_P-C Product feature CHAIN FJ562325_HBc_P-C of FT:mat_peptide FJ562325_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I223). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562326_HBc_P-C Product feature CHAIN FJ562326_HBc_P-C of FT:mat_peptide FJ562326_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I227). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|FJ562327_HBc_P-C Product feature CHAIN FJ562327_HBc_P-C of FT:mat_peptide FJ562327_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I228). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSSLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562329_HBc_P-C Product feature CHAIN FJ562329_HBc_P-C of FT:mat_peptide FJ562329_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I230). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAPVDILFFFPSDFFPSIQDLLDTAWPLYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELGVGYVNGNMGLKFRQIWWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562330_HBc_P-C Product feature CHAIN FJ562330_HBc_P-C of FT:mat_peptide FJ562330_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I231). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562332_HBc_P-C Product feature CHAIN FJ562332_HBc_P-C of FT:mat_peptide FJ562332_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562333_HBc_P-C Product feature CHAIN FJ562333_HBc_P-C of FT:mat_peptide FJ562333_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I78). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562334_HBc_P-C Product feature CHAIN FJ562334_HBc_P-C of FT:mat_peptide FJ562334_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562335_HBc_P-C Product feature CHAIN FJ562335_HBc_P-C of FT:mat_peptide FJ562335_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I108). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLQLLSFLPADFFPSVRDLLDTAIALFREALESPEHCSPHHTALRQAILCWGDLMNLATWVGSNLEDPV
SRELVVNYVNVNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562337_HBc_P-C Product feature CHAIN FJ562337_HBc_P-C of FT:mat_peptide FJ562337_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I173). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALXSPEXCSPHHTALRQAFLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSKSPRRRRSQSREPQC
>gnl|hbvpro|FJ562340_HBc_P-C Product feature CHAIN FJ562340_HBc_P-C of FT:mat_peptide FJ562340_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I220). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715341_HBc_P-C Product feature CHAIN FJ715341_HBc_P-C of FT:mat_peptide FJ715341_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715342_HBc_P-C Product feature CHAIN FJ715342_HBc_P-C of FT:mat_peptide FJ715342_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRMSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715343_HBc_P-C Product feature CHAIN FJ715343_HBc_P-C of FT:mat_peptide FJ715343_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLVTWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNALFLSTLAETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715344_HBc_P-C Product feature CHAIN FJ715344_HBc_P-C of FT:mat_peptide FJ715344_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGMSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715350_HBc_P-C Product feature CHAIN FJ715350_HBc_P-C of FT:mat_peptide FJ715350_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715351_HBc_P-C Product feature CHAIN FJ715351_HBc_P-C of FT:mat_peptide FJ715351_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715352_HBc_P-C Product feature CHAIN FJ715352_HBc_P-C of FT:mat_peptide FJ715352_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715353_HBc_P-C Product feature CHAIN FJ715353_HBc_P-C of FT:mat_peptide FJ715353_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715355_HBc_P-C Product feature CHAIN FJ715355_HBc_P-C of FT:mat_peptide FJ715355_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715357_HBc_P-C Product feature CHAIN FJ715357_HBc_P-C of FT:mat_peptide FJ715357_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715358_HBc_P-C Product feature CHAIN FJ715358_HBc_P-C of FT:mat_peptide FJ715358_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715359_HBc_P-C Product feature CHAIN FJ715359_HBc_P-C of FT:mat_peptide FJ715359_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715364_HBc_P-C Product feature CHAIN FJ715364_HBc_P-C of FT:mat_peptide FJ715364_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRLPNAPILSTLPETTVVRRRGSSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715365_HBc_P-C Product feature CHAIN FJ715365_HBc_P-C of FT:mat_peptide FJ715365_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC73). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715366_HBc_P-C Product feature CHAIN FJ715366_HBc_P-C of FT:mat_peptide FJ715366_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC74). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715367_HBc_P-C Product feature CHAIN FJ715367_HBc_P-C of FT:mat_peptide FJ715367_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC75). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFVPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715368_HBc_P-C Product feature CHAIN FJ715368_HBc_P-C of FT:mat_peptide FJ715368_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715370_HBc_P-C Product feature CHAIN FJ715370_HBc_P-C of FT:mat_peptide FJ715370_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715371_HBc_P-C Product feature CHAIN FJ715371_HBc_P-C of FT:mat_peptide FJ715371_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715372_HBc_P-C Product feature CHAIN FJ715372_HBc_P-C of FT:mat_peptide FJ715372_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|FJ715374_HBc_P-C Product feature CHAIN FJ715374_HBc_P-C of FT:mat_peptide FJ715374_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715375_HBc_P-C Product feature CHAIN FJ715375_HBc_P-C of FT:mat_peptide FJ715375_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREAVPEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715376_HBc_P-C Product feature CHAIN FJ715376_HBc_P-C of FT:mat_peptide FJ715376_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715377_HBc_P-C Product feature CHAIN FJ715377_HBc_P-C of FT:mat_peptide FJ715377_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715378_HBc_P-C Product feature CHAIN FJ715378_HBc_P-C of FT:mat_peptide FJ715378_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715379_HBc_P-C Product feature CHAIN FJ715379_HBc_P-C of FT:mat_peptide FJ715379_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715380_HBc_P-C Product feature CHAIN FJ715380_HBc_P-C of FT:mat_peptide FJ715380_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715381_HBc_P-C Product feature CHAIN FJ715381_HBc_P-C of FT:mat_peptide FJ715381_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715382_HBc_P-C Product feature CHAIN FJ715382_HBc_P-C of FT:mat_peptide FJ715382_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715383_HBc_P-C Product feature CHAIN FJ715383_HBc_P-C of FT:mat_peptide FJ715383_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRGRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715389_HBc_P-C Product feature CHAIN FJ715389_HBc_P-C of FT:mat_peptide FJ715389_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM62). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPFIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715390_HBc_P-C Product feature CHAIN FJ715390_HBc_P-C of FT:mat_peptide FJ715390_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM63). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLISFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715391_HBc_P-C Product feature CHAIN FJ715391_HBc_P-C of FT:mat_peptide FJ715391_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLRETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715392_HBc_P-C Product feature CHAIN FJ715392_HBc_P-C of FT:mat_peptide FJ715392_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEYCSPHHTALRQAILCWGELMNLATWAGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715395_HBc_P-C Product feature CHAIN FJ715395_HBc_P-C of FT:mat_peptide FJ715395_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715397_HBc_P-C Product feature CHAIN FJ715397_HBc_P-C of FT:mat_peptide FJ715397_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715398_HBc_P-C Product feature CHAIN FJ715398_HBc_P-C of FT:mat_peptide FJ715398_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715400_HBc_P-C Product feature CHAIN FJ715400_HBc_P-C of FT:mat_peptide FJ715400_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715402_HBc_P-C Product feature CHAIN FJ715402_HBc_P-C of FT:mat_peptide FJ715402_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715403_HBc_P-C Product feature CHAIN FJ715403_HBc_P-C of FT:mat_peptide FJ715403_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRGRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715404_HBc_P-C Product feature CHAIN FJ715404_HBc_P-C of FT:mat_peptide FJ715404_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELPSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSLRRRRSQSRESQC
>gnl|hbvpro|FJ715405_HBc_P-C Product feature CHAIN FJ715405_HBc_P-C of FT:mat_peptide FJ715405_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715406_HBc_P-C Product feature CHAIN FJ715406_HBc_P-C of FT:mat_peptide FJ715406_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELPSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715407_HBc_P-C Product feature CHAIN FJ715407_HBc_P-C of FT:mat_peptide FJ715407_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN41). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715409_HBc_P-C Product feature CHAIN FJ715409_HBc_P-C of FT:mat_peptide FJ715409_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715415_HBc_P-C Product feature CHAIN FJ715415_HBc_P-C of FT:mat_peptide FJ715415_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN61). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715416_HBc_P-C Product feature CHAIN FJ715416_HBc_P-C of FT:mat_peptide FJ715416_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN62). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715418_HBc_P-C Product feature CHAIN FJ715418_HBc_P-C of FT:mat_peptide FJ715418_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715421_HBc_P-C Product feature CHAIN FJ715421_HBc_P-C of FT:mat_peptide FJ715421_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVSVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715422_HBc_P-C Product feature CHAIN FJ715422_HBc_P-C of FT:mat_peptide FJ715422_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVIRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715424_HBc_P-C Product feature CHAIN FJ715424_HBc_P-C of FT:mat_peptide FJ715424_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN74). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|FJ751764_HBc_P-C Product feature CHAIN FJ751764_HBc_P-C of FT:mat_peptide FJ751764_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ751765_HBc_P-C Product feature CHAIN FJ751765_HBc_P-C of FT:mat_peptide FJ751765_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFSSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ751770_HBc_P-C Product feature CHAIN FJ751770_HBc_P-C of FT:mat_peptide FJ751770_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|FJ787437_HBc_P-C Product feature CHAIN FJ787437_HBc_P-C of FT:mat_peptide FJ787437_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S129-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787439_HBc_P-C Product feature CHAIN FJ787439_HBc_P-C of FT:mat_peptide FJ787439_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787441_HBc_P-C Product feature CHAIN FJ787441_HBc_P-C of FT:mat_peptide FJ787441_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787442_HBc_P-C Product feature CHAIN FJ787442_HBc_P-C of FT:mat_peptide FJ787442_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787443_HBc_P-C Product feature CHAIN FJ787443_HBc_P-C of FT:mat_peptide FJ787443_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787447_HBc_P-C Product feature CHAIN FJ787447_HBc_P-C of FT:mat_peptide FJ787447_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787449_HBc_P-C Product feature CHAIN FJ787449_HBc_P-C of FT:mat_peptide FJ787449_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S567-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|FJ787452_HBc_P-C Product feature CHAIN FJ787452_HBc_P-C of FT:mat_peptide FJ787452_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S955-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|FJ787453_HBc_P-C Product feature CHAIN FJ787453_HBc_P-C of FT:mat_peptide FJ787453_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787454_HBc_P-C Product feature CHAIN FJ787454_HBc_P-C of FT:mat_peptide FJ787454_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787455_HBc_P-C Product feature CHAIN FJ787455_HBc_P-C of FT:mat_peptide FJ787455_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|FJ787456_HBc_P-C Product feature CHAIN FJ787456_HBc_P-C of FT:mat_peptide FJ787456_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVTHVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787457_HBc_P-C Product feature CHAIN FJ787457_HBc_P-C of FT:mat_peptide FJ787457_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELFSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|FJ787458_HBc_P-C Product feature CHAIN FJ787458_HBc_P-C of FT:mat_peptide FJ787458_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-9). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787461_HBc_P-C Product feature CHAIN FJ787461_HBc_P-C of FT:mat_peptide FJ787461_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787462_HBc_P-C Product feature CHAIN FJ787462_HBc_P-C of FT:mat_peptide FJ787462_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787463_HBc_P-C Product feature CHAIN FJ787463_HBc_P-C of FT:mat_peptide FJ787463_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-6). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787464_HBc_P-C Product feature CHAIN FJ787464_HBc_P-C of FT:mat_peptide FJ787464_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787465_HBc_P-C Product feature CHAIN FJ787465_HBc_P-C of FT:mat_peptide FJ787465_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-5). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787466_HBc_P-C Product feature CHAIN FJ787466_HBc_P-C of FT:mat_peptide FJ787466_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787467_HBc_P-C Product feature CHAIN FJ787467_HBc_P-C of FT:mat_peptide FJ787467_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787468_HBc_P-C Product feature CHAIN FJ787468_HBc_P-C of FT:mat_peptide FJ787468_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787469_HBc_P-C Product feature CHAIN FJ787469_HBc_P-C of FT:mat_peptide FJ787469_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PLPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787470_HBc_P-C Product feature CHAIN FJ787470_HBc_P-C of FT:mat_peptide FJ787470_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|FJ787471_HBc_P-C Product feature CHAIN FJ787471_HBc_P-C of FT:mat_peptide FJ787471_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|FJ787479_HBc_P-C Product feature CHAIN FJ787479_HBc_P-C of FT:mat_peptide FJ787479_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787481_HBc_P-C Product feature CHAIN FJ787481_HBc_P-C of FT:mat_peptide FJ787481_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-2). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787482_HBc_P-C Product feature CHAIN FJ787482_HBc_P-C of FT:mat_peptide FJ787482_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1158-7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALEAPEHCSPHHTAIRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ787483_HBc_P-C Product feature CHAIN FJ787483_HBc_P-C of FT:mat_peptide FJ787483_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1158-8). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALEAPEHCSPHHTAIGQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ787485_HBc_P-C Product feature CHAIN FJ787485_HBc_P-C of FT:mat_peptide FJ787485_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1656-8). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTVSALYREALEAPEHCSPHHTAIRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ787486_HBc_P-C Product feature CHAIN FJ787486_HBc_P-C of FT:mat_peptide FJ787486_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2235-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787487_HBc_P-C Product feature CHAIN FJ787487_HBc_P-C of FT:mat_peptide FJ787487_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DMY-1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRGLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ787488_HBc_P-C Product feature CHAIN FJ787488_HBc_P-C of FT:mat_peptide FJ787488_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DMY-5). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ787489_HBc_P-C Product feature CHAIN FJ787489_HBc_P-C of FT:mat_peptide FJ787489_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DMY-6). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGGNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ787490_HBc_P-C Product feature CHAIN FJ787490_HBc_P-C of FT:mat_peptide FJ787490_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LHZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRFQSPRRRRSQSRESQC
>gnl|hbvpro|FJ848339_HBc_P-C Product feature CHAIN FJ848339_HBc_P-C of FT:mat_peptide FJ848339_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASGELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAFVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899761_HBc_P-C Product feature CHAIN FJ899761_HBc_P-C of FT:mat_peptide FJ899761_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ899763_HBc_P-C Product feature CHAIN FJ899763_HBc_P-C of FT:mat_peptide FJ899763_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899764_HBc_P-C Product feature CHAIN FJ899764_HBc_P-C of FT:mat_peptide FJ899764_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899765_HBc_P-C Product feature CHAIN FJ899765_HBc_P-C of FT:mat_peptide FJ899765_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ899767_HBc_P-C Product feature CHAIN FJ899767_HBc_P-C of FT:mat_peptide FJ899767_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRESVVGYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRQRGRPTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899768_HBc_P-C Product feature CHAIN FJ899768_HBc_P-C of FT:mat_peptide FJ899768_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C56-7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDQA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ899769_HBc_P-C Product feature CHAIN FJ899769_HBc_P-C of FT:mat_peptide FJ899769_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899770_HBc_P-C Product feature CHAIN FJ899770_HBc_P-C of FT:mat_peptide FJ899770_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRELLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899771_HBc_P-C Product feature CHAIN FJ899771_HBc_P-C of FT:mat_peptide FJ899771_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCLPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899774_HBc_P-C Product feature CHAIN FJ899774_HBc_P-C of FT:mat_peptide FJ899774_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKESGASVELLSFLPSDFFPSIRDLLDTASALYREALEAPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899775_HBc_P-C Product feature CHAIN FJ899775_HBc_P-C of FT:mat_peptide FJ899775_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899776_HBc_P-C Product feature CHAIN FJ899776_HBc_P-C of FT:mat_peptide FJ899776_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899777_HBc_P-C Product feature CHAIN FJ899777_HBc_P-C of FT:mat_peptide FJ899777_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899778_HBc_P-C Product feature CHAIN FJ899778_HBc_P-C of FT:mat_peptide FJ899778_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899783_HBc_P-C Product feature CHAIN FJ899783_HBc_P-C of FT:mat_peptide FJ899783_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPSDFFPSIRDLLDTASALYREALESPKHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899788_HBc_P-C Product feature CHAIN FJ899788_HBc_P-C of FT:mat_peptide FJ899788_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWSHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ899789_HBc_P-C Product feature CHAIN FJ899789_HBc_P-C of FT:mat_peptide FJ899789_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ904423_HBc_P-C Product feature CHAIN FJ904423_HBc_P-C of FT:mat_peptide FJ904423_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A78). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPIAYRPSNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ184326_HBc_P-C Product feature CHAIN GQ184326_HBc_P-C of FT:mat_peptide GQ184326_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM501). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALHREALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227692_HBc_P-C Product feature CHAIN GQ227692_HBc_P-C of FT:mat_peptide GQ227692_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227693_HBc_P-C Product feature CHAIN GQ227693_HBc_P-C of FT:mat_peptide GQ227693_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227694_HBc_P-C Product feature CHAIN GQ227694_HBc_P-C of FT:mat_peptide GQ227694_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227695_HBc_P-C Product feature CHAIN GQ227695_HBc_P-C of FT:mat_peptide GQ227695_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-5). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
TDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRGSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227696_HBc_P-C Product feature CHAIN GQ227696_HBc_P-C of FT:mat_peptide GQ227696_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLTTWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227697_HBc_P-C Product feature CHAIN GQ227697_HBc_P-C of FT:mat_peptide GQ227697_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ259588_HBc_P-C Product feature CHAIN GQ259588_HBc_P-C of FT:mat_peptide GQ259588_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358153_HBc_P-C Product feature CHAIN GQ358153_HBc_P-C of FT:mat_peptide GQ358153_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIHB006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|GQ358154_HBc_P-C Product feature CHAIN GQ358154_HBc_P-C of FT:mat_peptide GQ358154_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLK126). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358157_HBc_P-C Product feature CHAIN GQ358157_HBc_P-C of FT:mat_peptide GQ358157_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M007). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358158_HBc_C-C Product feature CHAIN GQ358158_HBc_C-C of FT:mat_peptide GQ358158_HBc_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M154). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ372968_HBc_P-C Product feature CHAIN GQ372968_HBc_P-C of FT:mat_peptide GQ372968_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6380-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ377514_HBc_P-C Product feature CHAIN GQ377514_HBc_P-C of FT:mat_peptide GQ377514_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J8). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377515_HBc_P-C Product feature CHAIN GQ377515_HBc_P-C of FT:mat_peptide GQ377515_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377517_HBc_P-C Product feature CHAIN GQ377517_HBc_P-C of FT:mat_peptide GQ377517_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377518_HBc_P-C Product feature CHAIN GQ377518_HBc_P-C of FT:mat_peptide GQ377518_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ377521_HBc_P-C Product feature CHAIN GQ377521_HBc_P-C of FT:mat_peptide GQ377521_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|GQ377523_HBc_P-C Product feature CHAIN GQ377523_HBc_P-C of FT:mat_peptide GQ377523_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377524_HBc_P-C Product feature CHAIN GQ377524_HBc_P-C of FT:mat_peptide GQ377524_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377526_HBc_P-C Product feature CHAIN GQ377526_HBc_P-C of FT:mat_peptide GQ377526_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377527_HBc_P-C Product feature CHAIN GQ377527_HBc_P-C of FT:mat_peptide GQ377527_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377528_HBc_P-C Product feature CHAIN GQ377528_HBc_P-C of FT:mat_peptide GQ377528_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377529_HBc_P-C Product feature CHAIN GQ377529_HBc_P-C of FT:mat_peptide GQ377529_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377531_HBc_P-C Product feature CHAIN GQ377531_HBc_P-C of FT:mat_peptide GQ377531_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J36). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377533_HBc_P-C Product feature CHAIN GQ377533_HBc_P-C of FT:mat_peptide GQ377533_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377535_HBc_P-C Product feature CHAIN GQ377535_HBc_P-C of FT:mat_peptide GQ377535_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J45). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377536_HBc_P-C Product feature CHAIN GQ377536_HBc_P-C of FT:mat_peptide GQ377536_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377538_HBc_P-C Product feature CHAIN GQ377538_HBc_P-C of FT:mat_peptide GQ377538_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377540_HBc_P-C Product feature CHAIN GQ377540_HBc_P-C of FT:mat_peptide GQ377540_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J57). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377541_HBc_P-C Product feature CHAIN GQ377541_HBc_P-C of FT:mat_peptide GQ377541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377543_HBc_P-C Product feature CHAIN GQ377543_HBc_P-C of FT:mat_peptide GQ377543_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J63). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ377545_HBc_P-C Product feature CHAIN GQ377545_HBc_P-C of FT:mat_peptide GQ377545_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377546_HBc_P-C Product feature CHAIN GQ377546_HBc_P-C of FT:mat_peptide GQ377546_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J77). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377551_HBc_P-C Product feature CHAIN GQ377551_HBc_P-C of FT:mat_peptide GQ377551_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377552_HBc_P-C Product feature CHAIN GQ377552_HBc_P-C of FT:mat_peptide GQ377552_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J83). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGGSEELLSFLPSDLFPFIRDILDRGDALYREALECPEHCSPPHTALRQAILCWGELMNLTPWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377553_HBc_P-C Product feature CHAIN GQ377553_HBc_P-C of FT:mat_peptide GQ377553_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377554_HBc_P-C Product feature CHAIN GQ377554_HBc_P-C of FT:mat_peptide GQ377554_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J85). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377555_HBc_P-C Product feature CHAIN GQ377555_HBc_P-C of FT:mat_peptide GQ377555_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377557_HBc_P-C Product feature CHAIN GQ377557_HBc_P-C of FT:mat_peptide GQ377557_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J88). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377559_HBc_P-C Product feature CHAIN GQ377559_HBc_P-C of FT:mat_peptide GQ377559_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J92). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377562_HBc_P-C Product feature CHAIN GQ377562_HBc_P-C of FT:mat_peptide GQ377562_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J97). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377563_HBc_P-C Product feature CHAIN GQ377563_HBc_P-C of FT:mat_peptide GQ377563_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J98). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377570_HBc_P-C Product feature CHAIN GQ377570_HBc_P-C of FT:mat_peptide GQ377570_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J110). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377571_HBc_P-C Product feature CHAIN GQ377571_HBc_P-C of FT:mat_peptide GQ377571_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J112). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377572_HBc_P-C Product feature CHAIN GQ377572_HBc_P-C of FT:mat_peptide GQ377572_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J113). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377574_HBc_P-C Product feature CHAIN GQ377574_HBc_P-C of FT:mat_peptide GQ377574_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J115). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377575_HBc_P-C Product feature CHAIN GQ377575_HBc_P-C of FT:mat_peptide GQ377575_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFRASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377576_HBc_P-C Product feature CHAIN GQ377576_HBc_P-C of FT:mat_peptide GQ377576_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J117). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377577_HBc_P-C Product feature CHAIN GQ377577_HBc_P-C of FT:mat_peptide GQ377577_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J118). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377578_HBc_P-C Product feature CHAIN GQ377578_HBc_P-C of FT:mat_peptide GQ377578_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J125). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377579_HBc_P-C Product feature CHAIN GQ377579_HBc_P-C of FT:mat_peptide GQ377579_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J126). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377580_HBc_P-C Product feature CHAIN GQ377580_HBc_P-C of FT:mat_peptide GQ377580_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J127). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377583_HBc_P-C Product feature CHAIN GQ377583_HBc_P-C of FT:mat_peptide GQ377583_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J132). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377584_HBc_P-C Product feature CHAIN GQ377584_HBc_P-C of FT:mat_peptide GQ377584_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J133). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377585_HBc_P-C Product feature CHAIN GQ377585_HBc_P-C of FT:mat_peptide GQ377585_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J134). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377586_HBc_P-C Product feature CHAIN GQ377586_HBc_P-C of FT:mat_peptide GQ377586_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J135). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|GQ377591_HBc_P-C Product feature CHAIN GQ377591_HBc_P-C of FT:mat_peptide GQ377591_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J148). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377593_HBc_P-C Product feature CHAIN GQ377593_HBc_P-C of FT:mat_peptide GQ377593_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J150). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377597_HBc_P-C Product feature CHAIN GQ377597_HBc_P-C of FT:mat_peptide GQ377597_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J157). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLMWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377598_HBc_P-C Product feature CHAIN GQ377598_HBc_P-C of FT:mat_peptide GQ377598_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J158). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377599_HBc_P-C Product feature CHAIN GQ377599_HBc_P-C of FT:mat_peptide GQ377599_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J160). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377600_HBc_P-C Product feature CHAIN GQ377600_HBc_P-C of FT:mat_peptide GQ377600_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J161). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377601_HBc_P-C Product feature CHAIN GQ377601_HBc_P-C of FT:mat_peptide GQ377601_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J164). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377603_HBc_P-C Product feature CHAIN GQ377603_HBc_P-C of FT:mat_peptide GQ377603_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J166). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377605_HBc_P-C Product feature CHAIN GQ377605_HBc_P-C of FT:mat_peptide GQ377605_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J169). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ377608_HBc_P-C Product feature CHAIN GQ377608_HBc_P-C of FT:mat_peptide GQ377608_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J174). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377609_HBc_P-C Product feature CHAIN GQ377609_HBc_P-C of FT:mat_peptide GQ377609_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J176). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377615_HBc_P-C Product feature CHAIN GQ377615_HBc_P-C of FT:mat_peptide GQ377615_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J186). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377616_HBc_P-C Product feature CHAIN GQ377616_HBc_P-C of FT:mat_peptide GQ377616_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J192). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377617_HBc_P-C Product feature CHAIN GQ377617_HBc_P-C of FT:mat_peptide GQ377617_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J193). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377618_HBc_P-C Product feature CHAIN GQ377618_HBc_P-C of FT:mat_peptide GQ377618_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J194). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377619_HBc_P-C Product feature CHAIN GQ377619_HBc_P-C of FT:mat_peptide GQ377619_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J195). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377620_HBc_P-C Product feature CHAIN GQ377620_HBc_P-C of FT:mat_peptide GQ377620_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J197). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377623_HBc_P-C Product feature CHAIN GQ377623_HBc_P-C of FT:mat_peptide GQ377623_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J208). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSHHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRQRGRSPRRRT
PSPRRRRSQSPRCRRSQSREPRC
>gnl|hbvpro|GQ377624_HBc_P-C Product feature CHAIN GQ377624_HBc_P-C of FT:mat_peptide GQ377624_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J221). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377628_HBc_P-C Product feature CHAIN GQ377628_HBc_P-C of FT:mat_peptide GQ377628_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J232). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377631_HBc_P-C Product feature CHAIN GQ377631_HBc_P-C of FT:mat_peptide GQ377631_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J239). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377632_HBc_P-C Product feature CHAIN GQ377632_HBc_P-C of FT:mat_peptide GQ377632_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J240). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377636_HBc_P-C Product feature CHAIN GQ377636_HBc_P-C of FT:mat_peptide GQ377636_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J248). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377637_HBc_P-C Product feature CHAIN GQ377637_HBc_P-C of FT:mat_peptide GQ377637_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J249). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377640_HBc_P-C Product feature CHAIN GQ377640_HBc_P-C of FT:mat_peptide GQ377640_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J253). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377642_HBc_P-C Product feature CHAIN GQ377642_HBc_P-C of FT:mat_peptide GQ377642_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J256). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475305_HBc_P-C Product feature CHAIN GQ475305_HBc_P-C of FT:mat_peptide GQ475305_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR1CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475306_HBc_P-C Product feature CHAIN GQ475306_HBc_P-C of FT:mat_peptide GQ475306_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR2CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475307_HBc_P-C Product feature CHAIN GQ475307_HBc_P-C of FT:mat_peptide GQ475307_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR3CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475308_HBc_P-C Product feature CHAIN GQ475308_HBc_P-C of FT:mat_peptide GQ475308_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR4CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475309_HBc_P-C Product feature CHAIN GQ475309_HBc_P-C of FT:mat_peptide GQ475309_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR5CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475310_HBc_P-C Product feature CHAIN GQ475310_HBc_P-C of FT:mat_peptide GQ475310_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR6CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475311_HBc_P-C Product feature CHAIN GQ475311_HBc_P-C of FT:mat_peptide GQ475311_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR7CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475312_HBc_P-C Product feature CHAIN GQ475312_HBc_P-C of FT:mat_peptide GQ475312_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR8CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475313_HBc_P-C Product feature CHAIN GQ475313_HBc_P-C of FT:mat_peptide GQ475313_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR9CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475314_HBc_P-C Product feature CHAIN GQ475314_HBc_P-C of FT:mat_peptide GQ475314_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR10CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475315_HBc_P-C Product feature CHAIN GQ475315_HBc_P-C of FT:mat_peptide GQ475315_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR11CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475316_HBc_P-C Product feature CHAIN GQ475316_HBc_P-C of FT:mat_peptide GQ475316_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR12CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475317_HBc_P-C Product feature CHAIN GQ475317_HBc_P-C of FT:mat_peptide GQ475317_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR13CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475318_HBc_P-C Product feature CHAIN GQ475318_HBc_P-C of FT:mat_peptide GQ475318_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR14CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475319_HBc_P-C Product feature CHAIN GQ475319_HBc_P-C of FT:mat_peptide GQ475319_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR15CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475320_HBc_P-C Product feature CHAIN GQ475320_HBc_P-C of FT:mat_peptide GQ475320_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR16CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475321_HBc_P-C Product feature CHAIN GQ475321_HBc_P-C of FT:mat_peptide GQ475321_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR17CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ475322_HBc_P-C Product feature CHAIN GQ475322_HBc_P-C of FT:mat_peptide GQ475322_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR18LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475324_HBc_P-C Product feature CHAIN GQ475324_HBc_P-C of FT:mat_peptide GQ475324_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR20LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475325_HBc_P-C Product feature CHAIN GQ475325_HBc_P-C of FT:mat_peptide GQ475325_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR21LC). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GQ475326_HBc_P-C Product feature CHAIN GQ475326_HBc_P-C of FT:mat_peptide GQ475326_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR22LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ475327_HBc_P-C Product feature CHAIN GQ475327_HBc_P-C of FT:mat_peptide GQ475327_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR23LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475328_HBc_P-C Product feature CHAIN GQ475328_HBc_P-C of FT:mat_peptide GQ475328_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR24LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475329_HBc_P-C Product feature CHAIN GQ475329_HBc_P-C of FT:mat_peptide GQ475329_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR25LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475330_HBc_P-C Product feature CHAIN GQ475330_HBc_P-C of FT:mat_peptide GQ475330_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR26LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475331_HBc_P-C Product feature CHAIN GQ475331_HBc_P-C of FT:mat_peptide GQ475331_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR27LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475332_HBc_P-C Product feature CHAIN GQ475332_HBc_P-C of FT:mat_peptide GQ475332_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR28LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475333_HBc_P-C Product feature CHAIN GQ475333_HBc_P-C of FT:mat_peptide GQ475333_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR29LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475334_HBc_P-C Product feature CHAIN GQ475334_HBc_P-C of FT:mat_peptide GQ475334_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR30LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475336_HBc_P-C Product feature CHAIN GQ475336_HBc_P-C of FT:mat_peptide GQ475336_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR32LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475337_HBc_P-C Product feature CHAIN GQ475337_HBc_P-C of FT:mat_peptide GQ475337_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR33LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLMWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475338_HBc_P-C Product feature CHAIN GQ475338_HBc_P-C of FT:mat_peptide GQ475338_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR34LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475339_HBc_P-C Product feature CHAIN GQ475339_HBc_P-C of FT:mat_peptide GQ475339_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR35HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475341_HBc_P-C Product feature CHAIN GQ475341_HBc_P-C of FT:mat_peptide GQ475341_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR37HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ475342_HBc_P-C Product feature CHAIN GQ475342_HBc_P-C of FT:mat_peptide GQ475342_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR38HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475343_HBc_P-C Product feature CHAIN GQ475343_HBc_P-C of FT:mat_peptide GQ475343_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR39HCC). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPPVRDLLDTASALYREALESSEHCSPHHTALRQAILCWGELMDLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTPYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ475344_HBc_P-C Product feature CHAIN GQ475344_HBc_P-C of FT:mat_peptide GQ475344_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR40HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475345_HBc_P-C Product feature CHAIN GQ475345_HBc_P-C of FT:mat_peptide GQ475345_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR41HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475346_HBc_P-C Product feature CHAIN GQ475346_HBc_P-C of FT:mat_peptide GQ475346_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR42HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475347_HBc_P-C Product feature CHAIN GQ475347_HBc_P-C of FT:mat_peptide GQ475347_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR43HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475348_HBc_P-C Product feature CHAIN GQ475348_HBc_P-C of FT:mat_peptide GQ475348_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR44HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475349_HBc_P-C Product feature CHAIN GQ475349_HBc_P-C of FT:mat_peptide GQ475349_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR45HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475350_HBc_P-C Product feature CHAIN GQ475350_HBc_P-C of FT:mat_peptide GQ475350_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR46HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475351_HBc_P-C Product feature CHAIN GQ475351_HBc_P-C of FT:mat_peptide GQ475351_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR47HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRATVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475352_HBc_P-C Product feature CHAIN GQ475352_HBc_P-C of FT:mat_peptide GQ475352_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR48HCC). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPPVRDLLDTASALYREALESSEHCSPHHTALRQAILCWGELMDLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTPYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ475354_HBc_P-C Product feature CHAIN GQ475354_HBc_P-C of FT:mat_peptide GQ475354_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR50HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475355_HBc_P-C Product feature CHAIN GQ475355_HBc_P-C of FT:mat_peptide GQ475355_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR51HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVRYVNVNMGLKARQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475356_HBc_P-C Product feature CHAIN GQ475356_HBc_P-C of FT:mat_peptide GQ475356_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR52HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475357_HBc_P-C Product feature CHAIN GQ475357_HBc_P-C of FT:mat_peptide GQ475357_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR53HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855523_HBc_P-C Product feature CHAIN GQ855523_HBc_P-C of FT:mat_peptide GQ855523_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 37). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855525_HBc_P-C Product feature CHAIN GQ855525_HBc_P-C of FT:mat_peptide GQ855525_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 96). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855528_HBc_P-C Product feature CHAIN GQ855528_HBc_P-C of FT:mat_peptide GQ855528_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 140). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855534_HBc_P-C Product feature CHAIN GQ855534_HBc_P-C of FT:mat_peptide GQ855534_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 266). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855541_HBc_P-C Product feature CHAIN GQ855541_HBc_P-C of FT:mat_peptide GQ855541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 385). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIKQLLRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855543_HBc_P-C Product feature CHAIN GQ855543_HBc_P-C of FT:mat_peptide GQ855543_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 416). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|GQ855544_HBc_P-C Product feature CHAIN GQ855544_HBc_P-C of FT:mat_peptide GQ855544_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 423). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855548_HBc_P-C Product feature CHAIN GQ855548_HBc_P-C of FT:mat_peptide GQ855548_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 512). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ872210_HBc_P-C Product feature CHAIN GQ872210_HBc_P-C of FT:mat_peptide GQ872210_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKKFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ872211_HBc_P-C Product feature CHAIN GQ872211_HBc_P-C of FT:mat_peptide GQ872211_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924604_HBc_P-C Product feature CHAIN GQ924604_HBc_P-C of FT:mat_peptide GQ924604_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924609_HBc_P-C Product feature CHAIN GQ924609_HBc_P-C of FT:mat_peptide GQ924609_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRXRSQSPRRRRSQSREXQC
>gnl|hbvpro|GQ924612_HBc_P-C Product feature CHAIN GQ924612_HBc_P-C of FT:mat_peptide GQ924612_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GQ924613_HBc_P-C Product feature CHAIN GQ924613_HBc_P-C of FT:mat_peptide GQ924613_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30b). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GQ924614_HBc_P-C Product feature CHAIN GQ924614_HBc_P-C of FT:mat_peptide GQ924614_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924615_HBc_P-C Product feature CHAIN GQ924615_HBc_P-C of FT:mat_peptide GQ924615_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSYHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924616_HBc_P-C Product feature CHAIN GQ924616_HBc_P-C of FT:mat_peptide GQ924616_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924619_HBc_P-C Product feature CHAIN GQ924619_HBc_P-C of FT:mat_peptide GQ924619_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M37). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPTNAPILSTLPETCVVRQRGRSPRRRT
PSPXRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ924620_HBc_C-C Product feature CHAIN GQ924620_HBc_C-C of FT:mat_peptide GQ924620_HBc_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQATLCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924622_HBc_P-C Product feature CHAIN GQ924622_HBc_P-C of FT:mat_peptide GQ924622_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924623_HBc_P-C Product feature CHAIN GQ924623_HBc_P-C of FT:mat_peptide GQ924623_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M41). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ924629_HBc_P-C Product feature CHAIN GQ924629_HBc_P-C of FT:mat_peptide GQ924629_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSXRRRT
PSSCRXRSQSXSRRRSQCRECQX
>gnl|hbvpro|GQ924633_HBc_P-C Product feature CHAIN GQ924633_HBc_P-C of FT:mat_peptide GQ924633_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M56). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924636_HBc_P-C Product feature CHAIN GQ924636_HBc_P-C of FT:mat_peptide GQ924636_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M68). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSHRRRT
PSPRRRRSQSPRRRRSQCRECQC
>gnl|hbvpro|GQ924642_HBc_P-C Product feature CHAIN GQ924642_HBc_P-C of FT:mat_peptide GQ924642_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M77). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPNDFFPSMRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKLRQIFWFHISCLMFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924643_HBc_P-C Product feature CHAIN GQ924643_HBc_P-C of FT:mat_peptide GQ924643_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M78). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPADFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPVPYRPQNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|GQ924649_HBc_P-C Product feature CHAIN GQ924649_HBc_P-C of FT:mat_peptide GQ924649_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924650_HBc_P-C Product feature CHAIN GQ924650_HBc_P-C of FT:mat_peptide GQ924650_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M87). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPNIRDLLDTASALFREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924655_HBc_P-C Product feature CHAIN GQ924655_HBc_P-C of FT:mat_peptide GQ924655_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M92). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924658_HBc_P-C Product feature CHAIN GQ924658_HBc_P-C of FT:mat_peptide GQ924658_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M95). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGKETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU434374_HBc_P-C Product feature CHAIN GU434374_HBc_P-C of FT:mat_peptide GU434374_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 214-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563561_HBc_P-C Product feature CHAIN GU563561_HBc_P-C of FT:mat_peptide GU563561_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BV-153). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU721029_HBc_P-C Product feature CHAIN GU721029_HBc_P-C of FT:mat_peptide GU721029_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CMCL107). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU827639_HBc_P-C Product feature CHAIN GU827639_HBc_P-C of FT:mat_peptide GU827639_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CMCL6). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SREAVVGYVNVNMGLKLRQLLWFHISCLTFGRTTVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGGSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011465_HBc_P-C Product feature CHAIN HM011465_HBc_P-C of FT:mat_peptide HM011465_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011468_HBc_P-C Product feature CHAIN HM011468_HBc_P-C of FT:mat_peptide HM011468_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011481_HBc_P-C Product feature CHAIN HM011481_HBc_P-C of FT:mat_peptide HM011481_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPPVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011486_HBc_P-C Product feature CHAIN HM011486_HBc_P-C of FT:mat_peptide HM011486_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SREXVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXXYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXSXC
>gnl|hbvpro|HM011488_HBc_P-C Product feature CHAIN HM011488_HBc_P-C of FT:mat_peptide HM011488_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011489_HBc_P-C Product feature CHAIN HM011489_HBc_P-C of FT:mat_peptide HM011489_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011491_HBc_P-C Product feature CHAIN HM011491_HBc_P-C of FT:mat_peptide HM011491_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011493_HBc_P-C Product feature CHAIN HM011493_HBc_P-C of FT:mat_peptide HM011493_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011495_HBc_P-C Product feature CHAIN HM011495_HBc_P-C of FT:mat_peptide HM011495_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPXYRPXNAPILSTLPETTVVRXRXRTPRRRT
PSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|HM011497_HBc_P-C Product feature CHAIN HM011497_HBc_P-C of FT:mat_peptide HM011497_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011500_HBc_P-C Product feature CHAIN HM011500_HBc_P-C of FT:mat_peptide HM011500_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRNTVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRPRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|HM011502_HBc_P-C Product feature CHAIN HM011502_HBc_P-C of FT:mat_peptide HM011502_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRZSQC
>gnl|hbvpro|HM042269_HBc_P-C Product feature CHAIN HM042269_HBc_P-C of FT:mat_peptide HM042269_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 475). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLVTWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750131_HBc_P-C Product feature CHAIN HM750131_HBc_P-C of FT:mat_peptide HM750131_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750132_HBc_P-C Product feature CHAIN HM750132_HBc_P-C of FT:mat_peptide HM750132_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750134_HBc_P-C Product feature CHAIN HM750134_HBc_P-C of FT:mat_peptide HM750134_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750135_HBc_P-C Product feature CHAIN HM750135_HBc_P-C of FT:mat_peptide HM750135_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGKKTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|HM750136_HBc_P-C Product feature CHAIN HM750136_HBc_P-C of FT:mat_peptide HM750136_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSDC-53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750137_HBc_P-C Product feature CHAIN HM750137_HBc_P-C of FT:mat_peptide HM750137_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750138_HBc_P-C Product feature CHAIN HM750138_HBc_P-C of FT:mat_peptide HM750138_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-100). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750139_HBc_P-C Product feature CHAIN HM750139_HBc_P-C of FT:mat_peptide HM750139_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750140_HBc_P-C Product feature CHAIN HM750140_HBc_P-C of FT:mat_peptide HM750140_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-56). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750141_HBc_P-C Product feature CHAIN HM750141_HBc_P-C of FT:mat_peptide HM750141_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-115). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ638218_HBc_P-C Product feature CHAIN HQ638218_HBc_P-C of FT:mat_peptide HQ638218_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A64-1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700456_HBc_P-C Product feature CHAIN HQ700456_HBc_P-C of FT:mat_peptide HQ700456_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA121_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700476_HBc_P-C Product feature CHAIN HQ700476_HBc_P-C of FT:mat_peptide HQ700476_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_PA58_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLXDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRXPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700490_HBc_P-C Product feature CHAIN HQ700490_HBc_P-C of FT:mat_peptide HQ700490_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_WH23_1993). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700495_HBc_P-C Product feature CHAIN HQ700495_HBc_P-C of FT:mat_peptide HQ700495_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155PF_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700496_HBc_P-C Product feature CHAIN HQ700496_HBc_P-C of FT:mat_peptide HQ700496_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155C_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700502_HBc_P-C Product feature CHAIN HQ700502_HBc_P-C of FT:mat_peptide HQ700502_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Is_1991). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700504_HBc_P-C Product feature CHAIN HQ700504_HBc_P-C of FT:mat_peptide HQ700504_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Ve_1992). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700506_HBc_P-C Product feature CHAIN HQ700506_HBc_P-C of FT:mat_peptide HQ700506_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NC_TA32_2003). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700516_HBc_P-C Product feature CHAIN HQ700516_HBc_P-C of FT:mat_peptide HQ700516_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D029_2005). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700517_HBc_P-C Product feature CHAIN HQ700517_HBc_P-C of FT:mat_peptide HQ700517_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D058A_2005). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGXETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700522_HBc_P-C Product feature CHAIN HQ700522_HBc_P-C of FT:mat_peptide HQ700522_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_H086A_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700543_HBc_P-C Product feature CHAIN HQ700543_HBc_P-C of FT:mat_peptide HQ700543_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_P124A_2005). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNXAXXXKXLXWFPISXXTFGRETVLXYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700544_HBc_P-C Product feature CHAIN HQ700544_HBc_P-C of FT:mat_peptide HQ700544_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_T003_2A). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700555_HBc_P-C Product feature CHAIN HQ700555_HBc_P-C of FT:mat_peptide HQ700555_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD4171_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700556_HBc_P-C Product feature CHAIN HQ700556_HBc_P-C of FT:mat_peptide HQ700556_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BA4986_2002). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700558_HBc_P-C Product feature CHAIN HQ700558_HBc_P-C of FT:mat_peptide HQ700558_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5375_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700559_HBc_P-C Product feature CHAIN HQ700559_HBc_P-C of FT:mat_peptide HQ700559_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5561_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700561_HBc_P-C Product feature CHAIN HQ700561_HBc_P-C of FT:mat_peptide HQ700561_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BF7376_2002). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700562_HBc_P-C Product feature CHAIN HQ700562_HBc_P-C of FT:mat_peptide HQ700562_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tomga_BH5413_2002). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700563_HBc_P-C Product feature CHAIN HQ700563_HBc_P-C of FT:mat_peptide HQ700563_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BL9389_2002). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700564_HBc_P-C Product feature CHAIN HQ700564_HBc_P-C of FT:mat_peptide HQ700564_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BQ3589_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700565_HBc_P-C Product feature CHAIN HQ700565_HBc_P-C of FT:mat_peptide HQ700565_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BR6895_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700566_HBc_P-C Product feature CHAIN HQ700566_HBc_P-C of FT:mat_peptide HQ700566_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_JN1142_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700567_HBc_P-C Product feature CHAIN HQ700567_HBc_P-C of FT:mat_peptide HQ700567_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To268_2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700568_HBc_P-C Product feature CHAIN HQ700568_HBc_P-C of FT:mat_peptide HQ700568_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To281_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700569_HBc_P-C Product feature CHAIN HQ700569_HBc_P-C of FT:mat_peptide HQ700569_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To347_2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700570_HBc_P-C Product feature CHAIN HQ700570_HBc_P-C of FT:mat_peptide HQ700570_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To356_2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|HQ700571_HBc_P-C Product feature CHAIN HQ700571_HBc_P-C of FT:mat_peptide HQ700571_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To391_2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700572_HBc_P-C Product feature CHAIN HQ700572_HBc_P-C of FT:mat_peptide HQ700572_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To422_2007). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700573_HBc_P-C Product feature CHAIN HQ700573_HBc_P-C of FT:mat_peptide HQ700573_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To426_2007). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700574_HBc_P-C Product feature CHAIN HQ700574_HBc_P-C of FT:mat_peptide HQ700574_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To400_2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700575_HBc_P-C Product feature CHAIN HQ700575_HBc_P-C of FT:mat_peptide HQ700575_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To244_2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGGNLEDPA
SRELVVNYVNINMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700576_HBc_P-C Product feature CHAIN HQ700576_HBc_P-C of FT:mat_peptide HQ700576_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To250_2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRXRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700577_HBc_P-C Product feature CHAIN HQ700577_HBc_P-C of FT:mat_peptide HQ700577_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To293_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLXDPA
SREXVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700578_HBc_P-C Product feature CHAIN HQ700578_HBc_P-C of FT:mat_peptide HQ700578_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To16_2004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLQDQA
SRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF436920_HBc_P-C Product feature CHAIN JF436920_HBc_P-C of FT:mat_peptide JF436920_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SZ6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828905_HBc_P-C Product feature CHAIN JF828905_HBc_P-C of FT:mat_peptide JF828905_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSLRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828906_HBc_P-C Product feature CHAIN JF828906_HBc_P-C of FT:mat_peptide JF828906_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828907_HBc_P-C Product feature CHAIN JF828907_HBc_P-C of FT:mat_peptide JF828907_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-3). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828908_HBc_P-C Product feature CHAIN JF828908_HBc_P-C of FT:mat_peptide JF828908_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828910_HBc_P-C Product feature CHAIN JF828910_HBc_P-C of FT:mat_peptide JF828910_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-8). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGGLMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828911_HBc_P-C Product feature CHAIN JF828911_HBc_P-C of FT:mat_peptide JF828911_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-9). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828912_HBc_P-C Product feature CHAIN JF828912_HBc_P-C of FT:mat_peptide JF828912_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-11). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828913_HBc_P-C Product feature CHAIN JF828913_HBc_P-C of FT:mat_peptide JF828913_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828915_HBc_P-C Product feature CHAIN JF828915_HBc_P-C of FT:mat_peptide JF828915_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828916_HBc_P-C Product feature CHAIN JF828916_HBc_P-C of FT:mat_peptide JF828916_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828917_HBc_P-C Product feature CHAIN JF828917_HBc_P-C of FT:mat_peptide JF828917_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828918_HBc_P-C Product feature CHAIN JF828918_HBc_P-C of FT:mat_peptide JF828918_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828919_HBc_P-C Product feature CHAIN JF828919_HBc_P-C of FT:mat_peptide JF828919_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828920_HBc_P-C Product feature CHAIN JF828920_HBc_P-C of FT:mat_peptide JF828920_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-14). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828921_HBc_P-C Product feature CHAIN JF828921_HBc_P-C of FT:mat_peptide JF828921_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828922_HBc_P-C Product feature CHAIN JF828922_HBc_P-C of FT:mat_peptide JF828922_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828923_HBc_P-C Product feature CHAIN JF828923_HBc_P-C of FT:mat_peptide JF828923_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828924_HBc_P-C Product feature CHAIN JF828924_HBc_P-C of FT:mat_peptide JF828924_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828925_HBc_P-C Product feature CHAIN JF828925_HBc_P-C of FT:mat_peptide JF828925_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828926_HBc_P-C Product feature CHAIN JF828926_HBc_P-C of FT:mat_peptide JF828926_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828928_HBc_P-C Product feature CHAIN JF828928_HBc_P-C of FT:mat_peptide JF828928_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828929_HBc_P-C Product feature CHAIN JF828929_HBc_P-C of FT:mat_peptide JF828929_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828930_HBc_P-C Product feature CHAIN JF828930_HBc_P-C of FT:mat_peptide JF828930_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828931_HBc_P-C Product feature CHAIN JF828931_HBc_P-C of FT:mat_peptide JF828931_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-15). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828937_HBc_P-C Product feature CHAIN JF828937_HBc_P-C of FT:mat_peptide JF828937_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES72-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWAGSNLEGPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JF899336_HBc_P-C Product feature CHAIN JF899336_HBc_P-C of FT:mat_peptide JF899336_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10B3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104432_HBc_P-C Product feature CHAIN JN104432_HBc_P-C of FT:mat_peptide JN104432_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104433_HBc_P-C Product feature CHAIN JN104433_HBc_P-C of FT:mat_peptide JN104433_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104434_HBc_P-C Product feature CHAIN JN104434_HBc_P-C of FT:mat_peptide JN104434_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPCRRRSQSRESQC
>gnl|hbvpro|JN104435_HBc_P-C Product feature CHAIN JN104435_HBc_P-C of FT:mat_peptide JN104435_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104437_HBc_P-C Product feature CHAIN JN104437_HBc_P-C of FT:mat_peptide JN104437_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYANVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104440_HBc_P-C Product feature CHAIN JN104440_HBc_P-C of FT:mat_peptide JN104440_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN315779_HBc_P-C Product feature CHAIN JN315779_HBc_P-C of FT:mat_peptide JN315779_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN400087_HBc_P-C Product feature CHAIN JN400087_HBc_P-C of FT:mat_peptide JN400087_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-75-Mother). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSWESQC
>gnl|hbvpro|JN400088_HBc_P-C Product feature CHAIN JN400088_HBc_P-C of FT:mat_peptide JN400088_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Baby). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDRLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN400089_HBc_P-C Product feature CHAIN JN400089_HBc_P-C of FT:mat_peptide JN400089_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Mother). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSWESQC
>gnl|hbvpro|JN827414_HBc_P-C Product feature CHAIN JN827414_HBc_P-C of FT:mat_peptide JN827414_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0015). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827415_HBc_P-C Product feature CHAIN JN827415_HBc_P-C of FT:mat_peptide JN827415_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0032). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827416_HBc_P-C Product feature CHAIN JN827416_HBc_P-C of FT:mat_peptide JN827416_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0294). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827417_HBc_P-C Product feature CHAIN JN827417_HBc_P-C of FT:mat_peptide JN827417_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0300). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827418_HBc_P-C Product feature CHAIN JN827418_HBc_P-C of FT:mat_peptide JN827418_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0904). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827420_HBc_P-C Product feature CHAIN JN827420_HBc_P-C of FT:mat_peptide JN827420_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4681). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827421_HBc_P-C Product feature CHAIN JN827421_HBc_P-C of FT:mat_peptide JN827421_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5205). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827422_HBc_P-C Product feature CHAIN JN827422_HBc_P-C of FT:mat_peptide JN827422_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5494). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827423_HBc_P-C Product feature CHAIN JN827423_HBc_P-C of FT:mat_peptide JN827423_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6359). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827424_HBc_P-C Product feature CHAIN JN827424_HBc_P-C of FT:mat_peptide JN827424_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2566). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827425_HBc_P-C Product feature CHAIN JN827425_HBc_P-C of FT:mat_peptide JN827425_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3765). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027317_HBc_P-C Product feature CHAIN JQ027317_HBc_P-C of FT:mat_peptide JQ027317_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGXNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027318_HBc_P-C Product feature CHAIN JQ027318_HBc_P-C of FT:mat_peptide JQ027318_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ027319_HBc_P-C Product feature CHAIN JQ027319_HBc_P-C of FT:mat_peptide JQ027319_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ027320_HBc_P-C Product feature CHAIN JQ027320_HBc_P-C of FT:mat_peptide JQ027320_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ027321_HBc_P-C Product feature CHAIN JQ027321_HBc_P-C of FT:mat_peptide JQ027321_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027322_HBc_P-C Product feature CHAIN JQ027322_HBc_P-C of FT:mat_peptide JQ027322_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|JQ027323_HBc_P-C Product feature CHAIN JQ027323_HBc_P-C of FT:mat_peptide JQ027323_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLDDPA
SRELIVSYVNVNMGLKXRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027324_HBc_P-C Product feature CHAIN JQ027324_HBc_P-C of FT:mat_peptide JQ027324_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRZTVLEYLVSFGVWMRTPPAYRPQNAPILSTLPETXVVRPRGRXPRRRT
PSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|JQ027332_HBc_P-C Product feature CHAIN JQ027332_HBc_P-C of FT:mat_peptide JQ027332_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQASLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQR
>gnl|hbvpro|JQ027333_HBc_P-C Product feature CHAIN JQ027333_HBc_P-C of FT:mat_peptide JQ027333_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040127_HBc_P-C Product feature CHAIN JQ040127_HBc_P-C of FT:mat_peptide JQ040127_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASXELLSFLPXDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|JQ040129_HBc_P-C Product feature CHAIN JQ040129_HBc_P-C of FT:mat_peptide JQ040129_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 88). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASSELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040131_HBc_P-C Product feature CHAIN JQ040131_HBc_P-C of FT:mat_peptide JQ040131_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 125). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDXA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ040132_HBc_P-C Product feature CHAIN JQ040132_HBc_P-C of FT:mat_peptide JQ040132_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 144). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYXEALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGXXTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQCQ
>gnl|hbvpro|JQ040133_HBc_P-C Product feature CHAIN JQ040133_HBc_P-C of FT:mat_peptide JQ040133_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 160). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040135_HBc_P-C Product feature CHAIN JQ040135_HBc_P-C of FT:mat_peptide JQ040135_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 213). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ040139_HBc_P-C Product feature CHAIN JQ040139_HBc_P-C of FT:mat_peptide JQ040139_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 256). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLQDPA
SRELIVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRQRGXXSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040141_HBc_P-C Product feature CHAIN JQ040141_HBc_P-C of FT:mat_peptide JQ040141_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 260). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040143_HBc_P-C Product feature CHAIN JQ040143_HBc_P-C of FT:mat_peptide JQ040143_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 264). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAFVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ040144_HBc_P-C Product feature CHAIN JQ040144_HBc_P-C of FT:mat_peptide JQ040144_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 272). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGXNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040145_HBc_P-C Product feature CHAIN JQ040145_HBc_P-C of FT:mat_peptide JQ040145_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 277). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIXSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040149_HBc_P-C Product feature CHAIN JQ040149_HBc_P-C of FT:mat_peptide JQ040149_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELXVXYVNVNMGLKIRQLLWFXISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ040151_HBc_P-C Product feature CHAIN JQ040151_HBc_P-C of FT:mat_peptide JQ040151_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G79). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040152_HBc_P-C Product feature CHAIN JQ040152_HBc_P-C of FT:mat_peptide JQ040152_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G172). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040154_HBc_P-C Product feature CHAIN JQ040154_HBc_P-C of FT:mat_peptide JQ040154_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G181). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040156_HBc_P-C Product feature CHAIN JQ040156_HBc_P-C of FT:mat_peptide JQ040156_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G186). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
XDIDPXKEFGASSELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040158_HBc_P-C Product feature CHAIN JQ040158_HBc_P-C of FT:mat_peptide JQ040158_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G192). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWMRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ040162_HBc_P-C Product feature CHAIN JQ040162_HBc_P-C of FT:mat_peptide JQ040162_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G216). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040163_HBc_P-C Product feature CHAIN JQ040163_HBc_P-C of FT:mat_peptide JQ040163_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G217). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040164_HBc_P-C Product feature CHAIN JQ040164_HBc_P-C of FT:mat_peptide JQ040164_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G221). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASXELLSFLPSDFFPAIRDLXDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ040165_HBc_P-C Product feature CHAIN JQ040165_HBc_P-C of FT:mat_peptide JQ040165_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G222). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLXSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040166_HBc_P-C Product feature CHAIN JQ040166_HBc_P-C of FT:mat_peptide JQ040166_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G223). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040167_HBc_P-C Product feature CHAIN JQ040167_HBc_P-C of FT:mat_peptide JQ040167_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G225). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPLDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040168_HBc_P-C Product feature CHAIN JQ040168_HBc_P-C of FT:mat_peptide JQ040168_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G233). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040172_HBc_P-C Product feature CHAIN JQ040172_HBc_P-C of FT:mat_peptide JQ040172_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G243). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341517_HBc_P-C Product feature CHAIN JQ341517_HBc_P-C of FT:mat_peptide JQ341517_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFXASVELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRQRGRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341518_HBc_P-C Product feature CHAIN JQ341518_HBc_P-C of FT:mat_peptide JQ341518_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLATWVGXNLEDXX
SRXLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341541_HBc_P-C Product feature CHAIN JQ341541_HBc_P-C of FT:mat_peptide JQ341541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXXAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341544_HBc_P-C Product feature CHAIN JQ341544_HBc_P-C of FT:mat_peptide JQ341544_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno54). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALXSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341545_HBc_P-C Product feature CHAIN JQ341545_HBc_P-C of FT:mat_peptide JQ341545_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno55). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPGYRPQXAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ429078_HBc_P-C Product feature CHAIN JQ429078_HBc_P-C of FT:mat_peptide JQ429078_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08.40.117). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQVILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ688403_HBc_P-C Product feature CHAIN JQ688403_HBc_P-C of FT:mat_peptide JQ688403_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ688404_HBc_P-C Product feature CHAIN JQ688404_HBc_P-C of FT:mat_peptide JQ688404_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707707_HBc_P-C Product feature CHAIN JQ707707_HBc_P-C of FT:mat_peptide JQ707707_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707708_HBc_P-C Product feature CHAIN JQ707708_HBc_P-C of FT:mat_peptide JQ707708_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707709_HBc_P-C Product feature CHAIN JQ707709_HBc_P-C of FT:mat_peptide JQ707709_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_13). Partial genome (Contains: HBe, HBc, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707710_HBc_P-C Product feature CHAIN JQ707710_HBc_P-C of FT:mat_peptide JQ707710_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707711_HBc_P-C Product feature CHAIN JQ707711_HBc_P-C of FT:mat_peptide JQ707711_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_15). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707712_HBc_P-C Product feature CHAIN JQ707712_HBc_P-C of FT:mat_peptide JQ707712_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_16). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707713_HBc_P-C Product feature CHAIN JQ707713_HBc_P-C of FT:mat_peptide JQ707713_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_19-5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707715_HBc_P-C Product feature CHAIN JQ707715_HBc_P-C of FT:mat_peptide JQ707715_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_22). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707716_HBc_P-C Product feature CHAIN JQ707716_HBc_P-C of FT:mat_peptide JQ707716_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_23). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707717_HBc_P-C Product feature CHAIN JQ707717_HBc_P-C of FT:mat_peptide JQ707717_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_25). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707718_HBc_P-C Product feature CHAIN JQ707718_HBc_P-C of FT:mat_peptide JQ707718_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_28). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707719_HBc_P-C Product feature CHAIN JQ707719_HBc_P-C of FT:mat_peptide JQ707719_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_29). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707720_HBc_P-C Product feature CHAIN JQ707720_HBc_P-C of FT:mat_peptide JQ707720_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_32-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707721_HBc_P-C Product feature CHAIN JQ707721_HBc_P-C of FT:mat_peptide JQ707721_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_33). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707722_HBc_P-C Product feature CHAIN JQ707722_HBc_P-C of FT:mat_peptide JQ707722_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_34). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707723_HBc_P-C Product feature CHAIN JQ707723_HBc_P-C of FT:mat_peptide JQ707723_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_35). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707724_HBc_P-C Product feature CHAIN JQ707724_HBc_P-C of FT:mat_peptide JQ707724_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_38). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707725_HBc_P-C Product feature CHAIN JQ707725_HBc_P-C of FT:mat_peptide JQ707725_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_39). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707726_HBc_P-C Product feature CHAIN JQ707726_HBc_P-C of FT:mat_peptide JQ707726_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_4). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707727_HBc_P-C Product feature CHAIN JQ707727_HBc_P-C of FT:mat_peptide JQ707727_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_40). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707728_HBc_P-C Product feature CHAIN JQ707728_HBc_P-C of FT:mat_peptide JQ707728_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_41). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707729_HBc_P-C Product feature CHAIN JQ707729_HBc_P-C of FT:mat_peptide JQ707729_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_42). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707730_HBc_P-C Product feature CHAIN JQ707730_HBc_P-C of FT:mat_peptide JQ707730_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_47). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707731_HBc_P-C Product feature CHAIN JQ707731_HBc_P-C of FT:mat_peptide JQ707731_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707732_HBc_P-C Product feature CHAIN JQ707732_HBc_P-C of FT:mat_peptide JQ707732_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707733_HBc_P-C Product feature CHAIN JQ707733_HBc_P-C of FT:mat_peptide JQ707733_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_8). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707768_HBc_P-C Product feature CHAIN JQ707768_HBc_P-C of FT:mat_peptide JQ707768_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_10A-6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707769_HBc_P-C Product feature CHAIN JQ707769_HBc_P-C of FT:mat_peptide JQ707769_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_13A). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707770_HBc_P-C Product feature CHAIN JQ707770_HBc_P-C of FT:mat_peptide JQ707770_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_14B). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707771_HBc_P-C Product feature CHAIN JQ707771_HBc_P-C of FT:mat_peptide JQ707771_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_20B). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707772_HBc_P-C Product feature CHAIN JQ707772_HBc_P-C of FT:mat_peptide JQ707772_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_26A). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707773_HBc_P-C Product feature CHAIN JQ707773_HBc_P-C of FT:mat_peptide JQ707773_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_27A). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707774_HBc_P-C Product feature CHAIN JQ707774_HBc_P-C of FT:mat_peptide JQ707774_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_C4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETCVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801470_HBc_P-C Product feature CHAIN JQ801470_HBc_P-C of FT:mat_peptide JQ801470_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801472_HBc_P-C Product feature CHAIN JQ801472_HBc_P-C of FT:mat_peptide JQ801472_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPVNAPILSTLPETTVVRPRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801473_HBc_P-C Product feature CHAIN JQ801473_HBc_P-C of FT:mat_peptide JQ801473_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFVVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801475_HBc_P-C Product feature CHAIN JQ801475_HBc_P-C of FT:mat_peptide JQ801475_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801480_HBc_P-C Product feature CHAIN JQ801480_HBc_P-C of FT:mat_peptide JQ801480_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS24). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPA
SREVVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|JQ801481_HBc_P-C Product feature CHAIN JQ801481_HBc_P-C of FT:mat_peptide JQ801481_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801482_HBc_P-C Product feature CHAIN JQ801482_HBc_P-C of FT:mat_peptide JQ801482_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801483_HBc_P-C Product feature CHAIN JQ801483_HBc_P-C of FT:mat_peptide JQ801483_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS28). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801486_HBc_P-C Product feature CHAIN JQ801486_HBc_P-C of FT:mat_peptide JQ801486_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801487_HBc_P-C Product feature CHAIN JQ801487_HBc_P-C of FT:mat_peptide JQ801487_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS34). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801488_HBc_P-C Product feature CHAIN JQ801488_HBc_P-C of FT:mat_peptide JQ801488_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801489_HBc_P-C Product feature CHAIN JQ801489_HBc_P-C of FT:mat_peptide JQ801489_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS36). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGESMNLATWVGSNLEDPA
SRELVVSYVNVNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801490_HBc_P-C Product feature CHAIN JQ801490_HBc_P-C of FT:mat_peptide JQ801490_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ801491_HBc_P-C Product feature CHAIN JQ801491_HBc_P-C of FT:mat_peptide JQ801491_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQEILCWGELMNLATWVGSNLEDPA
SRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801493_HBc_P-C Product feature CHAIN JQ801493_HBc_P-C of FT:mat_peptide JQ801493_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRQRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801495_HBc_P-C Product feature CHAIN JQ801495_HBc_P-C of FT:mat_peptide JQ801495_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPG
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801496_HBc_P-C Product feature CHAIN JQ801496_HBc_P-C of FT:mat_peptide JQ801496_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801497_HBc_P-C Product feature CHAIN JQ801497_HBc_P-C of FT:mat_peptide JQ801497_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801498_HBc_P-C Product feature CHAIN JQ801498_HBc_P-C of FT:mat_peptide JQ801498_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLDDPT
SREAVVSYVNVNMGIKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRGSRGGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ801499_HBc_P-C Product feature CHAIN JQ801499_HBc_P-C of FT:mat_peptide JQ801499_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSYHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801500_HBc_P-C Product feature CHAIN JQ801500_HBc_P-C of FT:mat_peptide JQ801500_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRESVVSYVNVNMGIKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801501_HBc_P-C Product feature CHAIN JQ801501_HBc_P-C of FT:mat_peptide JQ801501_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801502_HBc_P-C Product feature CHAIN JQ801502_HBc_P-C of FT:mat_peptide JQ801502_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801503_HBc_P-C Product feature CHAIN JQ801503_HBc_P-C of FT:mat_peptide JQ801503_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JQ801504_HBc_P-C Product feature CHAIN JQ801504_HBc_P-C of FT:mat_peptide JQ801504_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801505_HBc_P-C Product feature CHAIN JQ801505_HBc_P-C of FT:mat_peptide JQ801505_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801508_HBc_P-C Product feature CHAIN JQ801508_HBc_P-C of FT:mat_peptide JQ801508_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL16). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPQDFFPNVRDLLDTATALYREALESPEHCTPHHTALRQAIVCWGELMNLATWVGGNLQDPA
SREAVVNYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|JQ801509_HBc_P-C Product feature CHAIN JQ801509_HBc_P-C of FT:mat_peptide JQ801509_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL17). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801510_HBc_P-C Product feature CHAIN JQ801510_HBc_P-C of FT:mat_peptide JQ801510_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL18). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRQGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801511_HBc_P-C Product feature CHAIN JQ801511_HBc_P-C of FT:mat_peptide JQ801511_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801513_HBc_P-C Product feature CHAIN JQ801513_HBc_P-C of FT:mat_peptide JQ801513_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801515_HBc_P-C Product feature CHAIN JQ801515_HBc_P-C of FT:mat_peptide JQ801515_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLMFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRSRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801517_HBc_P-C Product feature CHAIN JQ801517_HBc_P-C of FT:mat_peptide JQ801517_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL25). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPDDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGIKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVRQRRRSLRRRT
PSPRRRRSQSPRRGRSPSRGSQC
>gnl|hbvpro|JQ801518_HBc_P-C Product feature CHAIN JQ801518_HBc_P-C of FT:mat_peptide JQ801518_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTRPETNVVIRRGRSHRRRT
PSHSKRRSQSSRSRRCQSRESQC
>gnl|hbvpro|JQ801519_HBc_P-C Product feature CHAIN JQ801519_HBc_P-C of FT:mat_peptide JQ801519_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801520_HBc_P-C Product feature CHAIN JQ801520_HBc_P-C of FT:mat_peptide JQ801520_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRKT
PSPPTRRSQSPPRRRSQSRESQC
>gnl|hbvpro|JQ801522_HBc_P-C Product feature CHAIN JQ801522_HBc_P-C of FT:mat_peptide JQ801522_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSRRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801523_HBc_P-C Product feature CHAIN JQ801523_HBc_P-C of FT:mat_peptide JQ801523_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSLLDPLYTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAAWVGSNLEDPA
SRELLVSYVNVNTGLKIRQLLWFHITCLTLGRETVLEELVPFARWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PTPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026877_HBc_P-C Product feature CHAIN JX026877_HBc_P-C of FT:mat_peptide JX026877_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026878_HBc_P-C Product feature CHAIN JX026878_HBc_P-C of FT:mat_peptide JX026878_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JX026880_HBc_P-C Product feature CHAIN JX026880_HBc_P-C of FT:mat_peptide JX026880_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-23). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRHAILCWGELMNLATWVGGNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JX026884_HBc_P-C Product feature CHAIN JX026884_HBc_P-C of FT:mat_peptide JX026884_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-60). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026885_HBc_P-C Product feature CHAIN JX026885_HBc_P-C of FT:mat_peptide JX026885_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-64). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026888_HBc_P-C Product feature CHAIN JX026888_HBc_P-C of FT:mat_peptide JX026888_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRLPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX036335_HBc_P-C Product feature CHAIN JX036335_HBc_P-C of FT:mat_peptide JX036335_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-71_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX036336_HBc_P-C Product feature CHAIN JX036336_HBc_P-C of FT:mat_peptide JX036336_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-23_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX036337_HBc_P-C Product feature CHAIN JX036337_HBc_P-C of FT:mat_peptide JX036337_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-75_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX036338_HBc_P-C Product feature CHAIN JX036338_HBc_P-C of FT:mat_peptide JX036338_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-29_CD1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX036339_HBc_P-C Product feature CHAIN JX036339_HBc_P-C of FT:mat_peptide JX036339_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-77_CD). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX429903_HBc_P-C Product feature CHAIN JX429903_HBc_P-C of FT:mat_peptide JX429903_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429904_HBc_P-C Product feature CHAIN JX429904_HBc_P-C of FT:mat_peptide JX429904_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429905_HBc_P-C Product feature CHAIN JX429905_HBc_P-C of FT:mat_peptide JX429905_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALASPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429906_HBc_P-C Product feature CHAIN JX429906_HBc_P-C of FT:mat_peptide JX429906_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429907_HBc_P-C Product feature CHAIN JX429907_HBc_P-C of FT:mat_peptide JX429907_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429909_HBc_P-C Product feature CHAIN JX429909_HBc_P-C of FT:mat_peptide JX429909_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429912_HBc_P-C Product feature CHAIN JX429912_HBc_P-C of FT:mat_peptide JX429912_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429913_HBc_P-C Product feature CHAIN JX429913_HBc_P-C of FT:mat_peptide JX429913_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429915_HBc_P-C Product feature CHAIN JX429915_HBc_P-C of FT:mat_peptide JX429915_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429916_HBc_P-C Product feature CHAIN JX429916_HBc_P-C of FT:mat_peptide JX429916_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429917_HBc_P-C Product feature CHAIN JX429917_HBc_P-C of FT:mat_peptide JX429917_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429918_HBc_P-C Product feature CHAIN JX429918_HBc_P-C of FT:mat_peptide JX429918_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYEEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504534_HBc_P-C Product feature CHAIN JX504534_HBc_P-C of FT:mat_peptide JX504534_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JX504535_HBc_P-C Product feature CHAIN JX504535_HBc_P-C of FT:mat_peptide JX504535_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALQSPEHCSPHHTAIRQAILCSGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRQTVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504536_HBc_P-C Product feature CHAIN JX504536_HBc_P-C of FT:mat_peptide JX504536_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVARRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504537_HBc_P-C Product feature CHAIN JX504537_HBc_P-C of FT:mat_peptide JX504537_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-49). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504539_HBc_P-C Product feature CHAIN JX504539_HBc_P-C of FT:mat_peptide JX504539_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIQDLRDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504541_HBc_P-C Product feature CHAIN JX504541_HBc_P-C of FT:mat_peptide JX504541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504542_HBc_P-C Product feature CHAIN JX504542_HBc_P-C of FT:mat_peptide JX504542_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504544_HBc_P-C Product feature CHAIN JX504544_HBc_P-C of FT:mat_peptide JX504544_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504545_HBc_P-C Product feature CHAIN JX504545_HBc_P-C of FT:mat_peptide JX504545_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504546_HBc_P-C Product feature CHAIN JX504546_HBc_P-C of FT:mat_peptide JX504546_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507211_HBc_P-C Product feature CHAIN JX507211_HBc_P-C of FT:mat_peptide JX507211_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SREAVVNYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPLNAPILSTLPETTVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507212_HBc_P-C Product feature CHAIN JX507212_HBc_P-C of FT:mat_peptide JX507212_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAQLLSFLPSDFFPSIRDLLDTAAALYREALESPEQCSPHHTALRQAILCWGELMNLATWVGSNLEDPT
SREAVVGYVNVNMGLKLRQXLWFHISCLTFGRHTVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRQRXRSPRRRT
SPPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507214_HBc_P-C Product feature CHAIN JX507214_HBc_P-C of FT:mat_peptide JX507214_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 99). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTTLRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX560519_HBc_P-C Product feature CHAIN JX560519_HBc_P-C of FT:mat_peptide JX560519_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX560520_HBc_P-C Product feature CHAIN JX560520_HBc_P-C of FT:mat_peptide JX560520_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH139). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661488_HBc_P-C Product feature CHAIN JX661488_HBc_P-C of FT:mat_peptide JX661488_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1212-C5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JX661489_HBc_P-C Product feature CHAIN JX661489_HBc_P-C of FT:mat_peptide JX661489_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1218-C9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661490_HBc_P-C Product feature CHAIN JX661490_HBc_P-C of FT:mat_peptide JX661490_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1217-C8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661491_HBc_P-C Product feature CHAIN JX661491_HBc_P-C of FT:mat_peptide JX661491_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1222-C10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661492_HBc_P-C Product feature CHAIN JX661492_HBc_P-C of FT:mat_peptide JX661492_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1215-C7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661493_HBc_P-C Product feature CHAIN JX661493_HBc_P-C of FT:mat_peptide JX661493_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1226-C13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661495_HBc_P-C Product feature CHAIN JX661495_HBc_P-C of FT:mat_peptide JX661495_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1223-C11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661496_HBc_P-C Product feature CHAIN JX661496_HBc_P-C of FT:mat_peptide JX661496_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1208-C4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661497_HBc_P-C Product feature CHAIN JX661497_HBc_P-C of FT:mat_peptide JX661497_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1228-C14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAFLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JX870000_HBc_P-C Product feature CHAIN JX870000_HBc_P-C of FT:mat_peptide JX870000_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 245). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSLHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRX
PXPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC315399_HBc_P-C Product feature CHAIN KC315399_HBc_P-C of FT:mat_peptide KC315399_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0507). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRQRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774179_HBc_P-C Product feature CHAIN KC774179_HBc_P-C of FT:mat_peptide KC774179_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SX11xa1580). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774180_HBc_P-C Product feature CHAIN KC774180_HBc_P-C of FT:mat_peptide KC774180_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1002). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774181_HBc_P-C Product feature CHAIN KC774181_HBc_P-C of FT:mat_peptide KC774181_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1012). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774182_HBc_P-C Product feature CHAIN KC774182_HBc_P-C of FT:mat_peptide KC774182_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774184_HBc_P-C Product feature CHAIN KC774184_HBc_P-C of FT:mat_peptide KC774184_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1022). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774185_HBc_P-C Product feature CHAIN KC774185_HBc_P-C of FT:mat_peptide KC774185_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1023). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774187_HBc_P-C Product feature CHAIN KC774187_HBc_P-C of FT:mat_peptide KC774187_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1027). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774189_HBc_P-C Product feature CHAIN KC774189_HBc_P-C of FT:mat_peptide KC774189_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1030). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774190_HBc_P-C Product feature CHAIN KC774190_HBc_P-C of FT:mat_peptide KC774190_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1031). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774191_HBc_P-C Product feature CHAIN KC774191_HBc_P-C of FT:mat_peptide KC774191_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1032). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774192_HBc_P-C Product feature CHAIN KC774192_HBc_P-C of FT:mat_peptide KC774192_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1034). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774194_HBc_P-C Product feature CHAIN KC774194_HBc_P-C of FT:mat_peptide KC774194_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1036). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774195_HBc_P-C Product feature CHAIN KC774195_HBc_P-C of FT:mat_peptide KC774195_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1046). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774196_HBc_P-C Product feature CHAIN KC774196_HBc_P-C of FT:mat_peptide KC774196_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2015). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774197_HBc_P-C Product feature CHAIN KC774197_HBc_P-C of FT:mat_peptide KC774197_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2035). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774199_HBc_P-C Product feature CHAIN KC774199_HBc_P-C of FT:mat_peptide KC774199_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2040). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPNAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774200_HBc_P-C Product feature CHAIN KC774200_HBc_P-C of FT:mat_peptide KC774200_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2044). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774202_HBc_P-C Product feature CHAIN KC774202_HBc_P-C of FT:mat_peptide KC774202_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2048). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774203_HBc_P-C Product feature CHAIN KC774203_HBc_P-C of FT:mat_peptide KC774203_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2051). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774204_HBc_P-C Product feature CHAIN KC774204_HBc_P-C of FT:mat_peptide KC774204_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2056). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774205_HBc_P-C Product feature CHAIN KC774205_HBc_P-C of FT:mat_peptide KC774205_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2058). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774206_HBc_P-C Product feature CHAIN KC774206_HBc_P-C of FT:mat_peptide KC774206_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2079). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774207_HBc_P-C Product feature CHAIN KC774207_HBc_P-C of FT:mat_peptide KC774207_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2084). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774208_HBc_P-C Product feature CHAIN KC774208_HBc_P-C of FT:mat_peptide KC774208_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2086). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774209_HBc_P-C Product feature CHAIN KC774209_HBc_P-C of FT:mat_peptide KC774209_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2087). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774210_HBc_P-C Product feature CHAIN KC774210_HBc_P-C of FT:mat_peptide KC774210_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2098). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774211_HBc_P-C Product feature CHAIN KC774211_HBc_P-C of FT:mat_peptide KC774211_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774213_HBc_P-C Product feature CHAIN KC774213_HBc_P-C of FT:mat_peptide KC774213_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2123). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774214_HBc_P-C Product feature CHAIN KC774214_HBc_P-C of FT:mat_peptide KC774214_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2124). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774215_HBc_P-C Product feature CHAIN KC774215_HBc_P-C of FT:mat_peptide KC774215_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2125). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774216_HBc_P-C Product feature CHAIN KC774216_HBc_P-C of FT:mat_peptide KC774216_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2126). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774217_HBc_P-C Product feature CHAIN KC774217_HBc_P-C of FT:mat_peptide KC774217_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774218_HBc_P-C Product feature CHAIN KC774218_HBc_P-C of FT:mat_peptide KC774218_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2134). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774219_HBc_P-C Product feature CHAIN KC774219_HBc_P-C of FT:mat_peptide KC774219_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774220_HBc_P-C Product feature CHAIN KC774220_HBc_P-C of FT:mat_peptide KC774220_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2152). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774221_HBc_P-C Product feature CHAIN KC774221_HBc_P-C of FT:mat_peptide KC774221_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2153). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KC774223_HBc_P-C Product feature CHAIN KC774223_HBc_P-C of FT:mat_peptide KC774223_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2183). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774224_HBc_P-C Product feature CHAIN KC774224_HBc_P-C of FT:mat_peptide KC774224_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2184). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774225_HBc_P-C Product feature CHAIN KC774225_HBc_P-C of FT:mat_peptide KC774225_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2188). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774226_HBc_P-C Product feature CHAIN KC774226_HBc_P-C of FT:mat_peptide KC774226_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2194). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFLFFQNLLNTPSALYREALKSPEHCSPHHTALRQAILGWVELINLAPWGGSNLKNPP
SRELLFTFVNVNMGLKIKQLLGFHISGLTFEKKTVLDYLGSFEVGIPPPPAYEPQNAPILSTLPKTTVVKQQGRPPKKKT
PSPPKQRSQSPRRRRSQSRGIQC
>gnl|hbvpro|KC774227_HBc_P-C Product feature CHAIN KC774227_HBc_P-C of FT:mat_peptide KC774227_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774228_HBc_P-C Product feature CHAIN KC774228_HBc_P-C of FT:mat_peptide KC774228_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1023). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774229_HBc_P-C Product feature CHAIN KC774229_HBc_P-C of FT:mat_peptide KC774229_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1024). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774231_HBc_P-C Product feature CHAIN KC774231_HBc_P-C of FT:mat_peptide KC774231_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1028). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774232_HBc_P-C Product feature CHAIN KC774232_HBc_P-C of FT:mat_peptide KC774232_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1031). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774233_HBc_P-C Product feature CHAIN KC774233_HBc_P-C of FT:mat_peptide KC774233_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1035). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774235_HBc_P-C Product feature CHAIN KC774235_HBc_P-C of FT:mat_peptide KC774235_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1041). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774236_HBc_P-C Product feature CHAIN KC774236_HBc_P-C of FT:mat_peptide KC774236_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1042). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774237_HBc_P-C Product feature CHAIN KC774237_HBc_P-C of FT:mat_peptide KC774237_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1051). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774238_HBc_P-C Product feature CHAIN KC774238_HBc_P-C of FT:mat_peptide KC774238_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1052). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774239_HBc_P-C Product feature CHAIN KC774239_HBc_P-C of FT:mat_peptide KC774239_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1063). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774240_HBc_P-C Product feature CHAIN KC774240_HBc_P-C of FT:mat_peptide KC774240_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1066). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIFSYVNVNMGLKIKQLLGFHISCLTFGKKTVLEYLGSFGVGIPTPPAYKPPNAPILSTLPETTVVKRQGRSPEKKT
PSPQKQRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774241_HBc_P-C Product feature CHAIN KC774241_HBc_P-C of FT:mat_peptide KC774241_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1067). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774242_HBc_P-C Product feature CHAIN KC774242_HBc_P-C of FT:mat_peptide KC774242_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1070). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774243_HBc_P-C Product feature CHAIN KC774243_HBc_P-C of FT:mat_peptide KC774243_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1007). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774244_HBc_P-C Product feature CHAIN KC774244_HBc_P-C of FT:mat_peptide KC774244_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1012). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774245_HBc_P-C Product feature CHAIN KC774245_HBc_P-C of FT:mat_peptide KC774245_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774247_HBc_P-C Product feature CHAIN KC774247_HBc_P-C of FT:mat_peptide KC774247_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1021). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC774248_HBc_P-C Product feature CHAIN KC774248_HBc_P-C of FT:mat_peptide KC774248_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1026). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774249_HBc_P-C Product feature CHAIN KC774249_HBc_P-C of FT:mat_peptide KC774249_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1027). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774250_HBc_P-C Product feature CHAIN KC774250_HBc_P-C of FT:mat_peptide KC774250_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1029). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774251_HBc_P-C Product feature CHAIN KC774251_HBc_P-C of FT:mat_peptide KC774251_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1030). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774252_HBc_P-C Product feature CHAIN KC774252_HBc_P-C of FT:mat_peptide KC774252_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1031). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|KC774253_HBc_P-C Product feature CHAIN KC774253_HBc_P-C of FT:mat_peptide KC774253_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1039). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELSNLATWVGSNLEDPA
SRELVVRYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774254_HBc_P-C Product feature CHAIN KC774254_HBc_P-C of FT:mat_peptide KC774254_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1046). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774255_HBc_P-C Product feature CHAIN KC774255_HBc_P-C of FT:mat_peptide KC774255_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1050). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774256_HBc_P-C Product feature CHAIN KC774256_HBc_P-C of FT:mat_peptide KC774256_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1053). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774257_HBc_P-C Product feature CHAIN KC774257_HBc_P-C of FT:mat_peptide KC774257_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1056). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774259_HBc_P-C Product feature CHAIN KC774259_HBc_P-C of FT:mat_peptide KC774259_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1061). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774260_HBc_P-C Product feature CHAIN KC774260_HBc_P-C of FT:mat_peptide KC774260_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1065). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774261_HBc_P-C Product feature CHAIN KC774261_HBc_P-C of FT:mat_peptide KC774261_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1067). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774262_HBc_P-C Product feature CHAIN KC774262_HBc_P-C of FT:mat_peptide KC774262_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1068). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774264_HBc_P-C Product feature CHAIN KC774264_HBc_P-C of FT:mat_peptide KC774264_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1072). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774265_HBc_P-C Product feature CHAIN KC774265_HBc_P-C of FT:mat_peptide KC774265_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1074). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774266_HBc_P-C Product feature CHAIN KC774266_HBc_P-C of FT:mat_peptide KC774266_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1075). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774267_HBc_P-C Product feature CHAIN KC774267_HBc_P-C of FT:mat_peptide KC774267_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1084). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774268_HBc_P-C Product feature CHAIN KC774268_HBc_P-C of FT:mat_peptide KC774268_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1085). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774269_HBc_P-C Product feature CHAIN KC774269_HBc_P-C of FT:mat_peptide KC774269_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1086). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774270_HBc_P-C Product feature CHAIN KC774270_HBc_P-C of FT:mat_peptide KC774270_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1093). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774271_HBc_P-C Product feature CHAIN KC774271_HBc_P-C of FT:mat_peptide KC774271_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1094). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774272_HBc_P-C Product feature CHAIN KC774272_HBc_P-C of FT:mat_peptide KC774272_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1107). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774274_HBc_P-C Product feature CHAIN KC774274_HBc_P-C of FT:mat_peptide KC774274_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1124). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774275_HBc_P-C Product feature CHAIN KC774275_HBc_P-C of FT:mat_peptide KC774275_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1126). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774276_HBc_P-C Product feature CHAIN KC774276_HBc_P-C of FT:mat_peptide KC774276_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1128). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774277_HBc_P-C Product feature CHAIN KC774277_HBc_P-C of FT:mat_peptide KC774277_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2151). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774278_HBc_P-C Product feature CHAIN KC774278_HBc_P-C of FT:mat_peptide KC774278_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2155). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774279_HBc_P-C Product feature CHAIN KC774279_HBc_P-C of FT:mat_peptide KC774279_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2157). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774280_HBc_P-C Product feature CHAIN KC774280_HBc_P-C of FT:mat_peptide KC774280_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1053). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774281_HBc_P-C Product feature CHAIN KC774281_HBc_P-C of FT:mat_peptide KC774281_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1058). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774282_HBc_P-C Product feature CHAIN KC774282_HBc_P-C of FT:mat_peptide KC774282_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1060). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774283_HBc_P-C Product feature CHAIN KC774283_HBc_P-C of FT:mat_peptide KC774283_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1062). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774284_HBc_P-C Product feature CHAIN KC774284_HBc_P-C of FT:mat_peptide KC774284_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1065). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KC774285_HBc_P-C Product feature CHAIN KC774285_HBc_P-C of FT:mat_peptide KC774285_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1067). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774286_HBc_P-C Product feature CHAIN KC774286_HBc_P-C of FT:mat_peptide KC774286_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1076). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774287_HBc_P-C Product feature CHAIN KC774287_HBc_P-C of FT:mat_peptide KC774287_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1087). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774288_HBc_P-C Product feature CHAIN KC774288_HBc_P-C of FT:mat_peptide KC774288_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1175). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLKPLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRTRSQSRESQC
>gnl|hbvpro|KC774289_HBc_P-C Product feature CHAIN KC774289_HBc_P-C of FT:mat_peptide KC774289_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1180). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774290_HBc_P-C Product feature CHAIN KC774290_HBc_P-C of FT:mat_peptide KC774290_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1183). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774292_HBc_P-C Product feature CHAIN KC774292_HBc_P-C of FT:mat_peptide KC774292_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1196). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774293_HBc_P-C Product feature CHAIN KC774293_HBc_P-C of FT:mat_peptide KC774293_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1204). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774295_HBc_P-C Product feature CHAIN KC774295_HBc_P-C of FT:mat_peptide KC774295_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1207). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774296_HBc_P-C Product feature CHAIN KC774296_HBc_P-C of FT:mat_peptide KC774296_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1210). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774297_HBc_P-C Product feature CHAIN KC774297_HBc_P-C of FT:mat_peptide KC774297_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1580). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774298_HBc_P-C Product feature CHAIN KC774298_HBc_P-C of FT:mat_peptide KC774298_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1586). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774299_HBc_P-C Product feature CHAIN KC774299_HBc_P-C of FT:mat_peptide KC774299_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1601). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774300_HBc_P-C Product feature CHAIN KC774300_HBc_P-C of FT:mat_peptide KC774300_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1602). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQTRESQC
>gnl|hbvpro|KC774301_HBc_P-C Product feature CHAIN KC774301_HBc_P-C of FT:mat_peptide KC774301_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1627). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774302_HBc_P-C Product feature CHAIN KC774302_HBc_P-C of FT:mat_peptide KC774302_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1650). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC774303_HBc_P-C Product feature CHAIN KC774303_HBc_P-C of FT:mat_peptide KC774303_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1659). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774304_HBc_P-C Product feature CHAIN KC774304_HBc_P-C of FT:mat_peptide KC774304_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1662). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774306_HBc_P-C Product feature CHAIN KC774306_HBc_P-C of FT:mat_peptide KC774306_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774308_HBc_P-C Product feature CHAIN KC774308_HBc_P-C of FT:mat_peptide KC774308_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2019). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774309_HBc_P-C Product feature CHAIN KC774309_HBc_P-C of FT:mat_peptide KC774309_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2020). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774310_HBc_P-C Product feature CHAIN KC774310_HBc_P-C of FT:mat_peptide KC774310_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2022). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774311_HBc_P-C Product feature CHAIN KC774311_HBc_P-C of FT:mat_peptide KC774311_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2026). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774312_HBc_P-C Product feature CHAIN KC774312_HBc_P-C of FT:mat_peptide KC774312_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2029). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774313_HBc_P-C Product feature CHAIN KC774313_HBc_P-C of FT:mat_peptide KC774313_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2032). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRKTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774314_HBc_P-C Product feature CHAIN KC774314_HBc_P-C of FT:mat_peptide KC774314_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2033). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC774315_HBc_P-C Product feature CHAIN KC774315_HBc_P-C of FT:mat_peptide KC774315_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2039). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774316_HBc_P-C Product feature CHAIN KC774316_HBc_P-C of FT:mat_peptide KC774316_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2041). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774318_HBc_P-C Product feature CHAIN KC774318_HBc_P-C of FT:mat_peptide KC774318_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2043). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774319_HBc_P-C Product feature CHAIN KC774319_HBc_P-C of FT:mat_peptide KC774319_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2044). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETAVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774320_HBc_P-C Product feature CHAIN KC774320_HBc_P-C of FT:mat_peptide KC774320_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2051). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774321_HBc_P-C Product feature CHAIN KC774321_HBc_P-C of FT:mat_peptide KC774321_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2052). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KC774325_HBc_P-C Product feature CHAIN KC774325_HBc_P-C of FT:mat_peptide KC774325_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2063). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774326_HBc_P-C Product feature CHAIN KC774326_HBc_P-C of FT:mat_peptide KC774326_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2067). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774327_HBc_P-C Product feature CHAIN KC774327_HBc_P-C of FT:mat_peptide KC774327_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2069). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774329_HBc_P-C Product feature CHAIN KC774329_HBc_P-C of FT:mat_peptide KC774329_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2074). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774330_HBc_P-C Product feature CHAIN KC774330_HBc_P-C of FT:mat_peptide KC774330_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2075). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774331_HBc_P-C Product feature CHAIN KC774331_HBc_P-C of FT:mat_peptide KC774331_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2077). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774333_HBc_P-C Product feature CHAIN KC774333_HBc_P-C of FT:mat_peptide KC774333_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774334_HBc_P-C Product feature CHAIN KC774334_HBc_P-C of FT:mat_peptide KC774334_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1007). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|KC774335_HBc_P-C Product feature CHAIN KC774335_HBc_P-C of FT:mat_peptide KC774335_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774336_HBc_P-C Product feature CHAIN KC774336_HBc_P-C of FT:mat_peptide KC774336_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1015). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774337_HBc_P-C Product feature CHAIN KC774337_HBc_P-C of FT:mat_peptide KC774337_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1019). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774338_HBc_P-C Product feature CHAIN KC774338_HBc_P-C of FT:mat_peptide KC774338_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1027). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774339_HBc_P-C Product feature CHAIN KC774339_HBc_P-C of FT:mat_peptide KC774339_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1029). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774340_HBc_P-C Product feature CHAIN KC774340_HBc_P-C of FT:mat_peptide KC774340_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1034). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPNAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774342_HBc_P-C Product feature CHAIN KC774342_HBc_P-C of FT:mat_peptide KC774342_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1044). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774343_HBc_P-C Product feature CHAIN KC774343_HBc_P-C of FT:mat_peptide KC774343_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1046). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774345_HBc_P-C Product feature CHAIN KC774345_HBc_P-C of FT:mat_peptide KC774345_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1076). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774346_HBc_P-C Product feature CHAIN KC774346_HBc_P-C of FT:mat_peptide KC774346_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1078). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774347_HBc_P-C Product feature CHAIN KC774347_HBc_P-C of FT:mat_peptide KC774347_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1092). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774348_HBc_P-C Product feature CHAIN KC774348_HBc_P-C of FT:mat_peptide KC774348_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1093). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774351_HBc_P-C Product feature CHAIN KC774351_HBc_P-C of FT:mat_peptide KC774351_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1031). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774352_HBc_P-C Product feature CHAIN KC774352_HBc_P-C of FT:mat_peptide KC774352_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1042). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQIPRRRRSQSRESQC
>gnl|hbvpro|KC774353_HBc_P-C Product feature CHAIN KC774353_HBc_P-C of FT:mat_peptide KC774353_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1043). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|KC774354_HBc_P-C Product feature CHAIN KC774354_HBc_P-C of FT:mat_peptide KC774354_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1048). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KC774355_HBc_P-C Product feature CHAIN KC774355_HBc_P-C of FT:mat_peptide KC774355_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1070). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KC774356_HBc_P-C Product feature CHAIN KC774356_HBc_P-C of FT:mat_peptide KC774356_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1080). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774357_HBc_P-C Product feature CHAIN KC774357_HBc_P-C of FT:mat_peptide KC774357_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1081). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774358_HBc_P-C Product feature CHAIN KC774358_HBc_P-C of FT:mat_peptide KC774358_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1098). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774359_HBc_P-C Product feature CHAIN KC774359_HBc_P-C of FT:mat_peptide KC774359_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1099). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774360_HBc_P-C Product feature CHAIN KC774360_HBc_P-C of FT:mat_peptide KC774360_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774361_HBc_P-C Product feature CHAIN KC774361_HBc_P-C of FT:mat_peptide KC774361_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KC836842_HBc_P-C Product feature CHAIN KC836842_HBc_P-C of FT:mat_peptide KC836842_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AH18). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLQDQA
SRELVVGYVNINMGLKFRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRCRGRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875261_HBc_P-C Product feature CHAIN KC875261_HBc_P-C of FT:mat_peptide KC875261_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV26). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875262_HBc_P-C Product feature CHAIN KC875262_HBc_P-C of FT:mat_peptide KC875262_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875263_HBc_P-C Product feature CHAIN KC875263_HBc_P-C of FT:mat_peptide KC875263_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875264_HBc_P-C Product feature CHAIN KC875264_HBc_P-C of FT:mat_peptide KC875264_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV49). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPHAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875265_HBc_P-C Product feature CHAIN KC875265_HBc_P-C of FT:mat_peptide KC875265_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPHAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875267_HBc_P-C Product feature CHAIN KC875267_HBc_P-C of FT:mat_peptide KC875267_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875268_HBc_P-C Product feature CHAIN KC875268_HBc_P-C of FT:mat_peptide KC875268_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV68). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRSSQSRESQC
>gnl|hbvpro|KC875269_HBc_P-C Product feature CHAIN KC875269_HBc_P-C of FT:mat_peptide KC875269_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV62). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRELLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875270_HBc_P-C Product feature CHAIN KC875270_HBc_P-C of FT:mat_peptide KC875270_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV63). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875271_HBc_P-C Product feature CHAIN KC875271_HBc_P-C of FT:mat_peptide KC875271_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGVKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875272_HBc_P-C Product feature CHAIN KC875272_HBc_P-C of FT:mat_peptide KC875272_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV64). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875273_HBc_P-C Product feature CHAIN KC875273_HBc_P-C of FT:mat_peptide KC875273_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV77). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF165568_HBc_P-C Product feature CHAIN KF165568_HBc_P-C of FT:mat_peptide KF165568_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2180). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KF166858_HBc_P-C Product feature CHAIN KF166858_HBc_P-C of FT:mat_peptide KF166858_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 58). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNDNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214651_HBc_P-C Product feature CHAIN KF214651_HBc_P-C of FT:mat_peptide KF214651_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KF214652_HBc_P-C Product feature CHAIN KF214652_HBc_P-C of FT:mat_peptide KF214652_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPTDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214655_HBc_P-C Product feature CHAIN KF214655_HBc_P-C of FT:mat_peptide KF214655_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214667_HBc_P-C Product feature CHAIN KF214667_HBc_P-C of FT:mat_peptide KF214667_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-19). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVNHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214668_HBc_P-C Product feature CHAIN KF214668_HBc_P-C of FT:mat_peptide KF214668_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2011-22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214669_HBc_P-C Product feature CHAIN KF214669_HBc_P-C of FT:mat_peptide KF214669_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-16). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF214670_HBc_P-C Product feature CHAIN KF214670_HBc_P-C of FT:mat_peptide KF214670_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2010-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDQA
SRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214671_HBc_P-C Product feature CHAIN KF214671_HBc_P-C of FT:mat_peptide KF214671_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2007-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWICTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214672_HBc_P-C Product feature CHAIN KF214672_HBc_P-C of FT:mat_peptide KF214672_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-18). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214673_HBc_P-C Product feature CHAIN KF214673_HBc_P-C of FT:mat_peptide KF214673_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214675_HBc_P-C Product feature CHAIN KF214675_HBc_P-C of FT:mat_peptide KF214675_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLNLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214676_HBc_P-C Product feature CHAIN KF214676_HBc_P-C of FT:mat_peptide KF214676_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214677_HBc_P-C Product feature CHAIN KF214677_HBc_P-C of FT:mat_peptide KF214677_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-15). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAASLYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF214678_HBc_P-C Product feature CHAIN KF214678_HBc_P-C of FT:mat_peptide KF214678_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-9). Partial genome (Contains: HBe, HBc, HBx, LHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF485389_HBc_P-C Product feature CHAIN KF485389_HBc_P-C of FT:mat_peptide KF485389_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF485390_HBc_P-C Product feature CHAIN KF485390_HBc_P-C of FT:mat_peptide KF485390_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKESGASVEILSFLPSDFFPXIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVXSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF495606_HBc_P-C Product feature CHAIN KF495606_HBc_P-C of FT:mat_peptide KF495606_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NT-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779242_HBc_P-C Product feature CHAIN KF779242_HBc_P-C of FT:mat_peptide KF779242_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DEN6139). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779300_HBc_P-C Product feature CHAIN KF779300_HBc_P-C of FT:mat_peptide KF779300_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MLT0980). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779327_HBc_P-C Product feature CHAIN KF779327_HBc_P-C of FT:mat_peptide KF779327_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PNF4470). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFEASWELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVNYVNINMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873514_HBc_P-C Product feature CHAIN KF873514_HBc_P-C of FT:mat_peptide KF873514_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 053_EA_Gap). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREXLESPEHCSAHHTALRQAILCWGALMNLATWVGSNLDDPA
SRELVVSYVNVNMGLQIRQLLWFHISCLTFGRTTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873516_HBc_P-C Product feature CHAIN KF873516_HBc_P-C of FT:mat_peptide KF873516_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 020_EA_Ram). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873520_HBc_P-C Product feature CHAIN KF873520_HBc_P-C of FT:mat_peptide KF873520_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 025_EA_Yir). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLNDPA
SRELVVNYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873526_HBc_P-C Product feature CHAIN KF873526_HBc_P-C of FT:mat_peptide KF873526_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 040_K_Laj). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873536_HBc_P-C Product feature CHAIN KF873536_HBc_P-C of FT:mat_peptide KF873536_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 062_WA_Man). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVXYVNVNMGLKXRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPXNAPILSTLPETTVVRQRGRXXRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF873539_HBc_P-C Product feature CHAIN KF873539_HBc_P-C of FT:mat_peptide KF873539_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 033_TI_Ngu). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873541_HBc_P-C Product feature CHAIN KF873541_HBc_P-C of FT:mat_peptide KF873541_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 042_DR_Wad). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873544_HBc_P-C Product feature CHAIN KF873544_HBc_P-C of FT:mat_peptide KF873544_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 009_DR_Wad). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASXQLLSFLPSDFFPSIRDLLDTASALYQEALESQEHCSPHHTALRQAILCWGELMNLATWVGSNLEDXA
SRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173281_HBc_P-C Product feature CHAIN KJ173281_HBc_P-C of FT:mat_peptide KJ173281_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009C(e216)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173282_HBc_P-C Product feature CHAIN KJ173282_HBc_P-C of FT:mat_peptide KJ173282_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009M(e217)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173283_HBc_P-C Product feature CHAIN KJ173283_HBc_P-C of FT:mat_peptide KJ173283_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX022C(e230)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173284_HBc_P-C Product feature CHAIN KJ173284_HBc_P-C of FT:mat_peptide KJ173284_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX022M(e231)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173285_HBc_P-C Product feature CHAIN KJ173285_HBc_P-C of FT:mat_peptide KJ173285_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX026C(e241)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173286_HBc_P-C Product feature CHAIN KJ173286_HBc_P-C of FT:mat_peptide KJ173286_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX026M(e242)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173287_HBc_P-C Product feature CHAIN KJ173287_HBc_P-C of FT:mat_peptide KJ173287_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX028C(e244)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173288_HBc_P-C Product feature CHAIN KJ173288_HBc_P-C of FT:mat_peptide KJ173288_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX028M(e245n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173289_HBc_P-C Product feature CHAIN KJ173289_HBc_P-C of FT:mat_peptide KJ173289_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX038C(e252)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173290_HBc_P-C Product feature CHAIN KJ173290_HBc_P-C of FT:mat_peptide KJ173290_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX038M(e253n)). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173291_HBc_P-C Product feature CHAIN KJ173291_HBc_P-C of FT:mat_peptide KJ173291_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX050C(e275n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173292_HBc_P-C Product feature CHAIN KJ173292_HBc_P-C of FT:mat_peptide KJ173292_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX050M(e276n)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173293_HBc_P-C Product feature CHAIN KJ173293_HBc_P-C of FT:mat_peptide KJ173293_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX063C(e307)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173294_HBc_P-C Product feature CHAIN KJ173294_HBc_P-C of FT:mat_peptide KJ173294_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX063M(e308)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173295_HBc_P-C Product feature CHAIN KJ173295_HBc_P-C of FT:mat_peptide KJ173295_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH001C(e44)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPXRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|KJ173296_HBc_P-C Product feature CHAIN KJ173296_HBc_P-C of FT:mat_peptide KJ173296_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH001M(e45)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173301_HBc_P-C Product feature CHAIN KJ173301_HBc_P-C of FT:mat_peptide KJ173301_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB129C(m130)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173302_HBc_P-C Product feature CHAIN KJ173302_HBc_P-C of FT:mat_peptide KJ173302_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB129M(m129)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173303_HBc_P-C Product feature CHAIN KJ173303_HBc_P-C of FT:mat_peptide KJ173303_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB215C(m216)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173304_HBc_P-C Product feature CHAIN KJ173304_HBc_P-C of FT:mat_peptide KJ173304_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB215M(m215)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173305_HBc_P-C Product feature CHAIN KJ173305_HBc_P-C of FT:mat_peptide KJ173305_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB023C(m24)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173306_HBc_P-C Product feature CHAIN KJ173306_HBc_P-C of FT:mat_peptide KJ173306_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB023M(M23)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173307_HBc_P-C Product feature CHAIN KJ173307_HBc_P-C of FT:mat_peptide KJ173307_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB255C(m256)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173308_HBc_P-C Product feature CHAIN KJ173308_HBc_P-C of FT:mat_peptide KJ173308_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB255M(m255)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173309_HBc_P-C Product feature CHAIN KJ173309_HBc_P-C of FT:mat_peptide KJ173309_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB045C(m46)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173310_HBc_P-C Product feature CHAIN KJ173310_HBc_P-C of FT:mat_peptide KJ173310_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB045M(m45)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173311_HBc_P-C Product feature CHAIN KJ173311_HBc_P-C of FT:mat_peptide KJ173311_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH005C(e49)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173312_HBc_P-C Product feature CHAIN KJ173312_HBc_P-C of FT:mat_peptide KJ173312_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH005M(e50)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173313_HBc_P-C Product feature CHAIN KJ173313_HBc_P-C of FT:mat_peptide KJ173313_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH006C(e34)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173314_HBc_P-C Product feature CHAIN KJ173314_HBc_P-C of FT:mat_peptide KJ173314_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH006M(e35)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173315_HBc_P-C Product feature CHAIN KJ173315_HBc_P-C of FT:mat_peptide KJ173315_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH017C(e36)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173316_HBc_P-C Product feature CHAIN KJ173316_HBc_P-C of FT:mat_peptide KJ173316_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH017M(e37)). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173317_HBc_P-C Product feature CHAIN KJ173317_HBc_P-C of FT:mat_peptide KJ173317_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH25C(e38)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173319_HBc_P-C Product feature CHAIN KJ173319_HBc_P-C of FT:mat_peptide KJ173319_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH29C(e40)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173321_HBc_P-C Product feature CHAIN KJ173321_HBc_P-C of FT:mat_peptide KJ173321_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH30C(e43)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173324_HBc_P-C Product feature CHAIN KJ173324_HBc_P-C of FT:mat_peptide KJ173324_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P001-M(003)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173327_HBc_P-C Product feature CHAIN KJ173327_HBc_P-C of FT:mat_peptide KJ173327_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P005_C(017)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173328_HBc_P-C Product feature CHAIN KJ173328_HBc_P-C of FT:mat_peptide KJ173328_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P005-M(327)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173331_HBc_P-C Product feature CHAIN KJ173331_HBc_P-C of FT:mat_peptide KJ173331_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY002C(e101)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173332_HBc_P-C Product feature CHAIN KJ173332_HBc_P-C of FT:mat_peptide KJ173332_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY002M(e102)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173333_HBc_P-C Product feature CHAIN KJ173333_HBc_P-C of FT:mat_peptide KJ173333_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY003C(e104)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173335_HBc_P-C Product feature CHAIN KJ173335_HBc_P-C of FT:mat_peptide KJ173335_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY010C(e112)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173336_HBc_P-C Product feature CHAIN KJ173336_HBc_P-C of FT:mat_peptide KJ173336_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY010M(e113)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173337_HBc_P-C Product feature CHAIN KJ173337_HBc_P-C of FT:mat_peptide KJ173337_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY028C(e133)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173391_HBc_P-C Product feature CHAIN KJ173391_HBc_P-C of FT:mat_peptide KJ173391_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac01-M(m601)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173392_HBc_P-C Product feature CHAIN KJ173392_HBc_P-C of FT:mat_peptide KJ173392_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac01-C(m602)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173393_HBc_P-C Product feature CHAIN KJ173393_HBc_P-C of FT:mat_peptide KJ173393_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac04-M(m611)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173394_HBc_P-C Product feature CHAIN KJ173394_HBc_P-C of FT:mat_peptide KJ173394_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac04-C(m612)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173395_HBc_P-C Product feature CHAIN KJ173395_HBc_P-C of FT:mat_peptide KJ173395_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac06-M(m619)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173396_HBc_P-C Product feature CHAIN KJ173396_HBc_P-C of FT:mat_peptide KJ173396_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac06-C(m620)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173426_HBc_P-C Product feature CHAIN KJ173426_HBc_P-C of FT:mat_peptide KJ173426_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_CLP(3)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173427_HBc_P-C Product feature CHAIN KJ173427_HBc_P-C of FT:mat_peptide KJ173427_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N01-M(011A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173428_HBc_P-C Product feature CHAIN KJ173428_HBc_P-C of FT:mat_peptide KJ173428_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N01-C(011B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173429_HBc_P-C Product feature CHAIN KJ173429_HBc_P-C of FT:mat_peptide KJ173429_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N02-M(085A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173430_HBc_P-C Product feature CHAIN KJ173430_HBc_P-C of FT:mat_peptide KJ173430_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N02-C(085B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173431_HBc_P-C Product feature CHAIN KJ173431_HBc_P-C of FT:mat_peptide KJ173431_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N04-M(158A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173432_HBc_P-C Product feature CHAIN KJ173432_HBc_P-C of FT:mat_peptide KJ173432_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N04-C(158B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173433_HBc_P-C Product feature CHAIN KJ173433_HBc_P-C of FT:mat_peptide KJ173433_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N05-M(159A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173434_HBc_P-C Product feature CHAIN KJ173434_HBc_P-C of FT:mat_peptide KJ173434_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N05-C(159B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173435_HBc_P-C Product feature CHAIN KJ173435_HBc_P-C of FT:mat_peptide KJ173435_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N06-M(166A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173436_HBc_P-C Product feature CHAIN KJ173436_HBc_P-C of FT:mat_peptide KJ173436_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N06-C(166B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173437_HBc_P-C Product feature CHAIN KJ173437_HBc_P-C of FT:mat_peptide KJ173437_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N08-M(6615A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173438_HBc_P-C Product feature CHAIN KJ173438_HBc_P-C of FT:mat_peptide KJ173438_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N08-C(3547B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173439_HBc_P-C Product feature CHAIN KJ173439_HBc_P-C of FT:mat_peptide KJ173439_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N12-M(6600A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173440_HBc_P-C Product feature CHAIN KJ173440_HBc_P-C of FT:mat_peptide KJ173440_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N12-C(4131B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173441_HBc_P-C Product feature CHAIN KJ173441_HBc_P-C of FT:mat_peptide KJ173441_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N17-M(199A)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173442_HBc_P-C Product feature CHAIN KJ173442_HBc_P-C of FT:mat_peptide KJ173442_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N17-C(199B)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173443_HBc_P-C Product feature CHAIN KJ173443_HBc_P-C of FT:mat_peptide KJ173443_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N207M(e413)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173444_HBc_P-C Product feature CHAIN KJ173444_HBc_P-C of FT:mat_peptide KJ173444_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N207C(e414)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173445_HBc_P-C Product feature CHAIN KJ173445_HBc_P-C of FT:mat_peptide KJ173445_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N208M(e415)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173446_HBc_P-C Product feature CHAIN KJ173446_HBc_P-C of FT:mat_peptide KJ173446_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N208C(e416)). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410489_HBc_P-C Product feature CHAIN KJ410489_HBc_P-C of FT:mat_peptide KJ410489_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1202). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410491_HBc_P-C Product feature CHAIN KJ410491_HBc_P-C of FT:mat_peptide KJ410491_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1323). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410492_HBc_P-C Product feature CHAIN KJ410492_HBc_P-C of FT:mat_peptide KJ410492_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1313). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410494_HBc_P-C Product feature CHAIN KJ410494_HBc_P-C of FT:mat_peptide KJ410494_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1100). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410495_HBc_P-C Product feature CHAIN KJ410495_HBc_P-C of FT:mat_peptide KJ410495_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1324). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410496_HBc_P-C Product feature CHAIN KJ410496_HBc_P-C of FT:mat_peptide KJ410496_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1095). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRSRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410498_HBc_P-C Product feature CHAIN KJ410498_HBc_P-C of FT:mat_peptide KJ410498_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK0015). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KJ410499_HBc_P-C Product feature CHAIN KJ410499_HBc_P-C of FT:mat_peptide KJ410499_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1328). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410501_HBc_P-C Product feature CHAIN KJ410501_HBc_P-C of FT:mat_peptide KJ410501_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK532). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410504_HBc_P-C Product feature CHAIN KJ410504_HBc_P-C of FT:mat_peptide KJ410504_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK315). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410505_HBc_P-C Product feature CHAIN KJ410505_HBc_P-C of FT:mat_peptide KJ410505_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HBV320). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410508_HBc_P-C Product feature CHAIN KJ410508_HBc_P-C of FT:mat_peptide KJ410508_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK346). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410510_HBc_P-C Product feature CHAIN KJ410510_HBc_P-C of FT:mat_peptide KJ410510_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK323). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALHREALESPEHCSPHHTAFRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGMKISQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410511_HBc_P-C Product feature CHAIN KJ410511_HBc_P-C of FT:mat_peptide KJ410511_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESGC
>gnl|hbvpro|KJ410513_HBc_P-C Product feature CHAIN KJ410513_HBc_P-C of FT:mat_peptide KJ410513_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK523). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410514_HBc_P-C Product feature CHAIN KJ410514_HBc_P-C of FT:mat_peptide KJ410514_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPA
SREAVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410515_HBc_P-C Product feature CHAIN KJ410515_HBc_P-C of FT:mat_peptide KJ410515_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK319). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAYQELLSFLPSDFFPTIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410518_HBc_P-C Product feature CHAIN KJ410518_HBc_P-C of FT:mat_peptide KJ410518_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK313). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSAHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KJ410519_HBc_P-C Product feature CHAIN KJ410519_HBc_P-C of FT:mat_peptide KJ410519_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK514). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410521_HBc_P-C Product feature CHAIN KJ410521_HBc_P-C of FT:mat_peptide KJ410521_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598635_HBc_P-C Product feature CHAIN KJ598635_HBc_P-C of FT:mat_peptide KJ598635_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598636_HBc_P-C Product feature CHAIN KJ598636_HBc_P-C of FT:mat_peptide KJ598636_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598637_HBc_P-C Product feature CHAIN KJ598637_HBc_P-C of FT:mat_peptide KJ598637_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C5). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598638_HBc_P-C Product feature CHAIN KJ598638_HBc_P-C of FT:mat_peptide KJ598638_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598639_HBc_P-C Product feature CHAIN KJ598639_HBc_P-C of FT:mat_peptide KJ598639_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598640_HBc_P-C Product feature CHAIN KJ598640_HBc_P-C of FT:mat_peptide KJ598640_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C10). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598641_HBc_P-C Product feature CHAIN KJ598641_HBc_P-C of FT:mat_peptide KJ598641_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB113). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598642_HBc_P-C Product feature CHAIN KJ598642_HBc_P-C of FT:mat_peptide KJ598642_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1A4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREAFESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598644_HBc_P-C Product feature CHAIN KJ598644_HBc_P-C of FT:mat_peptide KJ598644_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598645_HBc_P-C Product feature CHAIN KJ598645_HBc_P-C of FT:mat_peptide KJ598645_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB210). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598646_HBc_P-C Product feature CHAIN KJ598646_HBc_P-C of FT:mat_peptide KJ598646_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598647_HBc_P-C Product feature CHAIN KJ598647_HBc_P-C of FT:mat_peptide KJ598647_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598648_HBc_P-C Product feature CHAIN KJ598648_HBc_P-C of FT:mat_peptide KJ598648_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598649_HBc_P-C Product feature CHAIN KJ598649_HBc_P-C of FT:mat_peptide KJ598649_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SA8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598650_HBc_P-C Product feature CHAIN KJ598650_HBc_P-C of FT:mat_peptide KJ598650_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SA15). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPLDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598651_HBc_P-C Product feature CHAIN KJ598651_HBc_P-C of FT:mat_peptide KJ598651_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SB4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598652_HBc_P-C Product feature CHAIN KJ598652_HBc_P-C of FT:mat_peptide KJ598652_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598653_HBc_P-C Product feature CHAIN KJ598653_HBc_P-C of FT:mat_peptide KJ598653_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB28). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598654_HBc_P-C Product feature CHAIN KJ598654_HBc_P-C of FT:mat_peptide KJ598654_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB211). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
SSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598655_HBc_P-C Product feature CHAIN KJ598655_HBc_P-C of FT:mat_peptide KJ598655_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB212). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598656_HBc_P-C Product feature CHAIN KJ598656_HBc_P-C of FT:mat_peptide KJ598656_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB214). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598657_HBc_P-C Product feature CHAIN KJ598657_HBc_P-C of FT:mat_peptide KJ598657_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB215). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
SSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598658_HBc_P-C Product feature CHAIN KJ598658_HBc_P-C of FT:mat_peptide KJ598658_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2A8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598659_HBc_P-C Product feature CHAIN KJ598659_HBc_P-C of FT:mat_peptide KJ598659_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598660_HBc_P-C Product feature CHAIN KJ598660_HBc_P-C of FT:mat_peptide KJ598660_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB213). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598661_HBc_P-C Product feature CHAIN KJ598661_HBc_P-C of FT:mat_peptide KJ598661_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598662_HBc_P-C Product feature CHAIN KJ598662_HBc_P-C of FT:mat_peptide KJ598662_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRATVLEYLVSFGVWIRTPTAYRPQNAPILSTLPETTVIRQRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598663_HBc_P-C Product feature CHAIN KJ598663_HBc_P-C of FT:mat_peptide KJ598663_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB311). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598664_HBc_P-C Product feature CHAIN KJ598664_HBc_P-C of FT:mat_peptide KJ598664_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB312). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598665_HBc_P-C Product feature CHAIN KJ598665_HBc_P-C of FT:mat_peptide KJ598665_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB314). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHKALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598666_HBc_P-C Product feature CHAIN KJ598666_HBc_P-C of FT:mat_peptide KJ598666_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB3A1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598667_HBc_P-C Product feature CHAIN KJ598667_HBc_P-C of FT:mat_peptide KJ598667_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVYVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598668_HBc_P-C Product feature CHAIN KJ598668_HBc_P-C of FT:mat_peptide KJ598668_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598669_HBc_P-C Product feature CHAIN KJ598669_HBc_P-C of FT:mat_peptide KJ598669_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598670_HBc_P-C Product feature CHAIN KJ598670_HBc_P-C of FT:mat_peptide KJ598670_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598671_HBc_P-C Product feature CHAIN KJ598671_HBc_P-C of FT:mat_peptide KJ598671_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598672_HBc_P-C Product feature CHAIN KJ598672_HBc_P-C of FT:mat_peptide KJ598672_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB310). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPSNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598673_HBc_P-C Product feature CHAIN KJ598673_HBc_P-C of FT:mat_peptide KJ598673_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB3A3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598674_HBc_P-C Product feature CHAIN KJ598674_HBc_P-C of FT:mat_peptide KJ598674_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB3B1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598676_HBc_P-C Product feature CHAIN KJ598676_HBc_P-C of FT:mat_peptide KJ598676_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB3B3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598677_HBc_P-C Product feature CHAIN KJ598677_HBc_P-C of FT:mat_peptide KJ598677_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB3B4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598678_HBc_P-C Product feature CHAIN KJ598678_HBc_P-C of FT:mat_peptide KJ598678_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB3C2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRATVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598679_HBc_P-C Product feature CHAIN KJ598679_HBc_P-C of FT:mat_peptide KJ598679_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598680_HBc_P-C Product feature CHAIN KJ598680_HBc_P-C of FT:mat_peptide KJ598680_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598681_HBc_P-C Product feature CHAIN KJ598681_HBc_P-C of FT:mat_peptide KJ598681_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598686_HBc_P-C Product feature CHAIN KJ598686_HBc_P-C of FT:mat_peptide KJ598686_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB411). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598687_HBc_P-C Product feature CHAIN KJ598687_HBc_P-C of FT:mat_peptide KJ598687_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB413). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQA
SRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598688_HBc_P-C Product feature CHAIN KJ598688_HBc_P-C of FT:mat_peptide KJ598688_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC110). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598689_HBc_P-C Product feature CHAIN KJ598689_HBc_P-C of FT:mat_peptide KJ598689_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC140). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598690_HBc_P-C Product feature CHAIN KJ598690_HBc_P-C of FT:mat_peptide KJ598690_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598691_HBc_P-C Product feature CHAIN KJ598691_HBc_P-C of FT:mat_peptide KJ598691_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|KJ598694_HBc_P-C Product feature CHAIN KJ598694_HBc_P-C of FT:mat_peptide KJ598694_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC115). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598695_HBc_P-C Product feature CHAIN KJ598695_HBc_P-C of FT:mat_peptide KJ598695_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598696_HBc_P-C Product feature CHAIN KJ598696_HBc_P-C of FT:mat_peptide KJ598696_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC121). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598697_HBc_P-C Product feature CHAIN KJ598697_HBc_P-C of FT:mat_peptide KJ598697_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC123). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598698_HBc_P-C Product feature CHAIN KJ598698_HBc_P-C of FT:mat_peptide KJ598698_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC128). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598699_HBc_P-C Product feature CHAIN KJ598699_HBc_P-C of FT:mat_peptide KJ598699_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598701_HBc_P-C Product feature CHAIN KJ598701_HBc_P-C of FT:mat_peptide KJ598701_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC132). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598705_HBc_P-C Product feature CHAIN KJ598705_HBc_P-C of FT:mat_peptide KJ598705_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598706_HBc_P-C Product feature CHAIN KJ598706_HBc_P-C of FT:mat_peptide KJ598706_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598707_HBc_P-C Product feature CHAIN KJ598707_HBc_P-C of FT:mat_peptide KJ598707_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB56). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598708_HBc_P-C Product feature CHAIN KJ598708_HBc_P-C of FT:mat_peptide KJ598708_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598709_HBc_P-C Product feature CHAIN KJ598709_HBc_P-C of FT:mat_peptide KJ598709_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB511). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598710_HBc_P-C Product feature CHAIN KJ598710_HBc_P-C of FT:mat_peptide KJ598710_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB513). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598711_HBc_P-C Product feature CHAIN KJ598711_HBc_P-C of FT:mat_peptide KJ598711_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB515). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598712_HBc_P-C Product feature CHAIN KJ598712_HBc_P-C of FT:mat_peptide KJ598712_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB517). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598713_HBc_P-C Product feature CHAIN KJ598713_HBc_P-C of FT:mat_peptide KJ598713_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB518). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598714_HBc_P-C Product feature CHAIN KJ598714_HBc_P-C of FT:mat_peptide KJ598714_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB520). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598715_HBc_P-C Product feature CHAIN KJ598715_HBc_P-C of FT:mat_peptide KJ598715_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB521). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598716_HBc_P-C Product feature CHAIN KJ598716_HBc_P-C of FT:mat_peptide KJ598716_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598717_HBc_P-C Product feature CHAIN KJ598717_HBc_P-C of FT:mat_peptide KJ598717_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5102). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598718_HBc_P-C Product feature CHAIN KJ598718_HBc_P-C of FT:mat_peptide KJ598718_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5103). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598719_HBc_P-C Product feature CHAIN KJ598719_HBc_P-C of FT:mat_peptide KJ598719_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598720_HBc_P-C Product feature CHAIN KJ598720_HBc_P-C of FT:mat_peptide KJ598720_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598721_HBc_P-C Product feature CHAIN KJ598721_HBc_P-C of FT:mat_peptide KJ598721_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB62). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598722_HBc_P-C Product feature CHAIN KJ598722_HBc_P-C of FT:mat_peptide KJ598722_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598723_HBc_P-C Product feature CHAIN KJ598723_HBc_P-C of FT:mat_peptide KJ598723_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB66). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598724_HBc_P-C Product feature CHAIN KJ598724_HBc_P-C of FT:mat_peptide KJ598724_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598725_HBc_P-C Product feature CHAIN KJ598725_HBc_P-C of FT:mat_peptide KJ598725_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB69). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598726_HBc_P-C Product feature CHAIN KJ598726_HBc_P-C of FT:mat_peptide KJ598726_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB610). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598727_HBc_P-C Product feature CHAIN KJ598727_HBc_P-C of FT:mat_peptide KJ598727_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB612). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598728_HBc_P-C Product feature CHAIN KJ598728_HBc_P-C of FT:mat_peptide KJ598728_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB613). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598729_HBc_P-C Product feature CHAIN KJ598729_HBc_P-C of FT:mat_peptide KJ598729_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB614). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598730_HBc_P-C Product feature CHAIN KJ598730_HBc_P-C of FT:mat_peptide KJ598730_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB617). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598731_HBc_P-C Product feature CHAIN KJ598731_HBc_P-C of FT:mat_peptide KJ598731_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB618). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598732_HBc_P-C Product feature CHAIN KJ598732_HBc_P-C of FT:mat_peptide KJ598732_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB619). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598733_HBc_P-C Product feature CHAIN KJ598733_HBc_P-C of FT:mat_peptide KJ598733_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB620). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598734_HBc_P-C Product feature CHAIN KJ598734_HBc_P-C of FT:mat_peptide KJ598734_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB621). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598735_HBc_P-C Product feature CHAIN KJ598735_HBc_P-C of FT:mat_peptide KJ598735_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB622). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598736_HBc_P-C Product feature CHAIN KJ598736_HBc_P-C of FT:mat_peptide KJ598736_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB63). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598737_HBc_P-C Product feature CHAIN KJ598737_HBc_P-C of FT:mat_peptide KJ598737_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB624). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598738_HBc_P-C Product feature CHAIN KJ598738_HBc_P-C of FT:mat_peptide KJ598738_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB625). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598739_HBc_P-C Product feature CHAIN KJ598739_HBc_P-C of FT:mat_peptide KJ598739_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB627). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598740_HBc_P-C Product feature CHAIN KJ598740_HBc_P-C of FT:mat_peptide KJ598740_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB71). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598741_HBc_P-C Product feature CHAIN KJ598741_HBc_P-C of FT:mat_peptide KJ598741_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB72). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598742_HBc_P-C Product feature CHAIN KJ598742_HBc_P-C of FT:mat_peptide KJ598742_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598743_HBc_P-C Product feature CHAIN KJ598743_HBc_P-C of FT:mat_peptide KJ598743_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB77). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598744_HBc_P-C Product feature CHAIN KJ598744_HBc_P-C of FT:mat_peptide KJ598744_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB78). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598746_HBc_P-C Product feature CHAIN KJ598746_HBc_P-C of FT:mat_peptide KJ598746_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB710). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598747_HBc_P-C Product feature CHAIN KJ598747_HBc_P-C of FT:mat_peptide KJ598747_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB713). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598748_HBc_P-C Product feature CHAIN KJ598748_HBc_P-C of FT:mat_peptide KJ598748_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB714). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598749_HBc_P-C Product feature CHAIN KJ598749_HBc_P-C of FT:mat_peptide KJ598749_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB715). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598750_HBc_P-C Product feature CHAIN KJ598750_HBc_P-C of FT:mat_peptide KJ598750_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB716). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598751_HBc_P-C Product feature CHAIN KJ598751_HBc_P-C of FT:mat_peptide KJ598751_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB718). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598752_HBc_P-C Product feature CHAIN KJ598752_HBc_P-C of FT:mat_peptide KJ598752_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB720). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598753_HBc_P-C Product feature CHAIN KJ598753_HBc_P-C of FT:mat_peptide KJ598753_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB721). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598754_HBc_P-C Product feature CHAIN KJ598754_HBc_P-C of FT:mat_peptide KJ598754_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB724). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598762_HBc_P-C Product feature CHAIN KJ598762_HBc_P-C of FT:mat_peptide KJ598762_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLC1A0). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALCREALESPGHCSPHHTALRQAILCCGELMNLATWVGNNLEDQA
SRELVVSYVNANMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|KJ598772_HBc_P-C Product feature CHAIN KJ598772_HBc_P-C of FT:mat_peptide KJ598772_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB812). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598780_HBc_P-C Product feature CHAIN KJ598780_HBc_P-C of FT:mat_peptide KJ598780_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB823). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ790199_HBc_P-C Product feature CHAIN KJ790199_HBc_P-C of FT:mat_peptide KJ790199_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803754_HBc_P-C Product feature CHAIN KJ803754_HBc_P-C of FT:mat_peptide KJ803754_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY832150). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ803757_HBc_P-C Product feature CHAIN KJ803757_HBc_P-C of FT:mat_peptide KJ803757_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY333850). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWMRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803759_HBc_P-C Product feature CHAIN KJ803759_HBc_P-C of FT:mat_peptide KJ803759_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY114622). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803760_HBc_P-C Product feature CHAIN KJ803760_HBc_P-C of FT:mat_peptide KJ803760_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY805753). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHAALRQAILCWGELMNLATWVGSNLDDPA
SRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRCRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803761_HBc_P-C Product feature CHAIN KJ803761_HBc_P-C of FT:mat_peptide KJ803761_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY761182). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803762_HBc_P-C Product feature CHAIN KJ803762_HBc_P-C of FT:mat_peptide KJ803762_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY799841). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGIKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KJ803765_HBc_P-C Product feature CHAIN KJ803765_HBc_P-C of FT:mat_peptide KJ803765_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY5205). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803766_HBc_P-C Product feature CHAIN KJ803766_HBc_P-C of FT:mat_peptide KJ803766_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY5113). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KJ803769_HBc_P-C Product feature CHAIN KJ803769_HBc_P-C of FT:mat_peptide KJ803769_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY630304). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803770_HBc_P-C Product feature CHAIN KJ803770_HBc_P-C of FT:mat_peptide KJ803770_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY836190). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGEVMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803774_HBc_P-C Product feature CHAIN KJ803774_HBc_P-C of FT:mat_peptide KJ803774_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY98472). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTLWRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803776_HBc_P-C Product feature CHAIN KJ803776_HBc_P-C of FT:mat_peptide KJ803776_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY854757). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLEDPT
SREAVVGYVNVNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803777_HBc_P-C Product feature CHAIN KJ803777_HBc_P-C of FT:mat_peptide KJ803777_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY772684). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVRQRGRSLRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KJ803779_HBc_P-C Product feature CHAIN KJ803779_HBc_P-C of FT:mat_peptide KJ803779_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY814443). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQCC
>gnl|hbvpro|KJ803780_HBc_P-C Product feature CHAIN KJ803780_HBc_P-C of FT:mat_peptide KJ803780_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY797212). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803790_HBc_P-C Product feature CHAIN KJ803790_HBc_P-C of FT:mat_peptide KJ803790_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY853912). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQCRESQC
>gnl|hbvpro|KJ803792_HBc_P-C Product feature CHAIN KJ803792_HBc_P-C of FT:mat_peptide KJ803792_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY851636). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803793_HBc_P-C Product feature CHAIN KJ803793_HBc_P-C of FT:mat_peptide KJ803793_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY843805). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803799_HBc_P-C Product feature CHAIN KJ803799_HBc_P-C of FT:mat_peptide KJ803799_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY677465). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803809_HBc_P-C Product feature CHAIN KJ803809_HBc_P-C of FT:mat_peptide KJ803809_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY571524). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAIVCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVIRSRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSRC
>gnl|hbvpro|KJ803810_HBc_P-C Product feature CHAIN KJ803810_HBc_P-C of FT:mat_peptide KJ803810_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY193082). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYNEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ803811_HBc_P-C Product feature CHAIN KJ803811_HBc_P-C of FT:mat_peptide KJ803811_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY511545). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803812_HBc_P-C Product feature CHAIN KJ803812_HBc_P-C of FT:mat_peptide KJ803812_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY501336). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLMFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRSLRRRT
PSPRRRRSQSPLRRRSQSREPQCY
>gnl|hbvpro|KJ803813_HBc_P-C Product feature CHAIN KJ803813_HBc_P-C of FT:mat_peptide KJ803813_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY402913). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803814_HBc_P-C Product feature CHAIN KJ803814_HBc_P-C of FT:mat_peptide KJ803814_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY062175). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPLRRTSQSRESQC
>gnl|hbvpro|KJ803815_HBc_P-C Product feature CHAIN KJ803815_HBc_P-C of FT:mat_peptide KJ803815_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY070852). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPLRRTSQSRESQC
>gnl|hbvpro|KJ803818_HBc_P-C Product feature CHAIN KJ803818_HBc_P-C of FT:mat_peptide KJ803818_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY403021). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803823_HBc_P-C Product feature CHAIN KJ803823_HBc_P-C of FT:mat_peptide KJ803823_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY342396). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KJ803826_HBc_P-C Product feature CHAIN KJ803826_HBc_P-C of FT:mat_peptide KJ803826_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY491357). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KM213037_HBc_P-C Product feature CHAIN KM213037_HBc_P-C of FT:mat_peptide KM213037_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X15-k1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM229703_HBc_P-C Product feature CHAIN KM229703_HBc_P-C of FT:mat_peptide KM229703_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3115). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM359441_HBc_P-C Product feature CHAIN KM359441_HBc_P-C of FT:mat_peptide KM359441_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526744_HBc_P-C Product feature CHAIN KM526744_HBc_P-C of FT:mat_peptide KM526744_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Sanana). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526745_HBc_P-C Product feature CHAIN KM526745_HBc_P-C of FT:mat_peptide KM526745_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Makian). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM526746_HBc_P-C Product feature CHAIN KM526746_HBc_P-C of FT:mat_peptide KM526746_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Gotowasi). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875404_HBc_P-C Product feature CHAIN KM875404_HBc_P-C of FT:mat_peptide KM875404_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt1N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTTYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875412_HBc_P-C Product feature CHAIN KM875412_HBc_P-C of FT:mat_peptide KM875412_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt6N). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQVILCWGELMNLATWVGSNLEDPS
SRELVVSYVNVNMGLKLRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875424_HBc_P-C Product feature CHAIN KM875424_HBc_P-C of FT:mat_peptide KM875424_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt13N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875425_HBc_P-C Product feature CHAIN KM875425_HBc_P-C of FT:mat_peptide KM875425_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt13T). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRALLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875428_HBc_P-C Product feature CHAIN KM875428_HBc_P-C of FT:mat_peptide KM875428_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt15N). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KM875430_HBc_P-C Product feature CHAIN KM875430_HBc_P-C of FT:mat_peptide KM875430_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt16N). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP027477_HBc_P-C Product feature CHAIN KP027477_HBc_P-C of FT:mat_peptide KP027477_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148315_HBc_P-C Product feature CHAIN KP148315_HBc_P-C of FT:mat_peptide KP148315_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148462_HBc_P-C Product feature CHAIN KP148462_HBc_P-C of FT:mat_peptide KP148462_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP148463_HBc_P-C Product feature CHAIN KP148463_HBc_P-C of FT:mat_peptide KP148463_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148464_HBc_P-C Product feature CHAIN KP148464_HBc_P-C of FT:mat_peptide KP148464_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148465_HBc_P-C Product feature CHAIN KP148465_HBc_P-C of FT:mat_peptide KP148465_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148466_HBc_P-C Product feature CHAIN KP148466_HBc_P-C of FT:mat_peptide KP148466_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148468_HBc_P-C Product feature CHAIN KP148468_HBc_P-C of FT:mat_peptide KP148468_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148469_HBc_P-C Product feature CHAIN KP148469_HBc_P-C of FT:mat_peptide KP148469_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148470_HBc_P-C Product feature CHAIN KP148470_HBc_P-C of FT:mat_peptide KP148470_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALGSPEHCSPHHTALRQAILCWGELMDLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148471_HBc_P-C Product feature CHAIN KP148471_HBc_P-C of FT:mat_peptide KP148471_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148472_HBc_P-C Product feature CHAIN KP148472_HBc_P-C of FT:mat_peptide KP148472_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-8). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDP
ASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRR
TPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148473_HBc_P-C Product feature CHAIN KP148473_HBc_P-C of FT:mat_peptide KP148473_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148474_HBc_P-C Product feature CHAIN KP148474_HBc_P-C of FT:mat_peptide KP148474_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVSVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148475_HBc_P-C Product feature CHAIN KP148475_HBc_P-C of FT:mat_peptide KP148475_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISRLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148476_HBc_P-C Product feature CHAIN KP148476_HBc_P-C of FT:mat_peptide KP148476_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREAFESPEHCSPHHTALRQAILCWGELVNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148477_HBc_P-C Product feature CHAIN KP148477_HBc_P-C of FT:mat_peptide KP148477_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-18). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDP
ASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRR
TPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148480_HBc_P-C Product feature CHAIN KP148480_HBc_P-C of FT:mat_peptide KP148480_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDYFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148481_HBc_P-C Product feature CHAIN KP148481_HBc_P-C of FT:mat_peptide KP148481_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148482_HBc_P-C Product feature CHAIN KP148482_HBc_P-C of FT:mat_peptide KP148482_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148487_HBc_P-C Product feature CHAIN KP148487_HBc_P-C of FT:mat_peptide KP148487_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-30). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148488_HBc_P-C Product feature CHAIN KP148488_HBc_P-C of FT:mat_peptide KP148488_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRHRRSQSRESQC
>gnl|hbvpro|KP148489_HBc_P-C Product feature CHAIN KP148489_HBc_P-C of FT:mat_peptide KP148489_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148492_HBc_P-C Product feature CHAIN KP148492_HBc_P-C of FT:mat_peptide KP148492_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148493_HBc_P-C Product feature CHAIN KP148493_HBc_P-C of FT:mat_peptide KP148493_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-37). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148512_HBc_P-C Product feature CHAIN KP148512_HBc_P-C of FT:mat_peptide KP148512_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148513_HBc_P-C Product feature CHAIN KP148513_HBc_P-C of FT:mat_peptide KP148513_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148517_HBc_P-C Product feature CHAIN KP148517_HBc_P-C of FT:mat_peptide KP148517_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148520_HBc_P-C Product feature CHAIN KP148520_HBc_P-C of FT:mat_peptide KP148520_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGVSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148521_HBc_P-C Product feature CHAIN KP148521_HBc_P-C of FT:mat_peptide KP148521_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148523_HBc_P-C Product feature CHAIN KP148523_HBc_P-C of FT:mat_peptide KP148523_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148524_HBc_P-C Product feature CHAIN KP148524_HBc_P-C of FT:mat_peptide KP148524_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148525_HBc_P-C Product feature CHAIN KP148525_HBc_P-C of FT:mat_peptide KP148525_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDYFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGAWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRGSQSRESQC
>gnl|hbvpro|KP148526_HBc_P-C Product feature CHAIN KP148526_HBc_P-C of FT:mat_peptide KP148526_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148528_HBc_P-C Product feature CHAIN KP148528_HBc_P-C of FT:mat_peptide KP148528_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148529_HBc_P-C Product feature CHAIN KP148529_HBc_P-C of FT:mat_peptide KP148529_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148531_HBc_P-C Product feature CHAIN KP148531_HBc_P-C of FT:mat_peptide KP148531_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148532_HBc_P-C Product feature CHAIN KP148532_HBc_P-C of FT:mat_peptide KP148532_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148534_HBc_P-C Product feature CHAIN KP148534_HBc_P-C of FT:mat_peptide KP148534_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-49). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148535_HBc_P-C Product feature CHAIN KP148535_HBc_P-C of FT:mat_peptide KP148535_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148538_HBc_P-C Product feature CHAIN KP148538_HBc_P-C of FT:mat_peptide KP148538_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-63). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148540_HBc_P-C Product feature CHAIN KP148540_HBc_P-C of FT:mat_peptide KP148540_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148545_HBc_P-C Product feature CHAIN KP148545_HBc_P-C of FT:mat_peptide KP148545_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148546_HBc_P-C Product feature CHAIN KP148546_HBc_P-C of FT:mat_peptide KP148546_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTFPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148547_HBc_P-C Product feature CHAIN KP148547_HBc_P-C of FT:mat_peptide KP148547_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRPQSRESQC
>gnl|hbvpro|KP148548_HBc_P-C Product feature CHAIN KP148548_HBc_P-C of FT:mat_peptide KP148548_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148549_HBc_P-C Product feature CHAIN KP148549_HBc_P-C of FT:mat_peptide KP148549_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148551_HBc_P-C Product feature CHAIN KP148551_HBc_P-C of FT:mat_peptide KP148551_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148554_HBc_P-C Product feature CHAIN KP148554_HBc_P-C of FT:mat_peptide KP148554_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148555_HBc_P-C Product feature CHAIN KP148555_HBc_P-C of FT:mat_peptide KP148555_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148557_HBc_P-C Product feature CHAIN KP148557_HBc_P-C of FT:mat_peptide KP148557_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PPPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148558_HBc_P-C Product feature CHAIN KP148558_HBc_P-C of FT:mat_peptide KP148558_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148559_HBc_P-C Product feature CHAIN KP148559_HBc_P-C of FT:mat_peptide KP148559_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRQRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148560_HBc_P-C Product feature CHAIN KP148560_HBc_P-C of FT:mat_peptide KP148560_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148561_HBc_P-C Product feature CHAIN KP148561_HBc_P-C of FT:mat_peptide KP148561_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148562_HBc_P-C Product feature CHAIN KP148562_HBc_P-C of FT:mat_peptide KP148562_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-55). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148563_HBc_P-C Product feature CHAIN KP148563_HBc_P-C of FT:mat_peptide KP148563_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-56). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLPFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148564_HBc_P-C Product feature CHAIN KP148564_HBc_P-C of FT:mat_peptide KP148564_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPISSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148566_HBc_P-C Product feature CHAIN KP148566_HBc_P-C of FT:mat_peptide KP148566_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148568_HBc_P-C Product feature CHAIN KP148568_HBc_P-C of FT:mat_peptide KP148568_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-62). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKAFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148570_HBc_P-C Product feature CHAIN KP148570_HBc_P-C of FT:mat_peptide KP148570_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148571_HBc_P-C Product feature CHAIN KP148571_HBc_P-C of FT:mat_peptide KP148571_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148572_HBc_P-C Product feature CHAIN KP148572_HBc_P-C of FT:mat_peptide KP148572_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-68). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148573_HBc_P-C Product feature CHAIN KP148573_HBc_P-C of FT:mat_peptide KP148573_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-70). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148574_HBc_P-C Product feature CHAIN KP148574_HBc_P-C of FT:mat_peptide KP148574_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-71). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP784761_HBc_P-C Product feature CHAIN KP784761_HBc_P-C of FT:mat_peptide KP784761_HBc_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6130). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013761_HBc_P-C Product feature CHAIN KR013761_HBc_P-C of FT:mat_peptide KR013761_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSVGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013762_HBc_P-C Product feature CHAIN KR013762_HBc_P-C of FT:mat_peptide KR013762_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQLPRRRRSQSRESQC
>gnl|hbvpro|KR013763_HBc_P-C Product feature CHAIN KR013763_HBc_P-C of FT:mat_peptide KR013763_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013764_HBc_P-C Product feature CHAIN KR013764_HBc_P-C of FT:mat_peptide KR013764_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASAPYREALESPEHCPPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013767_HBc_P-C Product feature CHAIN KR013767_HBc_P-C of FT:mat_peptide KR013767_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013768_HBc_P-C Product feature CHAIN KR013768_HBc_P-C of FT:mat_peptide KR013768_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNVPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013770_HBc_P-C Product feature CHAIN KR013770_HBc_P-C of FT:mat_peptide KR013770_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013771_HBc_P-C Product feature CHAIN KR013771_HBc_P-C of FT:mat_peptide KR013771_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFLPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSRSWESQC
>gnl|hbvpro|KR013772_HBc_P-C Product feature CHAIN KR013772_HBc_P-C of FT:mat_peptide KR013772_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|KR013773_HBc_P-C Product feature CHAIN KR013773_HBc_P-C of FT:mat_peptide KR013773_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCRGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013774_HBc_P-C Product feature CHAIN KR013774_HBc_P-C of FT:mat_peptide KR013774_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013776_HBc_P-C Product feature CHAIN KR013776_HBc_P-C of FT:mat_peptide KR013776_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013777_HBc_P-C Product feature CHAIN KR013777_HBc_P-C of FT:mat_peptide KR013777_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRESVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013779_HBc_P-C Product feature CHAIN KR013779_HBc_P-C of FT:mat_peptide KR013779_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013780_HBc_P-C Product feature CHAIN KR013780_HBc_P-C of FT:mat_peptide KR013780_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCFTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013781_HBc_P-C Product feature CHAIN KR013781_HBc_P-C of FT:mat_peptide KR013781_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVESLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013782_HBc_P-C Product feature CHAIN KR013782_HBc_P-C of FT:mat_peptide KR013782_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013783_HBc_P-C Product feature CHAIN KR013783_HBc_P-C of FT:mat_peptide KR013783_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013784_HBc_P-C Product feature CHAIN KR013784_HBc_P-C of FT:mat_peptide KR013784_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLPDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013785_HBc_P-C Product feature CHAIN KR013785_HBc_P-C of FT:mat_peptide KR013785_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013786_HBc_P-C Product feature CHAIN KR013786_HBc_P-C of FT:mat_peptide KR013786_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013787_HBc_P-C Product feature CHAIN KR013787_HBc_P-C of FT:mat_peptide KR013787_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013788_HBc_P-C Product feature CHAIN KR013788_HBc_P-C of FT:mat_peptide KR013788_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013789_HBc_P-C Product feature CHAIN KR013789_HBc_P-C of FT:mat_peptide KR013789_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013790_HBc_P-C Product feature CHAIN KR013790_HBc_P-C of FT:mat_peptide KR013790_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013791_HBc_P-C Product feature CHAIN KR013791_HBc_P-C of FT:mat_peptide KR013791_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013792_HBc_P-C Product feature CHAIN KR013792_HBc_P-C of FT:mat_peptide KR013792_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMDLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013793_HBc_P-C Product feature CHAIN KR013793_HBc_P-C of FT:mat_peptide KR013793_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLKDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013794_HBc_P-C Product feature CHAIN KR013794_HBc_P-C of FT:mat_peptide KR013794_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013796_HBc_P-C Product feature CHAIN KR013796_HBc_P-C of FT:mat_peptide KR013796_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMDLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYGPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KR013797_HBc_P-C Product feature CHAIN KR013797_HBc_P-C of FT:mat_peptide KR013797_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013798_HBc_P-C Product feature CHAIN KR013798_HBc_P-C of FT:mat_peptide KR013798_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013799_HBc_P-C Product feature CHAIN KR013799_HBc_P-C of FT:mat_peptide KR013799_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013800_HBc_P-C Product feature CHAIN KR013800_HBc_P-C of FT:mat_peptide KR013800_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013801_HBc_P-C Product feature CHAIN KR013801_HBc_P-C of FT:mat_peptide KR013801_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYIEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PLPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013802_HBc_P-C Product feature CHAIN KR013802_HBc_P-C of FT:mat_peptide KR013802_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KR013803_HBc_P-C Product feature CHAIN KR013803_HBc_P-C of FT:mat_peptide KR013803_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013804_HBc_P-C Product feature CHAIN KR013804_HBc_P-C of FT:mat_peptide KR013804_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATRVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013805_HBc_P-C Product feature CHAIN KR013805_HBc_P-C of FT:mat_peptide KR013805_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVASYVNVNMGLKIRQLPWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQLPRRRRSQSRESQC
>gnl|hbvpro|KR013807_HBc_P-C Product feature CHAIN KR013807_HBc_P-C of FT:mat_peptide KR013807_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013808_HBc_P-C Product feature CHAIN KR013808_HBc_P-C of FT:mat_peptide KR013808_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHIPCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013809_HBc_P-C Product feature CHAIN KR013809_HBc_P-C of FT:mat_peptide KR013809_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPKRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013810_HBc_P-C Product feature CHAIN KR013810_HBc_P-C of FT:mat_peptide KR013810_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013811_HBc_P-C Product feature CHAIN KR013811_HBc_P-C of FT:mat_peptide KR013811_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013812_HBc_P-C Product feature CHAIN KR013812_HBc_P-C of FT:mat_peptide KR013812_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013813_HBc_P-C Product feature CHAIN KR013813_HBc_P-C of FT:mat_peptide KR013813_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013814_HBc_P-C Product feature CHAIN KR013814_HBc_P-C of FT:mat_peptide KR013814_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013815_HBc_P-C Product feature CHAIN KR013815_HBc_P-C of FT:mat_peptide KR013815_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013817_HBc_P-C Product feature CHAIN KR013817_HBc_P-C of FT:mat_peptide KR013817_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013818_HBc_P-C Product feature CHAIN KR013818_HBc_P-C of FT:mat_peptide KR013818_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013819_HBc_P-C Product feature CHAIN KR013819_HBc_P-C of FT:mat_peptide KR013819_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEWMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPDAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013820_HBc_P-C Product feature CHAIN KR013820_HBc_P-C of FT:mat_peptide KR013820_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013821_HBc_P-C Product feature CHAIN KR013821_HBc_P-C of FT:mat_peptide KR013821_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013822_HBc_P-C Product feature CHAIN KR013822_HBc_P-C of FT:mat_peptide KR013822_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR013823_HBc_P-C Product feature CHAIN KR013823_HBc_P-C of FT:mat_peptide KR013823_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRGRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR013824_HBc_P-C Product feature CHAIN KR013824_HBc_P-C of FT:mat_peptide KR013824_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013825_HBc_P-C Product feature CHAIN KR013825_HBc_P-C of FT:mat_peptide KR013825_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR013826_HBc_P-C Product feature CHAIN KR013826_HBc_P-C of FT:mat_peptide KR013826_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013827_HBc_P-C Product feature CHAIN KR013827_HBc_P-C of FT:mat_peptide KR013827_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013828_HBc_P-C Product feature CHAIN KR013828_HBc_P-C of FT:mat_peptide KR013828_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013829_HBc_P-C Product feature CHAIN KR013829_HBc_P-C of FT:mat_peptide KR013829_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013830_HBc_P-C Product feature CHAIN KR013830_HBc_P-C of FT:mat_peptide KR013830_HBc_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013831_HBc_P-C Product feature CHAIN KR013831_HBc_P-C of FT:mat_peptide KR013831_HBc_P-C of [Virus